


| Basic Information | |
|---|---|
| Family ID | F079076 |
| Family Type | Metagenome |
| Number of Sequences | 116 |
| Average Sequence Length | 44 residues |
| Representative Sequence | ILDERADQALPDKVNGLISKMTVETLNLRPNMLVNVTPEPAR |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 7.76 % |
| % of genes near scaffold ends (potentially truncated) | 88.79 % |
| % of genes from short scaffolds (< 2000 bps) | 88.79 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.069 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.241 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.483 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.586 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.71% β-sheet: 0.00% Coil/Unstructured: 94.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF12867 | DinB_2 | 21.55 |
| PF04879 | Molybdop_Fe4S4 | 12.93 |
| PF12704 | MacB_PCD | 5.17 |
| PF01418 | HTH_6 | 4.31 |
| PF08240 | ADH_N | 3.45 |
| PF00384 | Molybdopterin | 2.59 |
| PF04075 | F420H2_quin_red | 1.72 |
| PF04542 | Sigma70_r2 | 1.72 |
| PF00248 | Aldo_ket_red | 1.72 |
| PF07676 | PD40 | 1.72 |
| PF13424 | TPR_12 | 1.72 |
| PF07883 | Cupin_2 | 1.72 |
| PF00582 | Usp | 0.86 |
| PF13091 | PLDc_2 | 0.86 |
| PF03091 | CutA1 | 0.86 |
| PF00903 | Glyoxalase | 0.86 |
| PF01546 | Peptidase_M20 | 0.86 |
| PF00486 | Trans_reg_C | 0.86 |
| PF13620 | CarboxypepD_reg | 0.86 |
| PF01926 | MMR_HSR1 | 0.86 |
| PF01381 | HTH_3 | 0.86 |
| PF00768 | Peptidase_S11 | 0.86 |
| PF02687 | FtsX | 0.86 |
| PF00450 | Peptidase_S10 | 0.86 |
| PF07690 | MFS_1 | 0.86 |
| PF00857 | Isochorismatase | 0.86 |
| PF08530 | PepX_C | 0.86 |
| PF07394 | DUF1501 | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG1737 | DNA-binding transcriptional regulator, MurR/RpiR family, contains HTH and SIS domains | Transcription [K] | 4.31 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.72 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 1.72 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.72 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 1.72 |
| COG1324 | Divalent cation tolerance protein CutA | Inorganic ion transport and metabolism [P] | 0.86 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.86 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.86 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.86 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.86 |
| COG2939 | Carboxypeptidase C (cathepsin A) | Amino acid transport and metabolism [E] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.07 % |
| Unclassified | root | N/A | 12.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_105504962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1396 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10141107 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300000789|JGI1027J11758_12500694 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300000789|JGI1027J11758_12565150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1088 | Open in IMG/M |
| 3300001431|F14TB_100704431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300004267|Ga0066396_10103380 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300004480|Ga0062592_100412267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1080 | Open in IMG/M |
