


| Basic Information | |
|---|---|
| Family ID | F079061 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 38 residues |
| Representative Sequence | DTEGHKAIDVFYLTAQGKKLTAQKQELLREVLQGTLG |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.72 % |
| % of genes near scaffold ends (potentially truncated) | 96.55 % |
| % of genes from short scaffolds (< 2000 bps) | 83.62 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.552 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (28.448 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.759 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.724 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.08% β-sheet: 3.08% Coil/Unstructured: 73.85% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF04041 | Glyco_hydro_130 | 13.79 |
| PF07702 | UTRA | 4.31 |
| PF08282 | Hydrolase_3 | 4.31 |
| PF00672 | HAMP | 3.45 |
| PF06764 | DUF1223 | 2.59 |
| PF13620 | CarboxypepD_reg | 2.59 |
| PF04011 | LemA | 1.72 |
| PF02566 | OsmC | 1.72 |
| PF05199 | GMC_oxred_C | 1.72 |
| PF02321 | OEP | 1.72 |
| PF09424 | YqeY | 1.72 |
| PF02585 | PIG-L | 0.86 |
| PF13421 | Band_7_1 | 0.86 |
| PF00582 | Usp | 0.86 |
| PF13432 | TPR_16 | 0.86 |
| PF01564 | Spermine_synth | 0.86 |
| PF01979 | Amidohydro_1 | 0.86 |
| PF01364 | Peptidase_C25 | 0.86 |
| PF00175 | NAD_binding_1 | 0.86 |
| PF08281 | Sigma70_r4_2 | 0.86 |
| PF04138 | GtrA | 0.86 |
| PF17189 | Glyco_hydro_30C | 0.86 |
| PF09933 | DUF2165 | 0.86 |
| PF00535 | Glycos_transf_2 | 0.86 |
| PF00665 | rve | 0.86 |
| PF02836 | Glyco_hydro_2_C | 0.86 |
| PF01842 | ACT | 0.86 |
| PF14559 | TPR_19 | 0.86 |
| PF13518 | HTH_28 | 0.86 |
| PF04932 | Wzy_C | 0.86 |
| PF00589 | Phage_integrase | 0.86 |
| PF06271 | RDD | 0.86 |
| PF09650 | PHA_gran_rgn | 0.86 |
| PF13450 | NAD_binding_8 | 0.86 |
| PF13442 | Cytochrome_CBB3 | 0.86 |
| PF02702 | KdpD | 0.86 |
| PF00171 | Aldedh | 0.86 |
| PF01935 | DUF87 | 0.86 |
| PF16657 | Malt_amylase_C | 0.86 |
| PF13473 | Cupredoxin_1 | 0.86 |
| PF08245 | Mur_ligase_M | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG2152 | Predicted glycosyl hydrolase, GH43/DUF377 family | Carbohydrate transport and metabolism [G] | 13.79 |
| COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 4.31 |
| COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 4.31 |
| COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 4.31 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 4.31 |
| COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 4.31 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 3.45 |
| COG5429 | Uncharacterized conserved protein, DUF1223 domain | Function unknown [S] | 2.59 |
| COG1704 | Magnetosome formation protein MamQ, lipoprotein antigen LemA family | Cell wall/membrane/envelope biogenesis [M] | 1.72 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 1.72 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 1.72 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 1.72 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.86 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.86 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.86 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.86 |
