


| Basic Information | |
|---|---|
| Family ID | F079078 |
| Family Type | Metagenome |
| Number of Sequences | 116 |
| Average Sequence Length | 49 residues |
| Representative Sequence | VSRPDRGPEVAVDFAPPRKPNHVRPLAALVVVALAAGAVTVAVTQLLLH |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 86.21 % |
| % of genes near scaffold ends (potentially truncated) | 18.10 % |
| % of genes from short scaffolds (< 2000 bps) | 76.72 % |
| Associated GOLD sequencing projects | 73 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (32.759 % of family members) |
| Environment Ontology (ENVO) | Unclassified (65.517 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (70.690 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.77% β-sheet: 0.00% Coil/Unstructured: 66.23% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF13544 | Obsolete Pfam Family | 33.62 |
| PF07963 | N_methyl | 22.41 |
| PF11104 | PilM_2 | 8.62 |
| PF01966 | HD | 5.17 |
| PF13487 | HD_5 | 3.45 |
| PF00482 | T2SSF | 2.59 |
| PF13614 | AAA_31 | 0.86 |
| PF12728 | HTH_17 | 0.86 |
| PF13185 | GAF_2 | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002558|JGI25385J37094_10091454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 920 | Open in IMG/M |
| 3300002558|JGI25385J37094_10122653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 736 | Open in IMG/M |
| 3300002560|JGI25383J37093_10016208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2478 | Open in IMG/M |
| 3300002560|JGI25383J37093_10128568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 699 | Open in IMG/M |
| 3300002560|JGI25383J37093_10162381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 588 | Open in IMG/M |
| 3300002561|JGI25384J37096_10125109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 856 | Open in IMG/M |
| 3300002561|JGI25384J37096_10151400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 741 | Open in IMG/M |
| 3300002908|JGI25382J43887_10024358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3245 | Open in IMG/M |
| 3300002908|JGI25382J43887_10236689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 850 | Open in IMG/M |
| 3300002908|JGI25382J43887_10364152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 611 | Open in IMG/M |
| 3300002909|JGI25388J43891_1028452 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300002911|JGI25390J43892_10072496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 791 | Open in IMG/M |
| 3300002912|JGI25386J43895_10022420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1861 | Open in IMG/M |
| 3300002915|JGI25387J43893_1032266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 705 | Open in IMG/M |
| 3300005166|Ga0066674_10049257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1899 | Open in IMG/M |
| 3300005167|Ga0066672_10009455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 4610 | Open in IMG/M |
| 3300005167|Ga0066672_10026108 | All Organisms → cellular organisms → Bacteria | 3132 | Open in IMG/M |
| 3300005167|Ga0066672_10897566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 549 | Open in IMG/M |
| 3300005167|Ga0066672_10965642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 523 | Open in IMG/M |
| 3300005171|Ga0066677_10810957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 517 | Open in IMG/M |