| 3300005093|Ga0062594_102237198 | Not Available | 592 | Open in IMG/M |
| 3300005332|Ga0066388_101429081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1204 | Open in IMG/M |
| 3300005332|Ga0066388_101460223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1193 | Open in IMG/M |
| 3300005332|Ga0066388_102640568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 915 | Open in IMG/M |
| 3300005332|Ga0066388_103691091 | Not Available | 781 | Open in IMG/M |
| 3300005332|Ga0066388_106941666 | Not Available | 570 | Open in IMG/M |
| 3300005332|Ga0066388_107857807 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300005602|Ga0070762_10138023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1448 | Open in IMG/M |
| 3300005610|Ga0070763_10083306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1585 | Open in IMG/M |
| 3300005764|Ga0066903_102910587 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300005764|Ga0066903_107756683 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300005841|Ga0068863_102127158 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300006042|Ga0075368_10033451 | Not Available | 2000 | Open in IMG/M |
| 3300006173|Ga0070716_101496187 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300006176|Ga0070765_101032862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 777 | Open in IMG/M |
| 3300006806|Ga0079220_10545608 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300006845|Ga0075421_100067598 | All Organisms → cellular organisms → Bacteria | 4513 | Open in IMG/M |
| 3300006845|Ga0075421_102721133 | Not Available | 511 | Open in IMG/M |
| 3300006854|Ga0075425_102380113 | Not Available | 588 | Open in IMG/M |
| 3300006871|Ga0075434_101837204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius | 612 | Open in IMG/M |
| 3300006903|Ga0075426_10010622 | All Organisms → cellular organisms → Bacteria | 6552 | Open in IMG/M |
| 3300006903|Ga0075426_11469523 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300006903|Ga0075426_11492560 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 514 | Open in IMG/M |
| 3300006904|Ga0075424_101020177 | Not Available | 882 | Open in IMG/M |
| 3300006904|Ga0075424_102094014 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300006918|Ga0079216_10537043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 784 | Open in IMG/M |
| 3300007255|Ga0099791_10266810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300009038|Ga0099829_10224598 | All Organisms → cellular organisms → Bacteria | 1526 | Open in IMG/M |
| 3300009089|Ga0099828_10863361 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300009162|Ga0075423_10485230 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
| 3300009162|Ga0075423_10963067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius | 906 | Open in IMG/M |
| 3300009174|Ga0105241_11687653 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 615 | Open in IMG/M |
| 3300009645|Ga0116106_1121507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 841 | Open in IMG/M |
| 3300009792|Ga0126374_11607933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300010043|Ga0126380_11035700 | Not Available | 694 | Open in IMG/M |