| COG2205 | K+-sensing histidine kinase KdpD | Signal transduction mechanisms [T] | 0.86 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.86 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.86 |
| COG3250 | Beta-galactosidase/beta-glucuronidase | Carbohydrate transport and metabolism [G] | 0.86 |
| COG3307 | O-antigen ligase | Cell wall/membrane/envelope biogenesis [M] | 0.86 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.86 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.86 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.55 % |
| Unclassified | root | N/A | 3.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16814961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2439 | Open in IMG/M |
| 3300001154|JGI12636J13339_1000292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8267 | Open in IMG/M |
| 3300001867|JGI12627J18819_10402372 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 557 | Open in IMG/M |
| 3300001867|JGI12627J18819_10499268 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300002917|JGI25616J43925_10270518 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300004082|Ga0062384_101370741 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300004092|Ga0062389_101734682 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300005332|Ga0066388_101933528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1055 | Open in IMG/M |
| 3300005456|Ga0070678_100156369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1842 | Open in IMG/M |
| 3300005556|Ga0066707_10276538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1098 | Open in IMG/M |
| 3300005566|Ga0066693_10138654 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300005575|Ga0066702_10907412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 526 | Open in IMG/M |
| 3300005764|Ga0066903_101407804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1310 | Open in IMG/M |
| 3300005921|Ga0070766_10152529 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300006174|Ga0075014_100384815 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300006237|Ga0097621_100577955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1025 | Open in IMG/M |
| 3300006804|Ga0079221_10758144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 687 | Open in IMG/M |
| 3300007258|Ga0099793_10136548 | Not Available | 1156 | Open in IMG/M |
| 3300007265|Ga0099794_10812459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300009088|Ga0099830_10322359 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1237 | Open in IMG/M |
| 3300009090|Ga0099827_10165053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1822 | Open in IMG/M |
| 3300009143|Ga0099792_10364912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 875 | Open in IMG/M |
| 3300010304|Ga0134088_10140937 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300010335|Ga0134063_10039178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2041 | Open in IMG/M |
| 3300010358|Ga0126370_12425865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter | 521 | Open in IMG/M |
| 3300010359|Ga0126376_11248063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 760 | Open in IMG/M |
| 3300010360|Ga0126372_10162894 | All Organisms → cellular organisms → Bacteria | 1803 | Open in IMG/M |
| 3300010361|Ga0126378_12348393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