| 3300005172|Ga0066683_10204798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1219 | Open in IMG/M |
| 3300005172|Ga0066683_10780190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 558 | Open in IMG/M |
| 3300005177|Ga0066690_10399618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 933 | Open in IMG/M |
| 3300005179|Ga0066684_10089586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1862 | Open in IMG/M |
| 3300005179|Ga0066684_10384319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 941 | Open in IMG/M |
| 3300005181|Ga0066678_10092397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1816 | Open in IMG/M |
| 3300005187|Ga0066675_10260673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1241 | Open in IMG/M |
| 3300005435|Ga0070714_101897338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 581 | Open in IMG/M |
| 3300005445|Ga0070708_100039515 | All Organisms → cellular organisms → Bacteria | 4129 | Open in IMG/M |
| 3300005445|Ga0070708_100337221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1421 | Open in IMG/M |
| 3300005447|Ga0066689_10175166 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300005447|Ga0066689_10443607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 814 | Open in IMG/M |
| 3300005451|Ga0066681_10425408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 816 | Open in IMG/M |
| 3300005451|Ga0066681_10520003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 735 | Open in IMG/M |
| 3300005471|Ga0070698_100000129 | All Organisms → cellular organisms → Bacteria | 65832 | Open in IMG/M |
| 3300005518|Ga0070699_100817895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 853 | Open in IMG/M |
| 3300005542|Ga0070732_10927076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 532 | Open in IMG/M |
| 3300005552|Ga0066701_10134939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1474 | Open in IMG/M |
| 3300005554|Ga0066661_10447184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 790 | Open in IMG/M |
| 3300005555|Ga0066692_10337054 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300005558|Ga0066698_10478793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 847 | Open in IMG/M |
| 3300005559|Ga0066700_10871797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 600 | Open in IMG/M |
| 3300005569|Ga0066705_10415112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 843 | Open in IMG/M |
| 3300005569|Ga0066705_10563408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 704 | Open in IMG/M |
| 3300005574|Ga0066694_10569120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 528 | Open in IMG/M |
| 3300005576|Ga0066708_10693472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 645 | Open in IMG/M |
| 3300006031|Ga0066651_10579477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 596 | Open in IMG/M |
| 3300006173|Ga0070716_101415901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 566 | Open in IMG/M |
| 3300006796|Ga0066665_10429230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1092 | Open in IMG/M |
| 3300006797|Ga0066659_10105742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1925 | Open in IMG/M |
| 3300006800|Ga0066660_10149738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1728 | Open in IMG/M |