| 3300010043|Ga0126380_11918103 | Not Available | 539 | Open in IMG/M |
| 3300010046|Ga0126384_12254748 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300010048|Ga0126373_11838024 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300010359|Ga0126376_12494909 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300010361|Ga0126378_13071500 | Not Available | 532 | Open in IMG/M |
| 3300010362|Ga0126377_10030741 | All Organisms → cellular organisms → Bacteria | 4537 | Open in IMG/M |
| 3300010366|Ga0126379_10653946 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300010366|Ga0126379_12870949 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300010366|Ga0126379_13740360 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300010376|Ga0126381_101461914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 988 | Open in IMG/M |
| 3300010398|Ga0126383_11831526 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300010398|Ga0126383_12025007 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300012180|Ga0153974_1060175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
| 3300012202|Ga0137363_10279652 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
| 3300012203|Ga0137399_10942256 | Not Available | 727 | Open in IMG/M |
| 3300012212|Ga0150985_119565206 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2365 | Open in IMG/M |
| 3300012357|Ga0137384_10500867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 997 | Open in IMG/M |
| 3300012582|Ga0137358_10588453 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300012922|Ga0137394_10386555 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300012929|Ga0137404_10377582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1246 | Open in IMG/M |
| 3300013296|Ga0157374_10633062 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300015052|Ga0137411_1058913 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
| 3300015241|Ga0137418_10524319 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300015242|Ga0137412_10525752 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300015245|Ga0137409_10606237 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300015245|Ga0137409_11315867 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300015374|Ga0132255_102262078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 829 | Open in IMG/M |
| 3300016270|Ga0182036_10396724 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300016404|Ga0182037_10221037 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1482 | Open in IMG/M |
| 3300016422|Ga0182039_10105718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2090 | Open in IMG/M |
| 3300020579|Ga0210407_10328754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1195 | Open in IMG/M |
| 3300020583|Ga0210401_10001068 | All Organisms → cellular organisms → Bacteria | 32709 | Open in IMG/M |
| 3300020583|Ga0210401_10445451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1158 | Open in IMG/M |
| 3300021088|Ga0210404_10083193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1581 | Open in IMG/M |
| 3300021088|Ga0210404_10314341 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300021168|Ga0210406_10214954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1590 | Open in IMG/M |