| 3300010361|Ga0126378_13427425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300010366|Ga0126379_13758863 | Not Available | 509 | Open in IMG/M |
| 3300010398|Ga0126383_10167528 | All Organisms → cellular organisms → Bacteria | 2071 | Open in IMG/M |
| 3300010398|Ga0126383_12339996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300010403|Ga0134123_12979824 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300011120|Ga0150983_12608239 | All Organisms → cellular organisms → Bacteria | 2112 | Open in IMG/M |
| 3300011270|Ga0137391_10050737 | All Organisms → cellular organisms → Bacteria | 3536 | Open in IMG/M |
| 3300011270|Ga0137391_10097720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2542 | Open in IMG/M |
| 3300011271|Ga0137393_11095121 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300011271|Ga0137393_11801698 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300012189|Ga0137388_11748392 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300012189|Ga0137388_11852182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300012201|Ga0137365_10021790 | All Organisms → cellular organisms → Bacteria | 4972 | Open in IMG/M |
| 3300012203|Ga0137399_10139629 | All Organisms → cellular organisms → Bacteria | 1924 | Open in IMG/M |
| 3300012203|Ga0137399_11442254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300012209|Ga0137379_10064643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus saanensis | 3521 | Open in IMG/M |
| 3300012211|Ga0137377_10894263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 820 | Open in IMG/M |
| 3300012285|Ga0137370_10339824 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300012285|Ga0137370_10740190 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300012361|Ga0137360_10724017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 855 | Open in IMG/M |
| 3300012582|Ga0137358_10050562 | All Organisms → cellular organisms → Bacteria | 2768 | Open in IMG/M |
| 3300012901|Ga0157288_10419445 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300012917|Ga0137395_10518861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 859 | Open in IMG/M |
| 3300012918|Ga0137396_10122654 | All Organisms → cellular organisms → Bacteria | 1874 | Open in IMG/M |
| 3300012925|Ga0137419_10297182 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| 3300012925|Ga0137419_10490628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 974 | Open in IMG/M |
| 3300012925|Ga0137419_11183180 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300012925|Ga0137419_11274975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300012927|Ga0137416_11620075 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300012930|Ga0137407_10022560 | All Organisms → cellular organisms → Bacteria | 4760 | Open in IMG/M |
| 3300012957|Ga0164303_10218371 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300014200|Ga0181526_10135652 | All Organisms → cellular organisms → Bacteria | 1576 | Open in IMG/M |
| 3300015052|Ga0137411_1188471 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
| 3300017792|Ga0163161_11614293 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300017941|Ga0187850_10165080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1031 | Open in IMG/M |
