


| Basic Information | |
|---|---|
| Family ID | F079011 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 40 residues |
| Representative Sequence | RAYMFGDEFRRYIENDLMKREPHPDAKPMGAFSIGQSAT |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 18.10 % |
| % of genes near scaffold ends (potentially truncated) | 78.45 % |
| % of genes from short scaffolds (< 2000 bps) | 84.48 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.897 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.793 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.897 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.966 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.40% β-sheet: 0.00% Coil/Unstructured: 80.60% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF00180 | Iso_dh | 31.90 |
| PF08450 | SGL | 12.07 |
| PF03600 | CitMHS | 10.34 |
| PF02687 | FtsX | 3.45 |
| PF00694 | Aconitase_C | 2.59 |
| PF02567 | PhzC-PhzF | 1.72 |
| PF07366 | SnoaL | 1.72 |
| PF07007 | LprI | 0.86 |
| PF14559 | TPR_19 | 0.86 |
| PF12680 | SnoaL_2 | 0.86 |
| PF13751 | DDE_Tnp_1_6 | 0.86 |
| PF13744 | HTH_37 | 0.86 |
| PF01243 | Putative_PNPOx | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 12.07 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 12.07 |
| COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 1.72 |
| COG3755 | Uncharacterized conserved protein YecT, DUF1311 family | Function unknown [S] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.90 % |
| Unclassified | root | N/A | 18.10 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2065487018|GPINP_F5MS3JC02FU6LI | Not Available | 522 | Open in IMG/M |
| 2170459010|GIO7OMY01BS199 | Not Available | 502 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10107109 | Not Available | 588 | Open in IMG/M |
| 3300000955|JGI1027J12803_101396029 | Not Available | 679 | Open in IMG/M |
| 3300000955|JGI1027J12803_102056512 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300001139|JGI10220J13317_10652034 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300004114|Ga0062593_100020531 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 3476 | Open in IMG/M |
| 3300005186|Ga0066676_11135611 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005293|Ga0065715_10152238 | All Organisms → cellular organisms → Bacteria | 1716 | Open in IMG/M |
| 3300005293|Ga0065715_10282859 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300005332|Ga0066388_104281411 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 727 | Open in IMG/M |
| 3300005343|Ga0070687_100155432 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300005353|Ga0070669_101467397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 592 | Open in IMG/M |
| 3300005440|Ga0070705_101695926 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300005471|Ga0070698_101583477 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300005540|Ga0066697_10197562 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300005553|Ga0066695_10769704 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300005559|Ga0066700_10714403 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300005561|Ga0066699_10615391 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300005566|Ga0066693_10041411 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1505 | Open in IMG/M |
| 3300005566|Ga0066693_10048929 | All Organisms → cellular organisms → Bacteria | 1405 | Open in IMG/M |
| 3300005614|Ga0068856_101245655 | Not Available | 760 | Open in IMG/M |
| 3300005713|Ga0066905_100096588 | All Organisms → cellular organisms → Bacteria | 1993 | Open in IMG/M |
| 3300005764|Ga0066903_106035290 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300005764|Ga0066903_106507196 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 609 | Open in IMG/M |