| 3300021171|Ga0210405_10245965 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300021178|Ga0210408_10046699 | Not Available | 3389 | Open in IMG/M |
| 3300021401|Ga0210393_11369290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300021403|Ga0210397_10300183 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1179 | Open in IMG/M |
| 3300021404|Ga0210389_10583694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 879 | Open in IMG/M |
| 3300021420|Ga0210394_10223643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1644 | Open in IMG/M |
| 3300021432|Ga0210384_10034206 | All Organisms → cellular organisms → Bacteria | 4720 | Open in IMG/M |
| 3300021432|Ga0210384_11098232 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300021559|Ga0210409_11187649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300021560|Ga0126371_10162731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 2302 | Open in IMG/M |
| 3300025922|Ga0207646_10498024 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300025933|Ga0207706_10191040 | All Organisms → cellular organisms → Bacteria | 1797 | Open in IMG/M |
| 3300025939|Ga0207665_10561268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 888 | Open in IMG/M |
| 3300027667|Ga0209009_1108517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300027874|Ga0209465_10264404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
| 3300028379|Ga0268266_10137518 | All Organisms → cellular organisms → Bacteria | 2190 | Open in IMG/M |
| 3300031573|Ga0310915_11256597 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300031679|Ga0318561_10356466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 802 | Open in IMG/M |
| 3300031718|Ga0307474_10395751 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300031719|Ga0306917_11050904 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300031720|Ga0307469_10786205 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300031764|Ga0318535_10242024 | Not Available | 807 | Open in IMG/M |
| 3300031769|Ga0318526_10432851 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300031781|Ga0318547_10850428 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300031820|Ga0307473_10010411 | All Organisms → cellular organisms → Bacteria | 3348 | Open in IMG/M |
| 3300031823|Ga0307478_11812475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300031954|Ga0306926_10410568 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1670 | Open in IMG/M |
| 3300031954|Ga0306926_11823819 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300031962|Ga0307479_10958246 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300032076|Ga0306924_11290147 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300032174|Ga0307470_10016926 | All Organisms → cellular organisms → Bacteria | 3186 | Open in IMG/M |
| 3300032205|Ga0307472_101358790 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300032261|Ga0306920_100637876 | All Organisms → cellular organisms → Bacteria | 1574 | Open in IMG/M |
| 3300032783|Ga0335079_10648061 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300032805|Ga0335078_11221358 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300032828|Ga0335080_11667806 | Not Available | 626 | Open in IMG/M |