| 3300006854|Ga0075425_102609958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 558 | Open in IMG/M |
| 3300007258|Ga0099793_10581753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 560 | Open in IMG/M |
| 3300007265|Ga0099794_10339582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 780 | Open in IMG/M |
| 3300009012|Ga0066710_101342158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1109 | Open in IMG/M |
| 3300009012|Ga0066710_103555826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 588 | Open in IMG/M |
| 3300009038|Ga0099829_10064327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2763 | Open in IMG/M |
| 3300009088|Ga0099830_10295358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1292 | Open in IMG/M |
| 3300009088|Ga0099830_10648275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 868 | Open in IMG/M |
| 3300009090|Ga0099827_10000429 | All Organisms → cellular organisms → Bacteria | 18824 | Open in IMG/M |
| 3300009090|Ga0099827_10016913 | All Organisms → cellular organisms → Bacteria | 4945 | Open in IMG/M |
| 3300009137|Ga0066709_100012612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 7895 | Open in IMG/M |
| 3300009137|Ga0066709_101390287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1022 | Open in IMG/M |
| 3300010326|Ga0134065_10071302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1109 | Open in IMG/M |
| 3300010329|Ga0134111_10405998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 584 | Open in IMG/M |
| 3300010335|Ga0134063_10239959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 860 | Open in IMG/M |
| 3300011270|Ga0137391_10338179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1294 | Open in IMG/M |
| 3300012199|Ga0137383_10013019 | All Organisms → cellular organisms → Bacteria | 5627 | Open in IMG/M |
| 3300012202|Ga0137363_11011232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 706 | Open in IMG/M |
| 3300012203|Ga0137399_10014765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4888 | Open in IMG/M |
| 3300012206|Ga0137380_10196742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1829 | Open in IMG/M |
| 3300012210|Ga0137378_10049317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3786 | Open in IMG/M |
| 3300012211|Ga0137377_11461268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 611 | Open in IMG/M |
| 3300012917|Ga0137395_10283606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1170 | Open in IMG/M |
| 3300012918|Ga0137396_10068449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2476 | Open in IMG/M |
| 3300012927|Ga0137416_11102739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 712 | Open in IMG/M |
| 3300012927|Ga0137416_11724158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 572 | Open in IMG/M |
| 3300012975|Ga0134110_10210585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 818 | Open in IMG/M |
| 3300014150|Ga0134081_10086731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 972 | Open in IMG/M |
| 3300018431|Ga0066655_10112863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1546 | Open in IMG/M |
| 3300018431|Ga0066655_10190446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1259 | Open in IMG/M |