| 3300005983|Ga0081540_1051905 | All Organisms → cellular organisms → Bacteria | 2024 | Open in IMG/M |
| 3300006028|Ga0070717_10618820 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300006057|Ga0075026_100256231 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300006175|Ga0070712_101198305 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300006358|Ga0068871_100509843 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300006800|Ga0066660_10501251 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300006804|Ga0079221_10342999 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300006893|Ga0073928_10429349 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 961 | Open in IMG/M |
| 3300006904|Ga0075424_100196490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2142 | Open in IMG/M |
| 3300006904|Ga0075424_100449066 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
| 3300009012|Ga0066710_100319310 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2283 | Open in IMG/M |
| 3300009012|Ga0066710_100936297 | All Organisms → cellular organisms → Bacteria | 1335 | Open in IMG/M |
| 3300009100|Ga0075418_10144375 | All Organisms → cellular organisms → Bacteria | 2532 | Open in IMG/M |
| 3300009146|Ga0105091_10073278 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1544 | Open in IMG/M |
| 3300009147|Ga0114129_10772421 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
| 3300010047|Ga0126382_10261902 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1274 | Open in IMG/M |
| 3300010048|Ga0126373_10449743 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
| 3300010320|Ga0134109_10261038 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 656 | Open in IMG/M |
| 3300010321|Ga0134067_10080104 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300010335|Ga0134063_10167329 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1025 | Open in IMG/M |
| 3300010359|Ga0126376_10715928 | Not Available | 965 | Open in IMG/M |
| 3300010362|Ga0126377_11485010 | Not Available | 751 | Open in IMG/M |
| 3300011998|Ga0120114_1067567 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300012198|Ga0137364_10013963 | All Organisms → cellular organisms → Bacteria | 4717 | Open in IMG/M |
| 3300012198|Ga0137364_11042192 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 617 | Open in IMG/M |
| 3300012198|Ga0137364_11427400 | Not Available | 512 | Open in IMG/M |
| 3300012199|Ga0137383_11366946 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 502 | Open in IMG/M |
| 3300012202|Ga0137363_11366303 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 598 | Open in IMG/M |
| 3300012202|Ga0137363_11690436 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300012205|Ga0137362_11286595 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300012208|Ga0137376_10050337 | All Organisms → cellular organisms → Bacteria | 3405 | Open in IMG/M |
| 3300012285|Ga0137370_10159695 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1307 | Open in IMG/M |
| 3300012285|Ga0137370_10533937 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 720 | Open in IMG/M |
| 3300012359|Ga0137385_10132872 | All Organisms → cellular organisms → Bacteria | 2195 | Open in IMG/M |
| 3300012362|Ga0137361_10889377 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300012929|Ga0137404_10452651 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1139 | Open in IMG/M |
| 3300012948|Ga0126375_10596303 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300012960|Ga0164301_10631533 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300012971|Ga0126369_12510044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300012975|Ga0134110_10204050 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 830 | Open in IMG/M |