| 3300032892|Ga0335081_11448157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
| 3300032897|Ga0335071_11980878 | Not Available | 526 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.24% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.93% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.07% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.90% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.03% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.59% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.72% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.86% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.86% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.86% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012180 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG | Host-Associated | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1055049621 | 3300000364 | Soil | NLAGILEDRVQQLLPEKVKSSIAKVTVETLNLRPNMLVNVTPEPTR* |
| AF_2010_repII_A1DRAFT_101411071 | 3300000597 | Forest Soil | PRASLANILDERAEQLLPDKVNSLVSKMTVETLNLRPNMLVNVTPEPAP* |
| JGI1027J11758_125006941 | 3300000789 | Soil | RADQALPDKVNSFISKITVETINLRPNMLVNVTPEPAR* |
| JGI1027J11758_125651504 | 3300000789 | Soil | ALPEKVNCFVSKITVETLNLRPNMLVNVTPEPAR* |
| F14TB_1007044312 | 3300001431 | Soil | ERADQALPDKVNGLVSKITFEALNLRPNMLVNVTPEPTR* |
| Ga0066396_101033802 | 3300004267 | Tropical Forest Soil | ILDERADQELPEEVNGLISKVSVEILNLRPNMLVNVTPEPAH* |
| Ga0062592_1004122672 | 3300004480 | Soil | MAPALLRRRLRPSPNLAAILDERADQALPAKLNGVIVKWSVETLTLRPTMLVNVTPAGSR |
| Ga0062594_1022371982 | 3300005093 | Soil | RRLRPSPNLAAILDERADQALPAKLNGVIVKWSVETLTLRPTMLVNVTPAGSR* |
| Ga0066388_1014290813 | 3300005332 | Tropical Forest Soil | AILEERADQPLPEKVNGLISKMTVETLNLRTDMLVNVTPEPAR* |
| Ga0066388_1014602231 | 3300005332 | Tropical Forest Soil | AILDERGEQALPEKVNGLVAKMTVETLNLRPNMLVNVTAEPNR* |
| Ga0066388_1026405682 | 3300005332 | Tropical Forest Soil | ALILDERADQALPDKVIGLISTIKTEALNLRPDFLVNVTPLVAH* |
| Ga0066388_1036910912 | 3300005332 | Tropical Forest Soil | ALILDERADQALPDKVIGLISTIKTEALNLRPDFLVNVTPEAPH* |
| Ga0066388_1069416661 | 3300005332 | Tropical Forest Soil | RASLAAILDERTGQALPAKADGLISKMTVETLNLRPDMLVNVTPAP* |
| Ga0066388_1078578071 | 3300005332 | Tropical Forest Soil | RASLTNILDERADQQLPDKVNGLISKLTVETLNLRPNMLVNVTPDTTH* |
| Ga0070762_101380231 | 3300005602 | Soil | LRASRMVLVGKLSMRASLANILDERADQELPENVHNLILKMTVETLNLRPNMLVNITPEPER* |
| Ga0070763_100833061 | 3300005610 | Soil | MRASLANILDERADQELPENVHNLILKMTVETLNLRPNMLVNITPEPER* |
| Ga0066903_1029105872 | 3300005764 | Tropical Forest Soil | RPLSSLQAVLDERGDQALPDKVSGLISKISVETLNLRPSMLVNVTPEAPY* |
| Ga0066903_1077566831 | 3300005764 | Tropical Forest Soil | ADQALPEKVNGFISKMSVEVLNLRPNMLVNVTPEPAR* |
| Ga0068863_1021271581 | 3300005841 | Switchgrass Rhizosphere | RLRPRTSLASILDEHADQALPDKVNGLISKMTVETLNLRPNMLVNVTPTR* |
| Ga0075368_100334512 | 3300006042 | Populus Endosphere | ASLAAILDERARQALPDKVNGLVSTITFETLNLRPTMLVNVTPAPTR* |
| Ga0070716_1014961871 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | PRASLASILDERADQALPDKVNGLISKMTVETLNLRPNMLVNVTPESPR* |