| 3300018433|Ga0066667_10630514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 895 | Open in IMG/M |
| 3300018433|Ga0066667_10750843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 823 | Open in IMG/M |
| 3300021046|Ga0215015_10033485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2483 | Open in IMG/M |
| 3300021046|Ga0215015_10168906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 755 | Open in IMG/M |
| 3300021046|Ga0215015_10846868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 846 | Open in IMG/M |
| 3300025910|Ga0207684_10968714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 713 | Open in IMG/M |
| 3300025939|Ga0207665_10336491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1136 | Open in IMG/M |
| 3300026277|Ga0209350_1005404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 4425 | Open in IMG/M |
| 3300026296|Ga0209235_1038154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2416 | Open in IMG/M |
| 3300026298|Ga0209236_1135442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1067 | Open in IMG/M |
| 3300026300|Ga0209027_1020778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2489 | Open in IMG/M |
| 3300026301|Ga0209238_1008864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3969 | Open in IMG/M |
| 3300026308|Ga0209265_1065894 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300026310|Ga0209239_1028486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2679 | Open in IMG/M |
| 3300026310|Ga0209239_1048501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1924 | Open in IMG/M |
| 3300026318|Ga0209471_1000725 | All Organisms → cellular organisms → Bacteria | 20957 | Open in IMG/M |
| 3300026325|Ga0209152_10282583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 618 | Open in IMG/M |
| 3300026330|Ga0209473_1049996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1827 | Open in IMG/M |
| 3300026499|Ga0257181_1001439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2176 | Open in IMG/M |
| 3300026536|Ga0209058_1067061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1944 | Open in IMG/M |
| 3300026540|Ga0209376_1364177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 544 | Open in IMG/M |
| 3300026548|Ga0209161_10022731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 4465 | Open in IMG/M |
| 3300026548|Ga0209161_10137090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1428 | Open in IMG/M |
| 3300026550|Ga0209474_10115543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1787 | Open in IMG/M |
| 3300026551|Ga0209648_10091518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2513 | Open in IMG/M |
| 3300026551|Ga0209648_10170855 | All Organisms → cellular organisms → Bacteria | 1694 | Open in IMG/M |
| 3300026551|Ga0209648_10467030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 767 | Open in IMG/M |
| 3300026551|Ga0209648_10835695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 504 | Open in IMG/M |
| 3300027846|Ga0209180_10450048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 726 | Open in IMG/M |
| 3300027846|Ga0209180_10769547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 518 | Open in IMG/M |
| 3300027862|Ga0209701_10301892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 919 | Open in IMG/M |