| 3300017972|Ga0187781_10200917 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
| 3300017973|Ga0187780_11023555 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300018085|Ga0187772_11340904 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300020018|Ga0193721_1174564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 502 | Open in IMG/M |
| 3300020199|Ga0179592_10067325 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Rhodothermaeota → Rhodothermia → Rhodothermales → Rubricoccaceae → Rubrivirga → Rubrivirga marina | 1637 | Open in IMG/M |
| 3300020580|Ga0210403_10179652 | All Organisms → cellular organisms → Bacteria | 1734 | Open in IMG/M |
| 3300020581|Ga0210399_11025118 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300020581|Ga0210399_11077781 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300020583|Ga0210401_11368025 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300021086|Ga0179596_10422997 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300021088|Ga0210404_10591365 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300021168|Ga0210406_10127236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2150 | Open in IMG/M |
| 3300021170|Ga0210400_10704946 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300021171|Ga0210405_10627020 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300021171|Ga0210405_11114041 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300021432|Ga0210384_10001403 | All Organisms → cellular organisms → Bacteria | 32905 | Open in IMG/M |
| 3300021479|Ga0210410_10798449 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300021479|Ga0210410_10963115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
| 3300021560|Ga0126371_10107728 | Not Available | 2788 | Open in IMG/M |
| 3300024330|Ga0137417_1497071 | All Organisms → cellular organisms → Bacteria | 2784 | Open in IMG/M |
| 3300026285|Ga0209438_1052198 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
| 3300026315|Ga0209686_1045729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1618 | Open in IMG/M |
| 3300026318|Ga0209471_1189821 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300026320|Ga0209131_1203322 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300026334|Ga0209377_1068442 | All Organisms → cellular organisms → Bacteria | 1534 | Open in IMG/M |
| 3300026342|Ga0209057_1250137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300026467|Ga0257154_1082250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300027591|Ga0209733_1043651 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300027616|Ga0209106_1047565 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300027629|Ga0209422_1053251 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300027651|Ga0209217_1040245 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
| 3300027768|Ga0209772_10268653 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300027862|Ga0209701_10019538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4415 | Open in IMG/M |
| 3300028047|Ga0209526_10041048 | All Organisms → cellular organisms → Bacteria | 3256 | Open in IMG/M |
| 3300028047|Ga0209526_10138708 | All Organisms → cellular organisms → Bacteria | 1705 | Open in IMG/M |
| 3300029636|Ga0222749_10508326 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 653 | Open in IMG/M |