| Ga0070765_1010328622 | 3300006176 | Soil | SLASILDERADQSLPDQVKGLIAMMTIETLNLRTNMLVNVTPEPAH* |
| Ga0079220_105456082 | 3300006806 | Agricultural Soil | MLDERAEQALRNQLNGLVAKISGETLNLRPNMLVNLAPLTEP* |
| Ga0075421_1000675981 | 3300006845 | Populus Rhizosphere | YVRLRPRSSLALILDERADQALPDKVIGLISTIKNEALNLRPDFLVNVTPVVAH* |
| Ga0075421_1027211332 | 3300006845 | Populus Rhizosphere | AAILDERADQALPDRVNSLISKVTIETLNLRPNMLVNVTPVPAR* |
| Ga0075425_1023801132 | 3300006854 | Populus Rhizosphere | AAILDERADQALPDSVNGLISKMTVETLNLRPDMLVNVTPEPAR* |
| Ga0075434_1018372042 | 3300006871 | Populus Rhizosphere | LDEHADQALPDKVNGLISKMTVETLNLRPNMLVNVTPTR* |
| Ga0075426_100106221 | 3300006903 | Populus Rhizosphere | AAILDERADQALPDSVNASIAKMTVESLNLRPDMLVNVTPEGAR* |
| Ga0075426_114695232 | 3300006903 | Populus Rhizosphere | LRPRATLAAILDERADQALPDAVDSLIAKITVETLNLRPNMLVNVTMP* |
| Ga0075426_114925601 | 3300006903 | Populus Rhizosphere | PRASLAAILDERADQALPDKVTGLISKVTVETLNLRPNMLVNVTPE* |
| Ga0075424_1010201772 | 3300006904 | Populus Rhizosphere | PRASLAAILDERADQALPDKVNHLIAKVTVETLNLRANMLVNVTPETR* |
| Ga0075424_1020940142 | 3300006904 | Populus Rhizosphere | LRPRADLAAILDERADQALPDRVNSLISKVTIETLNLRPNMLVNVTPVPAR* |
| Ga0079216_105370433 | 3300006918 | Agricultural Soil | ILDERGDQALPDTVNGLIVKMIVETLNLRPNMLVNVTPSGQK* |
| Ga0099791_102668102 | 3300007255 | Vadose Zone Soil | ERADQAVPDKVNGLISKMTIETLNLRPDMLVNVTPEPAR* |
| Ga0099829_102245983 | 3300009038 | Vadose Zone Soil | AILDERADQALPDKVNGLISKMTVETLNLRPNMLVNVTPEPAR* |
| Ga0099828_108633611 | 3300009089 | Vadose Zone Soil | ILDERADQALPDKVNGLISKMTVETLNLRPNMLVNVTPEPAR* |
| Ga0075423_104852302 | 3300009162 | Populus Rhizosphere | LRPRADLAAILDERADQALPDRVNSLISKVTIETLNLRPNMLVNVTPAPAR* |
| Ga0075423_109630672 | 3300009162 | Populus Rhizosphere | LASILDEHADQALPDKVNGLISKMTVETLNLRPNMLVNVTPTR* |
| Ga0105241_116876531 | 3300009174 | Corn Rhizosphere | LDDPADRALPEGVTNLVSRITVETLNLRPTMLVNVTPVSSPR* |
| Ga0116106_11215072 | 3300009645 | Peatland | ILDERADQALPDKVNGLISKMTVETLNLRPDMLVNVTPVKEP* |
| Ga0126374_116079331 | 3300009792 | Tropical Forest Soil | MASLTAILEERADGDLPETVNGLISKVTVETLNLRPNMLVNVTPETQH* |
| Ga0126380_110357001 | 3300010043 | Tropical Forest Soil | SLAAILEQRPDEALPETVNGLISKMTIETLNLRPNMLVNVTPEPTQ* |
| Ga0126380_119181031 | 3300010043 | Tropical Forest Soil | SPRATLASILDERADQARAEKVNGLMSKMTVEALKGRPNMLVNVTPQSAP* |
| Ga0126384_122547482 | 3300010046 | Tropical Forest Soil | GSLANILDERADQPLPEKLNSLISKLTVETLNLRPNMLVNVTPATSQ* |
| Ga0126373_118380241 | 3300010048 | Tropical Forest Soil | DQALPDKVNALVSKMTVEILNLRPNMLVNLTPEPAR* |
| Ga0126376_124949091 | 3300010359 | Tropical Forest Soil | ASLANILDERADQALPDKVNGLISKMTVEILNLRTNMLVNVTPEVAH* |
| Ga0126378_130715001 | 3300010361 | Tropical Forest Soil | LRPRSNLGVILEERADQALPEKVNELISRTMTEILNLRPNMLVNVTPAP* |
| Ga0126377_100307416 | 3300010362 | Tropical Forest Soil | RADQALPDKVIGLISTIKTEALNLRPDFSVNVTPVVAH* |
| Ga0126379_106539462 | 3300010366 | Tropical Forest Soil | AAILEEHADQTLPDKVNGLISKMTVETLNLRPNMLVNVTPEPAH* |
| Ga0126379_128709491 | 3300010366 | Tropical Forest Soil | SILDERADQTLPDKVNGLIAKITVEILNLRPNMLVNVTPEPAP* |
| Ga0126379_137403602 | 3300010366 | Tropical Forest Soil | ALPERVNGLVSRMTVETLNLRPNMLVNVTPKPAP* |