| 3300027882|Ga0209590_10000509 | All Organisms → cellular organisms → Bacteria | 12903 | Open in IMG/M |
| 3300027882|Ga0209590_10031103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2819 | Open in IMG/M |
| 3300032180|Ga0307471_100048462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3482 | Open in IMG/M |
| 3300032180|Ga0307471_104182719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 510 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 32.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 28.45% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.03% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.59% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.72% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.86% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002915 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25385J37094_100914542 | 3300002558 | Grasslands Soil | VSRPDRGPEVAVDFAAPRKPSHVRPLAALVVVALAAGAVTVAVTQLLLH* |
| JGI25385J37094_101226532 | 3300002558 | Grasslands Soil | VAVDFAAPRKPSHVRPLAALVVVALAAGAVTVAVTQLLLH* |
| JGI25383J37093_100162082 | 3300002560 | Grasslands Soil | VSRPDQSPHVAVDFAPPRRPGRTRPLVALVVIVLSLGAVTVAVSQLLLR* |
| JGI25383J37093_101285682 | 3300002560 | Grasslands Soil | VSRPDRGPDVAVDFAPARKPNHVRPLALLVVVALAVGAVTVAVTQLLLR* |
| JGI25383J37093_101623812 | 3300002560 | Grasslands Soil | PDRGPGVAVDFAPPRKPNHVRPLAALVVLALAAGAVTVAVTQLLLH* |
| JGI25384J37096_101251092 | 3300002561 | Grasslands Soil | REVTSVSRPDQPPHVAVDFAPPRRPGRTRPLVALVVTVLSLGAVTVAVSQLLLR* |
| JGI25384J37096_101514002 | 3300002561 | Grasslands Soil | VSRPDRGPEVAVDFAAPRKPSHVRPLAALVVVALAVGAVTVAVTQLLLH* |
| JGI25382J43887_100243581 | 3300002908 | Grasslands Soil | VSRPDRGPEVAVDFAPARKPNHVRPLALLVVVALAVGAVTVAVTQLLLR* |
| JGI25382J43887_102366891 | 3300002908 | Grasslands Soil | VSRPDRGPDVAVDFAPARKPNHVRPLAALVVVALAVGAATVAVTQLLLH* |
| JGI25382J43887_103641522 | 3300002908 | Grasslands Soil | VSRPDRAPDIAVDFAPPRKPSRIRPLAVLVAAVLVAGVVTITVTQLLLR* |
| JGI25388J43891_10284521 | 3300002909 | Grasslands Soil | VSRPDRGPDVAVDFAPPPKPNHLRPLVVLVVVALAAGAAAVAVTQLLLH* |
| JGI25390J43892_100724962 | 3300002911 | Grasslands Soil | VSRPDRGPEVAVDFAPPRKPNHVRPLAALVVLALAAGAVT |
| JGI25386J43895_100224203 | 3300002912 | Grasslands Soil | REVTSVSRPDQSPHVAVDFAPPRRPGRTRPLVALVVIVLSLGAVTVAVSQLLLR* |
| JGI25387J43893_10322661 | 3300002915 | Grasslands Soil | EVTPVSRPDRGPEVAVDFAPPRKPSHVRPLAVLVVVALAAGGVTVAVTQLLLH* |
| Ga0066674_100492573 | 3300005166 | Soil | VSRPERANDVAVDFSPPRRAGRTRPLVGLVIIMLALGAVTVAVTQLLLH* |
| Ga0066672_100094554 | 3300005167 | Soil | VSRPDRAPNIAVDFAPPRNPSRVRPLAVLVATVLAVGVVTIAVTQLVLR* |
| Ga0066672_100261083 | 3300005167 | Soil | VSRPDRGPDVAVDFAPPHKGSRVRPLAALALVVLAVAAVAVAVTQLLLR* |
| Ga0066672_108975662 | 3300005167 | Soil | VSRPDRTPDIAVDFAPPRRPSRVRPLAVLVAVVLMAGVVTVAVTQLLLR* |
| Ga0066672_109656421 | 3300005167 | Soil | VSRPDRGPEVAVDFAPPRKPSHVRPLAVLVVVALAAGAVTVAVTQLLLH* |
| Ga0066677_108109571 | 3300005171 | Soil | VSRPDRGPDVAVDFAPPPKPNHLRPLVVLVVVALAAGAASVAVTQLLLH* |
| Ga0066683_102047983 | 3300005172 | Soil | VSRPDRAFDVAVDFSAPRRAGRTRPLVGLVIIMLALGAVTVAVTQLLLH* |
| Ga0066683_107801902 | 3300005172 | Soil | VSRAERANDVAVDFSPPRRSRRTRPLVGLVLVLLALGAVTVAVTQLLLH* |
| Ga0066690_103996182 | 3300005177 | Soil | VSRPDHAPEVAVDFAPPPRPNRTRPLIALVVVVLIVGAMTVAATQLLLR* |