| 3300012984|Ga0164309_11965615 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 501 | Open in IMG/M |
| 3300014745|Ga0157377_10384210 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300014968|Ga0157379_11054696 | Not Available | 777 | Open in IMG/M |
| 3300015373|Ga0132257_102294223 | Not Available | 699 | Open in IMG/M |
| 3300015374|Ga0132255_101739095 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300016319|Ga0182033_10035287 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3243 | Open in IMG/M |
| 3300016319|Ga0182033_11030775 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300016341|Ga0182035_10562685 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 981 | Open in IMG/M |
| 3300016357|Ga0182032_10045260 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2814 | Open in IMG/M |
| 3300016387|Ga0182040_10065373 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2333 | Open in IMG/M |
| 3300018000|Ga0184604_10325777 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300018066|Ga0184617_1239487 | Not Available | 543 | Open in IMG/M |
| 3300018081|Ga0184625_10374777 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300018081|Ga0184625_10670814 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 500 | Open in IMG/M |
| 3300018431|Ga0066655_10193113 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
| 3300018482|Ga0066669_10077660 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2222 | Open in IMG/M |
| 3300019789|Ga0137408_1194907 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300019887|Ga0193729_1052782 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1647 | Open in IMG/M |
| 3300020004|Ga0193755_1167169 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300020004|Ga0193755_1199823 | Not Available | 571 | Open in IMG/M |
| 3300020012|Ga0193732_1019648 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300020022|Ga0193733_1068335 | Not Available | 999 | Open in IMG/M |
| 3300020140|Ga0179590_1152467 | Not Available | 632 | Open in IMG/M |
| 3300025625|Ga0208219_1010471 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3015 | Open in IMG/M |
| 3300025915|Ga0207693_10040667 | Not Available | 3662 | Open in IMG/M |
| 3300025916|Ga0207663_10269510 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1261 | Open in IMG/M |
| 3300025931|Ga0207644_10915150 | Not Available | 735 | Open in IMG/M |
| 3300025933|Ga0207706_10122250 | All Organisms → cellular organisms → Bacteria | 2289 | Open in IMG/M |
| 3300025933|Ga0207706_10895541 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 750 | Open in IMG/M |
| 3300025961|Ga0207712_10046924 | All Organisms → cellular organisms → Bacteria | 2997 | Open in IMG/M |
| 3300025986|Ga0207658_11477492 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 622 | Open in IMG/M |
| 3300026067|Ga0207678_10906943 | Not Available | 779 | Open in IMG/M |
| 3300026330|Ga0209473_1009494 | All Organisms → cellular organisms → Bacteria | 4867 | Open in IMG/M |
| 3300027018|Ga0208475_1009424 | Not Available | 958 | Open in IMG/M |
| 3300028536|Ga0137415_11466951 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 507 | Open in IMG/M |
| 3300028587|Ga0247828_10397902 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300028814|Ga0307302_10200516 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300028881|Ga0307277_10301538 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300030844|Ga0075377_11630986 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300031446|Ga0170820_11340063 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300031719|Ga0306917_10962212 | Not Available | 667 | Open in IMG/M |
| 3300031777|Ga0318543_10409046 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 608 | Open in IMG/M |