| Ga0126381_1014619142 | 3300010376 | Tropical Forest Soil | DSAEIALPEKANSLISKMTVEVLSLRPTMLVNVTPEPAK* |
| Ga0126383_118315262 | 3300010398 | Tropical Forest Soil | TLPDKVNGLISKMTVETLNLRPNMLVNVTPEAGH* |
| Ga0126383_120250072 | 3300010398 | Tropical Forest Soil | RASLAAILDEHADQALPDKVNGLVSKMTVETLNLRTNMLVNVTPEPGH* |
| Ga0153974_10601751 | 3300012180 | Attine Ant Fungus Gardens | SLAAILDERADQALPDKVNGLISKMTVETLNLRPNMLVNVTPEPARQ* |
| Ga0137363_102796521 | 3300012202 | Vadose Zone Soil | ERIDRSLPDKIKGLIAKVTVETLNLRTNMLVNVTPEPAR* |
| Ga0137399_109422563 | 3300012203 | Vadose Zone Soil | AILDERGEQALPDKANGMISKMTVETLNLRPDMLVNVTPEPAR* |
| Ga0150985_1195652063 | 3300012212 | Avena Fatua Rhizosphere | MLPEKVRPGKSKMTVETLNLRPDMLVNVTAEPAR* |
| Ga0137384_105008671 | 3300012357 | Vadose Zone Soil | GILDESADQSLPDKVNGLIAKMTVETLNLRTNMLVNVTPEPAR* |
| Ga0137358_105884532 | 3300012582 | Vadose Zone Soil | ALPDKVNGSISKMTVETLNLRPNMLVNVTPEPAR* |
| Ga0137394_103865553 | 3300012922 | Vadose Zone Soil | ADQALPDKVNGSISKMTIETLNLRPNMLVNVTPEPAR* |
| Ga0137404_103775822 | 3300012929 | Vadose Zone Soil | RPRTSLAAILDERADQSLPDKVNGLIAKMTVETLNLRTNMLVNVTPEPAR* |
| Ga0157374_106330623 | 3300013296 | Miscanthus Rhizosphere | SILDERAEQALPDQVNGLVAKISVETLNLRPNMLVNLTPLTEP* |
| Ga0137411_10589131 | 3300015052 | Vadose Zone Soil | RPRANLAAILDERADQALPDKVNVSISKMTIETLNLRPNMLVNVTPEPAR* |
| Ga0137418_105243191 | 3300015241 | Vadose Zone Soil | VCLRPRTSLEGILDERADRSLPDKVNGLIAKVTVETLNLRTNMLVNVTPEPAR* |
| Ga0137412_105257521 | 3300015242 | Vadose Zone Soil | RLRPRTSLAGILDERADQSLPDKVNGLIAKMTVETLNLRTNMLLNVTPEPAR* |
| Ga0137409_106062372 | 3300015245 | Vadose Zone Soil | AAILDERADQALPDKVNGLISKISVETLNLRPNMLVNVTPEPAH* |
| Ga0137409_113158672 | 3300015245 | Vadose Zone Soil | QALPETVNNLISKITIETLNLRPNMLVNVTPEHAH* |
| Ga0132255_1022620781 | 3300015374 | Arabidopsis Rhizosphere | SLADILDERADQALPEKVNCFVSKITVETLNLRPNMLVNVTPEPAR* |
| Ga0182036_103967242 | 3300016270 | Soil | DQTLPDKVNGLISKLTVETLNLRPNMLVNVIPAGR |
| Ga0182037_102210371 | 3300016404 | Soil | SLQAILDERADQALPDKVSGLISKISVEILNLRPSMLVSLTPEAPH |
| Ga0182039_101057184 | 3300016422 | Soil | SSLQAILDERADQALPDKVSGLISKISVEILNLRPSMLVSLTPEAPH |
| Ga0210407_103287543 | 3300020579 | Soil | QALPDKVNGLISKMTVETVNLRPNMLVNVTPVKEP |
| Ga0210401_1000106820 | 3300020583 | Soil | MVLVGKLSMRASLANILDERADQELPENVHTLILKMTVETLNLWPNMLVNVTPEPER |
| Ga0210401_104454511 | 3300020583 | Soil | ADQALPDKVSGLISKMTVETLNLRPNMLVNVTPEAAR |
| Ga0210404_100831932 | 3300021088 | Soil | MRASLANILDERADQELPENVHNLILKMTVETLNLWPNMLVNVTPEPER |
| Ga0210404_103143413 | 3300021088 | Soil | VSLANILDERADQSLPDKVNGLISKMTVETLNLRPNMLVNVTPEPPR |
| Ga0210406_102149543 | 3300021168 | Soil | SLASILDEHADQALPDKVNGLISKMTVETVNLRPNMLVNVTPVKEP |
| Ga0210405_102459652 | 3300021171 | Soil | MRASLANILDERADQELPENVHNLILKMTVETLNLRPNMLVNITPEPER |
| Ga0210408_100466996 | 3300021178 | Soil | ADQALPEKVNGLTTKMTVETLNLRPNMLVNVTPEPAH |
| Ga0210393_113692902 | 3300021401 | Soil | LRPRPSLASILDERADQSLPDQVKGLIAKMTVETLNLRTNMLVNVTPEPAH |
| Ga0210397_103001832 | 3300021403 | Soil | MRASLANILDERADQELPENVHNLILKMTVETLNLRPNMLVNVTPGPER |
| Ga0210389_105836942 | 3300021404 | Soil | LRPRASLANILDERADQELPKKVHGLILKMTVETLNLRPNMLVNVTPEPER |