| Ga0066684_100895861 | 3300005179 | Soil | VSRPDRGPEVAVDFAPPRKPSHVRPLAVLVVVALAAGGVTVAVTQLLLH* |
| Ga0066684_103843192 | 3300005179 | Soil | VSRPDRAFNVAVDFSAPRRAGRTRPLVGLVVIVLALGAVTVAVTQLLLH* |
| Ga0066678_100923972 | 3300005181 | Soil | VSRPDRGPEVAVDFAPPRKPNHVRPLAALVVLALAAGGLTVAVTQLLLH* |
| Ga0066675_102606732 | 3300005187 | Soil | VSRPERANDVAVDFSPPRRSRRTRPLVGLVLVLLALGAVTVAVTQLLLH* |
| Ga0070714_1018973382 | 3300005435 | Agricultural Soil | VSQPDRLPEIAVDFAPPRAASRIRPLAVVAAVVLIAGVVTVAVTQLLLR* |
| Ga0070708_1000395154 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VSRPDRAPDVAVDFSEPRRPGRTRPLVALVAVVLAVGAVIVAVTQLLLR* |
| Ga0070708_1003372212 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VSRPDRGPNVAIDFSPPRHRNHVRPLAALVVVVLIVGAVTVAVTQLLLH* |
| Ga0066689_101751661 | 3300005447 | Soil | HREVTTVSRPDRGPDVAVDFAPPPKPNHVRPLAALVVAALAAGAATVAVTQLLLH* |
| Ga0066689_104436072 | 3300005447 | Soil | VSRPDRAFNVAVDFSAPRRAGRTRPLVGLVVMVLALGAVTVAVTQLLLH* |
| Ga0066681_104254082 | 3300005451 | Soil | VSRPDRAFNVAVDFSAPRRAARTRPLVGLVVIVLALGAVTVAVTQLLLH* |
| Ga0066681_105200031 | 3300005451 | Soil | VSRPDRANDVAVDFSPPRRAGRTRPLVGLVIIMLALGAVTVAVTQLLLH* |
| Ga0070698_10000012936 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VSRPDRAPDVAVDFAPPRQPNHIRPLAALVVVVLALGAVTVAVTQLLLH* |
| Ga0070699_1008178952 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VSRPDRGPDVAVDFSPPRQRDHVRPLAALVVVVLIVGAVTVAVTQLLLH* |
| Ga0070732_109270761 | 3300005542 | Surface Soil | VSRPDRAPQIAVDFAPPRRPSRVRPLAVLATGLLVAALVTVAVTQLLLR* |
| Ga0066701_101349391 | 3300005552 | Soil | VSRPDRGPDVAVDFAPPPKPNHVRPLAALVVAALAAGAATVAVTQLLLH* |
| Ga0066661_104471841 | 3300005554 | Soil | VSRPDRGPDVAVDFAPPHKGSRVRPLAALGLVVLAVAAVAVAVTQLLLR* |
| Ga0066692_103370541 | 3300005555 | Soil | DVAVDFAPPPKPNHVRPLAALLVAALAAGAATVAVTQLLLH* |
| Ga0066698_104787931 | 3300005558 | Soil | VSRPERANDVAVDFSPPRRSARTRPLVGLLLVLLALGAVTVAVTQLLLH* |
| Ga0066700_108717972 | 3300005559 | Soil | VSRPDRGPEVAVDFAPPRKPNHVRPLAALVVVALAAGAVTVAVTQLLLH* |
| Ga0066705_104151121 | 3300005569 | Soil | VSRPDRGPDVAVDFAPPPKPNHLRPLVALVVVSLAAGAAAVAVTQ |
| Ga0066705_105634082 | 3300005569 | Soil | VSRPDRGPEVAVDFAPPRKPNNVRPLAALVVVALAAGAVTVAVTQLLLH* |
| Ga0066694_105691201 | 3300005574 | Soil | VSRPDRGPDVAVDFAPPPKPNHVRPLAALLVVALAAGAATVAVTQLLLH* |
| Ga0066708_106934721 | 3300005576 | Soil | VLRPDRGPEVAVDFAPPRKPSHVRPLAVLVVVALAAGGVTVAVTQLLLH* |
| Ga0066651_105794772 | 3300006031 | Soil | VSRPDRGPDVAVDFAPPPKPNHLRPLVVLVFVALAAGAAAVAVTQLLLH* |
| Ga0070716_1014159012 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VSRPDRGPDVAVDFAPPRKPNNVRPLAALVVVVLIAGAVTVAVTQLLLR* |
| Ga0066665_104292302 | 3300006796 | Soil | VSRPERGPDVAVDFAPPTKPSHLRPLVALVVVALAAGAAAVAVTQLLLH* |
| Ga0066659_101057424 | 3300006797 | Soil | VSRPDRGPDVAVDFAPPPKPNHLRPLVVLVVVALAAGAASVAVTPLLLH* |
| Ga0066660_101497381 | 3300006800 | Soil | VPRPDRAPNIAVDFAPPRNPSRVRPLAVLVATVLAVGVVTIAVTQLVL |
| Ga0075425_1026099581 | 3300006854 | Populus Rhizosphere | DRPPEIAVDLAPPRAASRIRPLAMVVAVVLIAGVVMVAVTQLLLR* |
| Ga0099793_105817532 | 3300007258 | Vadose Zone Soil | VSRPDRGPDVAVDFAPPGRHNHLRPLAGLALVVLIVGAVTLAVTQLLLR* |
| Ga0099794_103395822 | 3300007265 | Vadose Zone Soil | ARHREVTPVSRPDRGPEVAVDCSPPRQRNHVRPLAALVVVVLIVGAITVAVTQLLLH* |