| 3300031879|Ga0306919_10266054 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1294 | Open in IMG/M |
| 3300031945|Ga0310913_10966785 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 598 | Open in IMG/M |
| 3300031946|Ga0310910_10767738 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 760 | Open in IMG/M |
| 3300031954|Ga0306926_11768477 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300032180|Ga0307471_100151122 | All Organisms → cellular organisms → Bacteria | 2234 | Open in IMG/M |
| 3300032180|Ga0307471_101809704 | Not Available | 762 | Open in IMG/M |
| 3300032205|Ga0307472_100633184 | Not Available | 950 | Open in IMG/M |
| 3300032421|Ga0310812_10554508 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300033289|Ga0310914_10436061 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1186 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.17% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.31% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.45% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.45% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.59% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.59% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.72% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.86% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.86% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.86% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.86% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.86% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.86% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.86% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2065487018 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020012 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300027018 | Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN575 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300030844 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPINP_03056450 | 2065487018 | Soil | RAYMFGDEFRRYIEDEVMKKQPHRDAKPMGVFPIGQSVS |
| F62_04913320 | 2170459010 | Grass Soil | KAFWKDRAYMFGDEFRRHIEDDLMKRQPHPDAKPMGAFAIGQSAN |
| AF_2010_repII_A001DRAFT_101071092 | 3300000793 | Forest Soil | DRAYMFGDEFRRYIEDEVMKKKPHPDAKPMGVFPIGQSVS* |
| JGI1027J12803_1013960291 | 3300000955 | Soil | AFWKDRAYMFGDEFRRHIENDLMKREPHPDAKPMGAFSIAPKDGMN* |
| JGI1027J12803_1020565121 | 3300000955 | Soil | KERAYMFGDEFRRYIENDLMKREPHPDAKPMGAFSIGQSAT* |
| JGI10220J13317_106520342 | 3300001139 | Soil | WKDRGYMFGEEFRHYVEDDLMERTPHPDAKPMGAFPISQRSE* |
| Ga0062593_1000205311 | 3300004114 | Soil | RAYMFGDEFRRHIEDDLMKREPHPDAKPMGAFRIGTGFAPRN* |
| Ga0066676_111356111 | 3300005186 | Soil | MFLSNRAYMFGDAFQRYIETDLMKREPHPDAKPKGAFSIGQRAE* |
| Ga0065715_101522383 | 3300005293 | Miscanthus Rhizosphere | KERAYMFGDEFRRYIENDVMKREPHPDAKPMGAFSIGRPAE* |
| Ga0065715_102828591 | 3300005293 | Miscanthus Rhizosphere | KAFWKDRAYMFGDEFRRHIENDLMKRQPHPDAKPMGAFSLGQSTEQESAR* |
| Ga0066388_1042814112 | 3300005332 | Tropical Forest Soil | FWKDRAYMFGDEFRRYIEDEVMKKKPHPDAKPMGVFSIGQRSE* |
| Ga0070687_1001554321 | 3300005343 | Switchgrass Rhizosphere | RAYMFGDEFRRHIENDLMKREPHPDAKPMGAFSIGRPSE* |
| Ga0070669_1014673971 | 3300005353 | Switchgrass Rhizosphere | WADRGYMFGAKFRDYIETDLMQRTPHPGAKPLGAFNIGQQTS* |
| Ga0070705_1016959262 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | RAYMFGDEFRRHIENDLMKRKPHPDAKPMGAFSIGQSTQ* |
| Ga0070698_1015834772 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | FWKDRAYMFGDEFRRHIENDLMKRQPHPDAKPMGAFSLGQSAEQESAR* |
| Ga0066697_101975622 | 3300005540 | Soil | MFGEEFRRYVENDLMKREPHPDAKPFGAFPIGRRAE* |
| Ga0066695_107697041 | 3300005553 | Soil | MFGEEFRHYVEDDLMKRTLHPDAKPMGAFPIGQRSE* |
| Ga0066700_107144031 | 3300005559 | Soil | DFFGEEFRRHVEDDLMKRTSHPDAKPMGAFSIGRPSE* |