| 3300031057|Ga0170834_107159917 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300031446|Ga0170820_12358571 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300031474|Ga0170818_112761310 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300031754|Ga0307475_10108541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2174 | Open in IMG/M |
| 3300031754|Ga0307475_10446029 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300031754|Ga0307475_11339482 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300031781|Ga0318547_10901115 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300031820|Ga0307473_10252746 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300031833|Ga0310917_10973839 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 569 | Open in IMG/M |
| 3300031946|Ga0310910_10040246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3240 | Open in IMG/M |
| 3300031946|Ga0310910_10722978 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 786 | Open in IMG/M |
| 3300031954|Ga0306926_12308022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300032060|Ga0318505_10123836 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300032180|Ga0307471_100868425 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300032180|Ga0307471_102217929 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300032805|Ga0335078_11694774 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300033004|Ga0335084_12287195 | Not Available | 522 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 28.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.38% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.03% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.17% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.59% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.59% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.59% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.59% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.72% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.86% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.86% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.86% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_02427810 | 2088090014 | Soil | LIDTEGQKAIDVFYLTSQGRKLDSRKRDVLREVLQGTLG |
| JGI12636J13339_10002921 | 3300001154 | Forest Soil | IDTEGQKAIDVFYLTEQGNKLNAQKKSLLQEVLQGTLA* |
| JGI12627J18819_104023722 | 3300001867 | Forest Soil | DTEGQKAIDVFYLTSQGNKLDSRKQDVLREVLQGTLG* |
| JGI12627J18819_104992681 | 3300001867 | Forest Soil | IDTEGQKAIDVFYLTSRGKKLEPQKQEVLREVLQGTLG* |
| JGI25616J43925_102705181 | 3300002917 | Grasslands Soil | LIDTEGQKAIDVFYLTAQGGKLTLQKKELLREVLEATLG* |
| Ga0062384_1013707411 | 3300004082 | Bog Forest Soil | LIDTEGQKAIDVFYLTEQGKKLSPEKQEALLKALHEKLG* |
| Ga0062389_1017346821 | 3300004092 | Bog Forest Soil | LIDTEGQKAIDVFYLTEQGKKLSPEKQEALLQALHEKLG* |
| Ga0066388_1019335281 | 3300005332 | Tropical Forest Soil | LIDTEGQKAIDVFYLTSHGNKLDSRKQDVLREVLQGTLG* |
| Ga0070678_1001563691 | 3300005456 | Miscanthus Rhizosphere | ALIDTEGHTAIDVFYLTSGGEKLQAGKQEELRATLTTILK* |
| Ga0066707_102765383 | 3300005556 | Soil | LIDTEGQKAIDGFYLTSQGKKLAAQKQDLLREVLQGTLG* |
| Ga0066693_101386541 | 3300005566 | Soil | ALIDTEGQKAIDVFYLTEQRHKLSAEKQEALRDALQRALR* |