| Ga0066710_1013421582 | 3300009012 | Grasslands Soil | VLRPDRGPEVAVDFAPPRKPSHVRPLAVLVVVALAAGGVTVAVTQLLLH |
| Ga0066710_1035558261 | 3300009012 | Grasslands Soil | VTLVSRPDRAFNVAVDFSAPRRAGRTRPLVGLVVIVLALGAVTVAVTQLLLH |
| Ga0099829_100643274 | 3300009038 | Vadose Zone Soil | VSRPDRGPDVAVDFSPPRQRNHVRPLAALVVVVLIVGAVTVAVTQLLLH* |
| Ga0099830_102953583 | 3300009088 | Vadose Zone Soil | VAVDFSPPRQRDHVRPLAALVVVVLIVGAVTVAVTQLLLH* |
| Ga0099830_106482752 | 3300009088 | Vadose Zone Soil | VSRPDRGPDVAVDFSPPRQRDHVRPLAALLVVVLIVGAVTIAVTQLLLH* |
| Ga0099827_100004294 | 3300009090 | Vadose Zone Soil | VPRRDRGPDVAVDFAPPRQPNRVRPLAALVVVVLVVGAVTVAVTQLLLH* |
| Ga0099827_100169135 | 3300009090 | Vadose Zone Soil | VSRPDRGPDVAVDFAPPPKPNHVRPLAALVVVALAAGAATVAVTQLLLH* |
| Ga0066709_1000126129 | 3300009137 | Grasslands Soil | VTNVSRPDRAPNIAVDFAPPRNPSRVRPLAVLVATVLAVGVVTIAVTQLVLR* |
| Ga0066709_1013902872 | 3300009137 | Grasslands Soil | VLRPDRGPEVAVDFAPPRKPSHVRPLAVLVVVALAAGAVTVAVTQLLLH* |
| Ga0134065_100713022 | 3300010326 | Grasslands Soil | VSRPDRAFNVAVDFSAPRRAGHTRPLVGLVVIVLALGAVTVAVTQLLLH* |
| Ga0134111_104059981 | 3300010329 | Grasslands Soil | TALLRHREVTLVSRPERANDVAVDFSPPRRSARTRPLVGLLLVLLALGAVTVAVTQLLLH |
| Ga0134063_102399591 | 3300010335 | Grasslands Soil | SLRRREVTLVSRPDRAFNVAVDFSAPRRAGRTRPLVGLVVIVLALGAVTVAVTQLLLH* |
| Ga0137391_103381792 | 3300011270 | Vadose Zone Soil | VSRPDRGPDVAVDFSPPRLRNHVRPLAALVVVVFIVGAVTVAVTQLLLH* |
| Ga0137383_100130192 | 3300012199 | Vadose Zone Soil | VSRPDRGPDVAVDFAPPPKPNHVRPLATLLVVALAAGAATVTVTQLLLH* |
| Ga0137363_110112322 | 3300012202 | Vadose Zone Soil | VSRPDRGPDVAVDFAPARKPNHVRPLAVLVVVALAVGAVTVAVTQLLLR* |
| Ga0137399_100147657 | 3300012203 | Vadose Zone Soil | VSRPDRGPDVAVDFAPPRRHNHLRPLAGLAVVVLIVGAVTLAVTQLLLR* |
| Ga0137380_101967424 | 3300012206 | Vadose Zone Soil | VTIVSRPDRAFDVAVDFSAPRRAGRTRPLVGLVVIVLALGVVTVAVTQLLLH* |
| Ga0137378_100493172 | 3300012210 | Vadose Zone Soil | VSRPDRGPDVAVDFAPPPKPNRVRPLAALVVVALAAGAATVAVTQLLLH* |
| Ga0137377_114612682 | 3300012211 | Vadose Zone Soil | VSRPDRGPDVAVDFAPPPKPNHVRPLAALLVAALAAGAATVAVTQLLLH* |
| Ga0137395_102836061 | 3300012917 | Vadose Zone Soil | VSRPDRGPDVAVDFSPPRQRNHVRPLAALVVVVLIVSAVTVAVTQLLLH* |
| Ga0137396_100684492 | 3300012918 | Vadose Zone Soil | VSRPDRGPDVAVDFAPPRRHNHLRPLAGLALVVLIVGAVTLAVTQLLLR* |
| Ga0137416_111027392 | 3300012927 | Vadose Zone Soil | DRGPDVAVDFAPPRRHNHLPPLAGLALVVLIVGAVTLAVTQLLLR* |
| Ga0137416_117241581 | 3300012927 | Vadose Zone Soil | VSRPDRGPDVAVDFAPARKPNHVRPLALLVVVALVVGAVTVAVTQLLLH* |
| Ga0134110_102105852 | 3300012975 | Grasslands Soil | VTLVSRPDRAFNVAVDFSAPRRAGRTRPLVGLVVIVLALGAVTVAVTQLLLH* |
| Ga0134081_100867312 | 3300014150 | Grasslands Soil | VSRPDRGPDVAVDFAPPPKPNHLRPLVVLVVVELAAGAASVAVTQLLLH* |
| Ga0066655_101128632 | 3300018431 | Grasslands Soil | VSRPDRAFNVAVDFSAPRRAGRTRPLVGLVVIVLALGAVTVAVTQLLLH |
| Ga0066655_101904463 | 3300018431 | Grasslands Soil | VSRPDRGPEVAVDFAPPRKPSHVRPLAVLVVVALAAGGVTVAVTQLLLH |
| Ga0066667_106305141 | 3300018433 | Grasslands Soil | VSRPDRGPDVAVDFAPPPKPNHLRPLVVLVVVALAAGAASVAVTQLLLH |
| Ga0066667_107508432 | 3300018433 | Grasslands Soil | VTNVSRPDRAPNIAVDFAPPRNPSRVRPLAVLVATVLAVGVVTIAVTQLVLR |
| Ga0215015_100334855 | 3300021046 | Soil | VSRPDHEPDVAVDFSPPRRRNHVGPLAALVVAVLIVGTVTVAVTQLLLH |
| Ga0215015_101689062 | 3300021046 | Soil | VSRPDRGPDVAVDFSPPRARNHVRPLAALVVVVVIVGAVTVTVTQLLLR |