| Ga0210394_102236431 | 3300021420 | Soil | ERADQSLPDQVKGLIAKMTVETLNLRTNMLVNVTPEPAH |
| Ga0210384_100342064 | 3300021432 | Soil | MVFVGKLSMRASLANILDERADQELPENVHNLILKMTVETLNLRPNMLVNITPEPER |
| Ga0210384_110982321 | 3300021432 | Soil | SARKLGDEPAGQALPDKVNGLISKMTVESLNLRPNMLVNVTPEPAR |
| Ga0210409_111876491 | 3300021559 | Soil | QALPDKVSGLISKMTVETLNLRPNMLVNVTPEAAR |
| Ga0126371_101627312 | 3300021560 | Tropical Forest Soil | DQAFPNKVSGLISKITVETLNLRPNMLVNVTPEHGR |
| Ga0207646_104980241 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | ASILDERADQALPDKVNGLISKMTVETLNLRSNMLVSVTPEPAR |
| Ga0207706_101910403 | 3300025933 | Corn Rhizosphere | ERAEQALPDQVNGLVAKISVETLNLRPNMLVNVTPLTEP |
| Ga0207665_105612682 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LANILDERADQALPDRVNGLISKMTVETLNLRPNMLVNVTPEPAR |
| Ga0209009_11085171 | 3300027667 | Forest Soil | LRPRENLAAILDERADQALPGKVNRLISKMTVGTLNLGPNMLVNVTPEPARQ |
| Ga0209465_102644041 | 3300027874 | Tropical Forest Soil | PRATLASILDEHADQVLPDKVSGLISRMTIETLNLRPNMLVNVTPVPGL |
| Ga0268266_101375181 | 3300028379 | Switchgrass Rhizosphere | DQALPDSVNGLISKMTVETLNLRPNMLVNVAPEPAR |
| Ga0310915_112565971 | 3300031573 | Soil | LRPRESLAAILEQSADQTLPDKVDGLISKITIETLNLRPNMLVNVTPERGR |
| Ga0318561_103564661 | 3300031679 | Soil | SILDEHADQVLPDKVSGLISRMTIETLNLRPNMLVNVTPVPGL |
| Ga0307474_103957513 | 3300031718 | Hardwood Forest Soil | LVAILDERAGQALPEKVNGLISKMTVETLNLRPNMLVNVTPETAR |
| Ga0306917_110509041 | 3300031719 | Soil | QTLPDKVDGLISKITIETLNLRPNMLVNVTLERGR |
| Ga0307469_107862051 | 3300031720 | Hardwood Forest Soil | ADQALPDKVNGLISKMTIETLNLRPNMLVNVTPEPAR |
| Ga0318535_102420241 | 3300031764 | Soil | QALPDSVSDLISKITVETLSLRPDMLVNVTPEAAR |
| Ga0318526_104328512 | 3300031769 | Soil | ILDERADQALPDKVNGLISKMTVETLNLRSNMLVNVTPEPAP |
| Ga0318547_108504281 | 3300031781 | Soil | ILDERADQPLPERINGLISRMTVESLNLRPDMLVNVTPVPAR |
| Ga0307473_100104115 | 3300031820 | Hardwood Forest Soil | CPRASLAAILDERASQALPDKVNGLISKMTVETLNLRPNMLVNVTAEPAR |
| Ga0307478_118124751 | 3300031823 | Hardwood Forest Soil | ASLAPILDERADQSLPDKVNGLISKVTVETLNLRPNMLVNVTPEPAR |
| Ga0306926_104105681 | 3300031954 | Soil | ADQALPDKVSGLISKISVEILNLRPSMLVSLTPEAPH |
| Ga0306926_118238191 | 3300031954 | Soil | PRASLATILDERADQGLPEKVTGLVSTMTVETLNLRPTMLVNVTPKPTP |
| Ga0307479_109582462 | 3300031962 | Hardwood Forest Soil | TSLASILDERADQALPDKVNGLISKMNVETLNLRPNMLVNVTPEPAR |
| Ga0306924_112901472 | 3300032076 | Soil | VRLKPRSSLGAILDENADQALPDDVNGLISKLTVETLNLRPNMLVNVIPAGR |
| Ga0307470_100169261 | 3300032174 | Hardwood Forest Soil | SLAAILDERSGQELPDNVNGLISKMTVETLNLRPNMLVNVTPEPAR |
| Ga0307472_1013587902 | 3300032205 | Hardwood Forest Soil | ERAEQELPDTANGLIAKTTVETLSLRPNMLVNVTPE |
| Ga0306920_1006378763 | 3300032261 | Soil | ANLGVILEERADQALPEKVNELISRTTTEILNLRPNMLVNVTPAP |
| Ga0335079_106480611 | 3300032783 | Soil | TSLAAILEEAADQPLPGTVYGLVLKVSVETLNLRTNMLVNVNPATEP |
| Ga0335078_112213581 | 3300032805 | Soil | LRPRPSLAAILDEHSEQAVPEKVNGLVSKVTIETLNLRVNMLVNVTPELMR |
| Ga0335080_116678062 | 3300032828 | Soil | LDERSDQALPAMVDGLISKMTVETLNLRPDMLVNVTPAP |
| Ga0335081_114481571 | 3300032892 | Soil | RVDQALPDKVNGLISKMTVEVLVLRPNMLVNVTPEPQR |
| Ga0335071_119808782 | 3300032897 | Soil | DERSDQALPAKVDGLISKMTVETLNLRPDMLVNVMPEP |
| ⦗Top⦘ |