| Ga0066702_109074122 | 3300005575 | Soil | GHKAIDVFYLTAQGKKLTGQKQELLREVLQGTLS* |
| Ga0066903_1014078041 | 3300005764 | Tropical Forest Soil | LIDTEGQKAIDVFYLTSQGKKLTAQKQDLLREVLQGTLG* |
| Ga0070766_101525292 | 3300005921 | Soil | DTEGQKAIDVFYLTEQGEKLSLEKQDALRQALQQKLG* |
| Ga0075014_1003848152 | 3300006174 | Watersheds | TEGQKAIDVFYLTEQGNKLNAQKKNLLHEVLQGTLA* |
| Ga0097621_1005779552 | 3300006237 | Miscanthus Rhizosphere | EGQKAIDVFYLTSQSKKLDSRKQEVLREVLQGTLG* |
| Ga0079221_107581441 | 3300006804 | Agricultural Soil | GHKAIDVFYLTAQGKKLTEQKQELLREVLQGTLS* |
| Ga0099793_101365482 | 3300007258 | Vadose Zone Soil | ALIDTEGQKAIDVFYLTTQGQKLPPQKQELLRELLQGTLG* |
| Ga0099794_108124592 | 3300007265 | Vadose Zone Soil | IDTEGHKAIDVFYLTAQGKKLTTQKQELLREVLQGTLV* |
| Ga0099830_103223591 | 3300009088 | Vadose Zone Soil | EGHKAIDVFYLTAQGKKLTTQKQELLREVLQGTLG* |
| Ga0099827_101650531 | 3300009090 | Vadose Zone Soil | TEGHKAIDVFYLTGQGKKLTTQQQELLREVLQGTLI* |
| Ga0099792_103649122 | 3300009143 | Vadose Zone Soil | LIDTEGQKAIDVFYLTSRGKKLEPQKQEMLREVLQGTLG* |
| Ga0134088_101409371 | 3300010304 | Grasslands Soil | EGQKAIDVFYLTSRGKKLDVQKRDVLREVLQGTIG* |
| Ga0134063_100391781 | 3300010335 | Grasslands Soil | DTEGHKAIDVFYLTAQGKKLTAQKQELLREVLQGTLG* |
| Ga0126370_124258651 | 3300010358 | Tropical Forest Soil | EGQKVIDVFYLTEQGKKLGAEKQAALFEALRSKLG* |
| Ga0126376_112480633 | 3300010359 | Tropical Forest Soil | GQKAIDVFYLTEDGKKLSASKQQMLRDALQGTLG* |
| Ga0126372_101628945 | 3300010360 | Tropical Forest Soil | DTEGQKAIDVFYLTSHGNKLDSRKQDVLREVLQGTLG* |
| Ga0126378_123483931 | 3300010361 | Tropical Forest Soil | TEGHKAIDVFYLTAQGRKLTAQKQELLREVLQGTLS* |
| Ga0126378_134274252 | 3300010361 | Tropical Forest Soil | TEGQKAIDVFYLTEDGKKLSASKQQMLRDALQGTLG* |
| Ga0126379_137588632 | 3300010366 | Tropical Forest Soil | DTEGHKAIDVFYLTAQGKKLTAQKQELLREVLHGTLG* |
| Ga0126383_101675281 | 3300010398 | Tropical Forest Soil | LIDTEGQKAIDVFYLTSQGNKLDPRKQDVLREVLHGTLA* |
| Ga0126383_123399961 | 3300010398 | Tropical Forest Soil | TEGHKAIDVFYLTAQGKKLTAQKQELLREVLQGTLS* |
| Ga0134123_129798241 | 3300010403 | Terrestrial Soil | ALIDTEGHTAIDVFYLTSGGEKLKAGKQEELRATLTTILK* |
| Ga0150983_126082391 | 3300011120 | Forest Soil | IDTEGQKAIDVFYLTERGKKLSQQKQELLREVLESTLS* |
| Ga0137391_100507375 | 3300011270 | Vadose Zone Soil | LIDTEGQKAIDVFYITAQGKKLPTQKQELLREVLQG |
| Ga0137391_100977201 | 3300011270 | Vadose Zone Soil | GQKAIDVFYLTEQGKKLTSQKQELLREALQGTLG* |
| Ga0137393_110951212 | 3300011271 | Vadose Zone Soil | LIDTEGQKAIDVFYLTEQGKKLSSQKQDLLREVLQGTLG* |
| Ga0137393_118016981 | 3300011271 | Vadose Zone Soil | EGQKAIDVFYLTDQGKKLGAQMKELLREVLQRTLV* |
| Ga0137388_117483922 | 3300012189 | Vadose Zone Soil | ALIDTEGQKAIDVFYLTAQDNKLNAQKKNLLHEVLQGTLP* |
| Ga0137388_118521821 | 3300012189 | Vadose Zone Soil | GHKAIDVFYLTAQGKKLTAQKQELLREVLQGTLS* |
| Ga0137365_100217901 | 3300012201 | Vadose Zone Soil | IDTEGQKAIDVFYLTEQGKKLTSQKQELLREALQGTLG* |
| Ga0137399_101396291 | 3300012203 | Vadose Zone Soil | TEGHKAIDVFYLTAQGKKLTTQKQELLREVLQGTLV* |
| Ga0137399_114422542 | 3300012203 | Vadose Zone Soil | LIDTEGQKAIDVFYLTAQGKKLPPQKQELLREVLQGTLS* |
| Ga0137379_100646433 | 3300012209 | Vadose Zone Soil | IDTEGHKAIDAFYLTALGEKLTTQKQELLREVLQGTLV* |
| Ga0137377_108942632 | 3300012211 | Vadose Zone Soil | EGHKAIDVFYLTAQGKKLTTQKQELLREVLQGTLV* |