| Ga0215015_108468681 | 3300021046 | Soil | VSRPDRAPGIAVDFAPPRQPSRVRPLAVLVAVVLMAGAVTVAVTQLLLH |
| Ga0207684_109687142 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VSRPDRGPNVAIDFSPPRHRNHVRPLAALVVVVLIVGAVTVAVTQLLLH |
| Ga0207665_103364912 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VSRPDRGHDVAVDFAPPRKPNNVRPLAALVVVVLIAGAVTVAVTQLLLR |
| Ga0209350_10054044 | 3300026277 | Grasslands Soil | VSRPDRGPDVAVDFAPPPKPNHLRPLVVLVVVALAAGAAAVAVTQLLLH |
| Ga0209235_10381543 | 3300026296 | Grasslands Soil | VSRPDRGPEVAVDFAAPRKPSHVRPLAALVVVALAVGAVTVAVTQLLLH |
| Ga0209236_11354422 | 3300026298 | Grasslands Soil | VSRPDRGPDVAVDFAPARKPNHVRPLAALVVVALAVGAATVAVTQLLLH |
| Ga0209027_10207784 | 3300026300 | Grasslands Soil | VSQPDRGPEVAVDFAPPRKPSHVRPLAVLVVVALAAGAVTVAVTQLLLH |
| Ga0209238_10088646 | 3300026301 | Grasslands Soil | VSRPDRGPEVAVDFAPPRKPNHVRPLAALVVVALAAGAVTVAVTQLLLH |
| Ga0209265_10658943 | 3300026308 | Soil | LRHREVRLVSRPERANEVAVDFSPPRRSRRTRPLVGLVLVLLALGAVTVAVTQLLLH |
| Ga0209239_10284864 | 3300026310 | Grasslands Soil | GPEVAVDFAPPRKPNHVRPLAALVVVALAAGAVTVAVTQLLLH |
| Ga0209239_10485011 | 3300026310 | Grasslands Soil | VSRPDRGPEVAVDFAPPRKPSHVRPLAVLVVVALAAGAVTVAVTQLLLH |
| Ga0209471_10007259 | 3300026318 | Soil | VSRPDRGPDVAVDFAPPHKGSRVRPLAALALVVLAVAAVAVAVTQLLLR |
| Ga0209152_102825832 | 3300026325 | Soil | VSRPDRAPNIAVDFAPPRNPSRVRPLAVLVATVLAVGVVTIAVTQLVLR |
| Ga0209473_10499964 | 3300026330 | Soil | VSRPERANDVAVDFSPPRRSARTRPLVGLLLVLLALGAVTVAVTQLLL |
| Ga0257181_10014393 | 3300026499 | Soil | VSRPDRGPDVAVDFSPPRPRNHVRPLAALVVVVLIVGAITVAVTQLLLH |
| Ga0209058_10670612 | 3300026536 | Soil | VSRPDRAFNVAVDFSAPRRAGRTRPLVGLVVMVLALGAVTVAVTQLLLH |
| Ga0209376_13641771 | 3300026540 | Soil | DRGPDVAVDFAPPPKPNHLRPLVVLVVVALAAGAASVAVTQLLLH |
| Ga0209161_100227315 | 3300026548 | Soil | VSRPERGPDVAVDFAPPTKPNHLRPLVALVVVALAAGAAAVAVTQLLLH |
| Ga0209161_101370903 | 3300026548 | Soil | VSRPERVNDVAVDFSPPRRSGRTRPLVGLVLVLLALGAVTVAVTQLLLH |
| Ga0209474_101155431 | 3300026550 | Soil | VLRPDRGPEVAVDFAPPRKPSHVRPLAVLVVVALAAGGVTVAVT |
| Ga0209648_100915186 | 3300026551 | Grasslands Soil | VSRPDRGPNVAVDFAPPRRRNHVRPLAALVVVVLVAGAVTVAVTQLLLR |
| Ga0209648_101708551 | 3300026551 | Grasslands Soil | VSRPDRGPDVAVDFAPPRRRNHVGPLAALVVVVLIAGAVTVAVTQLLLR |
| Ga0209648_104670302 | 3300026551 | Grasslands Soil | VSRPDRGPDVAVDFSPPRQRNHVRPLAALVVVVLIVGSVTVAVTQLLLH |
| Ga0209648_108356952 | 3300026551 | Grasslands Soil | VPRPDRGPDVAVDFAPPRQRNRVRPLAALVVVVLVVGAVTVAVTQLLLH |
| Ga0209180_104500482 | 3300027846 | Vadose Zone Soil | VSRPDRGPDVAVDFSPPRQRDHVRPLAALAAVVLIVGAVTVAVTQLLLH |
| Ga0209180_107695472 | 3300027846 | Vadose Zone Soil | VSRPDRGPDVAVDFSPPRQRNHVRPLAALVVVVLIVGAVTVAVTQLLLH |
| Ga0209701_103018922 | 3300027862 | Vadose Zone Soil | VSRPDRGPDVAVDFSPPRQRDHVRPLAALVVVVLIVGAVTVAVTQLLLH |
| Ga0209590_1000050911 | 3300027882 | Vadose Zone Soil | VPRRDRGPDVAVDFAPPRQPNRVRPLAALVVVVLVVGAVTVAVTQLLLH |
| Ga0209590_100311034 | 3300027882 | Vadose Zone Soil | VSRPDRGPDVAVDFAPPPKPNHVRPLAALVVVALAAGAATVAVTQLLLH |
| Ga0307471_1000484624 | 3300032180 | Hardwood Forest Soil | VSRPDRGPDVAVDFAPPRKPNNVRPLAALVVVVLIAGAVTVAVTQLLLR |
| Ga0307471_1041827192 | 3300032180 | Hardwood Forest Soil | VSRPDRPPEIAVDFAPPRAASRIRPLAVVVAVVLIAGVVTVAVTQLLLR |
| ⦗Top⦘ |