| Ga0137370_103398242 | 3300012285 | Vadose Zone Soil | VALIDTEGHKAIDVFYLTAQEKKLTTQKQELLREVLQGTLA* |
| Ga0137370_107401902 | 3300012285 | Vadose Zone Soil | DTEGHKAIDVFYLTAQGKKLTTQKQELLREVLQGTLA* |
| Ga0137360_107240171 | 3300012361 | Vadose Zone Soil | TEGHKAIDAFYLTAQGEKLTAQKQELLREVLQGTLV* |
| Ga0137358_100505623 | 3300012582 | Vadose Zone Soil | DTEGQKAIDVFYLTEHAKKLGTEKQDLLRASLQHALA* |
| Ga0157288_104194452 | 3300012901 | Soil | RGALLALIDTEGQKAIDVFYLTSQGSKLDSRKQDVLREVLQGTLG* |
| Ga0137395_105188612 | 3300012917 | Vadose Zone Soil | IDTEGQKAIDVFYLTSRGKKLEPQKQEMLREVLQGTLG* |
| Ga0137396_101226541 | 3300012918 | Vadose Zone Soil | TEGHKAIDVFYLTAQGKKLTTQKQELLCEVLQGTLV* |
| Ga0137419_102971821 | 3300012925 | Vadose Zone Soil | TEGEKAIDVFYLTAQGKKLDSRKQEVLQEVLQGTLG* |
| Ga0137419_104906282 | 3300012925 | Vadose Zone Soil | EGQKAIDVFYLTAQNKKLSAQKQDLLREVLQGMLG* |
| Ga0137419_111831802 | 3300012925 | Vadose Zone Soil | LIDTEGQKAIDVFYLTAQGGKLTPQKKELLREVLEATLG* |
| Ga0137419_112749753 | 3300012925 | Vadose Zone Soil | EGHKAIDVFYLTAQGKKLTTQKQELLREVLQGTLF* |
| Ga0137416_116200752 | 3300012927 | Vadose Zone Soil | TEGQKAIDVFYLTAQGKKLTTQKQELLREVLQGTLV* |
| Ga0137407_100225605 | 3300012930 | Vadose Zone Soil | ALIDTEGQKAIDVFYLTSRGKKLDAQKREVLREVLQGTIG* |
| Ga0164303_102183711 | 3300012957 | Soil | ALIDTEGQKAIDVFYLTSQSKKLDSRKQEVLREVLQGTLG* |
| Ga0181526_101356524 | 3300014200 | Bog | IDTEGQKAIDVFYLTAQGKKLTTQKQELLREVLMATLT* |
| Ga0137411_11884712 | 3300015052 | Vadose Zone Soil | DTEGHKAIDVFYLTAQGKKLTTQKQELLREVLQGTLV* |
| Ga0163161_116142931 | 3300017792 | Switchgrass Rhizosphere | TEGQKVIDVFYLTEQGKKLSLHKQEILRRALQGKLE |
| Ga0187850_101650804 | 3300017941 | Peatland | EGQKAIDVFYLTGQGKKLAPQKQELLREVLNATLS |
| Ga0187781_102009171 | 3300017972 | Tropical Peatland | LIDTEGHKAIDVFYLTTQGKKLAAQKQELLREVLQGTLA |
| Ga0187780_110235552 | 3300017973 | Tropical Peatland | LIDTEGQKAIDVFYLTSQGKKLTSQKKELLREVLQATLS |
| Ga0187772_113409041 | 3300018085 | Tropical Peatland | EGQKAIDVFYLTSQGQKLSAQKQVLLREVLQATLS |
| Ga0193721_11745641 | 3300020018 | Soil | IDTEGHKAIDVFYLTAQGKKLTTQKQELLCEVLQGTLV |
| Ga0179592_100673252 | 3300020199 | Vadose Zone Soil | DTEGHKAIDVFYLTAQGKKLTTQKQELLREVLQGTLV |
| Ga0210403_101796521 | 3300020580 | Soil | IEGQKAIDVFYLTEQAKKLSAEKQQSLREALQSALG |
| Ga0210399_110251182 | 3300020581 | Soil | EGQKAIDVFYLTSRGKKLTEQIKESLRQELQRSLN |
| Ga0210399_110777812 | 3300020581 | Soil | IDTEGQKAIDVFYLTERGEKLSQQKHELLREVLQSTLS |
| Ga0210401_113680251 | 3300020583 | Soil | DTEGQKAIDVFYLTEQGKKLSPEKQEALLKALHEKLG |
| Ga0179596_104229971 | 3300021086 | Vadose Zone Soil | EVALIDTEGHKAIDAFYLTALGEKLTTQKQELLREVLQGTLV |
| Ga0210404_105913652 | 3300021088 | Soil | IDTEGLKAIDVFYLTTQGKKLTSQKQELLREVLQGTLG |
| Ga0210406_101272361 | 3300021168 | Soil | VALINTEGQKAIDVFYLTAQGKKLTTSKQDLVREVLQGTLG |
| Ga0210400_107049462 | 3300021170 | Soil | TEGQKVIDVFYLTEQAKKLSAEKQQSLRLALQSALG |
| Ga0210405_106270201 | 3300021171 | Soil | LIDTEGQKAIDVFYLTEQGKKLSIQKQDLLREVLQGTLG |
| Ga0210405_111140411 | 3300021171 | Soil | TEGQKAIDVFYLTEQGKKLSAEKQEALRGALQSALG |
| Ga0210384_1000140313 | 3300021432 | Soil | LIDTEGQKAIDVFYLTAQANKLDAQKKNLLHEVLQGTLA |
| Ga0210410_107984491 | 3300021479 | Soil | DTEGQKAIDVFYLTEQGKKLSAEKQEALRGALQSALG |
| Ga0210410_109631151 | 3300021479 | Soil | DTEGQKAIDVFYLTEQAKKLSPEKQQSLREALQGALG |
| Ga0126371_101077281 | 3300021560 | Tropical Forest Soil | LIDTEGHKAIDVFYLTAQSKKLTAQKQELLREVLQGTLS |
| Ga0137417_14970714 | 3300024330 | Vadose Zone Soil | VALIDTEGQKAIDVFYLTEQREKLSTQKQELLREVLQGTLG |
| Ga0209438_10521982 | 3300026285 | Grasslands Soil | LIDTEGQKAIDVFYLTAQGGKLTPQKKELLREVLEATLG |
| Ga0209686_10457291 | 3300026315 | Soil | EGHKAIDVFYLTGQGKKLTTQKQELLREVLQGTLV |
| Ga0209471_11898212 | 3300026318 | Soil | ALIDTEGHKAIDVFYLTGQGKKLTTQKQELLREVLQGTLV |
| Ga0209131_12033222 | 3300026320 | Grasslands Soil | TEGQKAIDVFYLTAQGKKLTTQKQELLREVLQGTLV |
| Ga0209377_10684423 | 3300026334 | Soil | IDTEGQKAIDVFYLTSRGKKLDAQKREVLREVLEGTIG |
| Ga0209057_12501372 | 3300026342 | Soil | IDTEGHKAIDVFYLTAQGKKLTAQKQELLREVLQGTLS |
| Ga0257154_10822502 | 3300026467 | Soil | EGQKVIDVFYLTEHGKKLSPETQESLRRALREKLG |
| Ga0209733_10436511 | 3300027591 | Forest Soil | LIDTEGQKVIDVFYLTEQGKKLSAEKQESLRQALNAALV |
| Ga0209106_10475651 | 3300027616 | Forest Soil | EGQKAIDVFYLTSRGKKLTEQIKESLRQELQRSLS |
| Ga0209422_10532511 | 3300027629 | Forest Soil | DTEGQKAIDVFYLTSRGKKLTEKIKDGLRQELQRSLG |
| Ga0209217_10402453 | 3300027651 | Forest Soil | LIDTEGQKAIDVFYLTSRGKKLTDQIKDALRQDLQRSIG |
| Ga0209772_102686531 | 3300027768 | Bog Forest Soil | EVALIDTEGQKAIDVFYLTSEAKKLSASKQELLREVLKGTLN |
| Ga0209701_100195383 | 3300027862 | Vadose Zone Soil | DTEGQKAIDVFYLTAQGKKLSPQKQELLREVLQGTLS |
| Ga0209526_100410481 | 3300028047 | Forest Soil | IDTEGQKAIDVFYLTERAKKLSAEKQQSLCEALQSALR |
| Ga0209526_101387082 | 3300028047 | Forest Soil | TEGQKAIDVFYLTEHTKKLSAEKQQSLREALQSALG |
| Ga0222749_105083261 | 3300029636 | Soil | EGQKAIDVFYLTAQGKKLTTQKQELLRAVLQGTLV |
| Ga0170834_1071599171 | 3300031057 | Forest Soil | IDTEGQKVIDVFYLTEQGKKLGPEKQAALFEALRTKLG |
| Ga0170820_123585712 | 3300031446 | Forest Soil | DTEGQKAIDVFYLTSRGKKLESQKQEILREVLQGTLG |
| Ga0170818_1127613102 | 3300031474 | Forest Soil | DTEGQKAIDVFYLTAQGRKLTPQKQELLREVLLAMLA |
| Ga0307475_101085413 | 3300031754 | Hardwood Forest Soil | DTEGQKAIDVFYLTSQGKKLEPSKQEVLREVLQGTLG |
| Ga0307475_104460291 | 3300031754 | Hardwood Forest Soil | LIDTEGQKAIDVFYLTSRGKKLEPQKQEALREVLQGTLG |
| Ga0307475_113394821 | 3300031754 | Hardwood Forest Soil | LIDTEGQKAIDVFYLTEQSKKLSPEKQNALRQALQQKLG |
| Ga0318547_109011151 | 3300031781 | Soil | DTEGQKAIDVFYLTTQGRKLTSPKKDLVRDVLQGTLI |
| Ga0307473_102527462 | 3300031820 | Hardwood Forest Soil | ALIDTEGQKAIDVFYLTSRGKKLTEQIKDALRQDLQRSLG |
| Ga0310917_109738391 | 3300031833 | Soil | IDTEGQKAIDVFYLSAQSRKLTAQKQEVLREVLQATLS |
| Ga0310910_100402466 | 3300031946 | Soil | TEGQKAIDVFYLTSQGNKLDSRKQDVLREVLQGTLG |
| Ga0310910_107229782 | 3300031946 | Soil | IDTEGQKAIDVFYLSAQSGKLTAQKQEVLREVLQATLS |
| Ga0306926_123080222 | 3300031954 | Soil | VALVDTEGQKAIDVFYLTTQGRKLTSPKKDLVRDVLQGTLI |
| Ga0318505_101238361 | 3300032060 | Soil | ALIDTEGQKAIDVFYLTSQGNKLDSRKQDVLREVLQGTLG |
| Ga0307471_1008684251 | 3300032180 | Hardwood Forest Soil | DTEGQKAIDVFYLTEQAKKLSAEKQQSLREALQSALG |
| Ga0307471_1022179292 | 3300032180 | Hardwood Forest Soil | ALIDTEGQKAIDVFYLTEQAKKLGTEKQDLLRASLQHALA |
| Ga0335078_116947741 | 3300032805 | Soil | IDTEGQKAIDVFYLTSQGKKLLPQKQELLKEVLQGTLS |
| Ga0335084_122871951 | 3300033004 | Soil | TEGQKAIDVFYLTSQGKKLAAQKQELLKEVLQGTLS |
| ⦗Top⦘ |