| Ga0066699_106153912 | 3300005561 | Soil | MFGEEFRHYVEDDLMKRTPHPDAKPMGAFPIGQRSE* |
| Ga0066693_100414111 | 3300005566 | Soil | ERGYLFGEEFRRHVENGLMKREPHPDAKPMGAFSIGREG* |
| Ga0066693_100489293 | 3300005566 | Soil | MFGEEFRHYVEDDLMKRTPYPDAKPMGAFPIGRRSE* |
| Ga0068856_1012456552 | 3300005614 | Corn Rhizosphere | YLFGEEFRRYIENDLMKREPHPDAKPLGAFSISQAQSN* |
| Ga0066905_1000965881 | 3300005713 | Tropical Forest Soil | RAYMFGDEFRRYIENDVMKREPHPDAKPMGAFSIAEVRNNELA* |
| Ga0066903_1060352901 | 3300005764 | Tropical Forest Soil | PGGKDFWKERGYMFGDEFRQYIEDDLIKREPHPGAKPLGAFRIG* |
| Ga0066903_1065071962 | 3300005764 | Tropical Forest Soil | FWKERGYMFGDEFRRYIEDDLLKREPHPGAKPLGAFSIGQGPD* |
| Ga0081540_10519052 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MFGDEFRRYIEEDVMKKKPHPDAKPMGAFSIGQRND* |
| Ga0070717_106188202 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GYMFGEEFRRYVENDLMKREPHPDAKPLGAFPIGRRAE* |
| Ga0075026_1002562311 | 3300006057 | Watersheds | GKAFWKDRAYMFGDEFRRYIEDDLIKRQPHPDAKPMGVFSISQRSE* |
| Ga0070712_1011983052 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GKAFWKERAYMFGDEFRRYIETDLMKREPHPDAKPMGAFAIGQPVK* |
| Ga0068871_1005098432 | 3300006358 | Miscanthus Rhizosphere | MFGEEFRRYVENDLMKRGPHPDAKPLGAFPIGRHAE* |
| Ga0066660_105012511 | 3300006800 | Soil | FWKERGYLFGEEFRRHVEDDLMKREPHPDARPMGAFSICRGAE* |
| Ga0079221_103429991 | 3300006804 | Agricultural Soil | LFGEDFRQYIENDLMIRPPHPDAKPLGAFTIGPRTG* |
| Ga0073928_104293492 | 3300006893 | Iron-Sulfur Acid Spring | AYLFDDEFRRHVEDDLMKRTPHPDAKPLGAFSIGKKSDE* |
| Ga0075424_1001964903 | 3300006904 | Populus Rhizosphere | MFGEEFRRYVENDLMKREPHPDAKPLGAFPIGRRAE* |
| Ga0075424_1004490661 | 3300006904 | Populus Rhizosphere | WKDRAYMFGDEFRRHIENDLMKREPHPDAKPMGAFSIGQSAT* |
| Ga0066710_1003193102 | 3300009012 | Grasslands Soil | VTDFFGEEFRRHVESNLMKRTPRPDAKPMGAFSIDRQGD |
| Ga0066710_1009362971 | 3300009012 | Grasslands Soil | REVTDSFGEEFRRYVENDLMKRTLHPDAKPMGAFSIGRPE |
| Ga0075418_101443753 | 3300009100 | Populus Rhizosphere | MFGDEFRRYIEDEVMKKKPHPDAKPMGVFPIGQPAE* |
| Ga0105091_100732781 | 3300009146 | Freshwater Sediment | RGYLFGDEFRSYVENDVMMRKPHPRAKPMGAFPIGDASC* |
| Ga0114129_107724212 | 3300009147 | Populus Rhizosphere | MFGDEFRRYIEDEVMNKKPHPDAKPMGVFPIGQPAE* |
| Ga0126382_102619021 | 3300010047 | Tropical Forest Soil | MFGDEFRRYIDDDLIKREPHPDAKPMGVFSIGQRPE* |
| Ga0126373_104497433 | 3300010048 | Tropical Forest Soil | DRAYMFGDEFRRYIETDLMNREPHPDAKPMGAFSIGQSAT* |
| Ga0134109_102610381 | 3300010320 | Grasslands Soil | MCGEEFRRYVENDLMKREPHPDAKPFGAFPIGRRAE* |
| Ga0134067_100801042 | 3300010321 | Grasslands Soil | MFGEEFRHYVEDDLMKRTPHPDAKPMGAFPIGRRSE* |
| Ga0134063_101673292 | 3300010335 | Grasslands Soil | MFGEEFRHYVEDDLMKRTPHPDAKPMGVFRIGQQAE* |
| Ga0126376_107159282 | 3300010359 | Tropical Forest Soil | AFWKDRAYMFGDEFRRYIENDVMKKKPHPDAKPMGVFSIAESTK* |
| Ga0126377_114850102 | 3300010362 | Tropical Forest Soil | SDWAYMFGVAFRRYIEAEVMKKKPPPDAKPMGAIPIGQSVS* |
| Ga0120114_10675671 | 3300011998 | Permafrost | WKERGYLFGEEFRRHVEDDLMKRTPHPDAKPMGAFSIGRRAE* |
| Ga0137364_100139632 | 3300012198 | Vadose Zone Soil | MFGEELRRHVEDDLMKRGPHPDARPMGAFSIGQRVEEVASDRC* |
| Ga0137364_110421922 | 3300012198 | Vadose Zone Soil | YLFGEEFRRHVENGLMKREPHPDAKPMGAFSIGREG* |
| Ga0137364_114274001 | 3300012198 | Vadose Zone Soil | RAYMFGDEFRRYIENDVMKREPHPDAKPMGAFSIGRPAE* |
| Ga0137383_113669462 | 3300012199 | Vadose Zone Soil | AYMFGDAFQRYIETDLMKREPHPDAKPKGAFSIGQRAE* |
| Ga0137363_113663032 | 3300012202 | Vadose Zone Soil | MFGEEFRRYVENDLMKREPHPDAKPLGAFPIGQRSE* |
| Ga0137363_116904361 | 3300012202 | Vadose Zone Soil | MFGDEFRRYVENDLMKREPHPDAKAMGAFPIGHR* |
| Ga0137362_112865951 | 3300012205 | Vadose Zone Soil | FWKERGYMFGDEFRRYVESDLMKREPHPDTKPMGAFPIGQSAT* |
| Ga0137376_100503372 | 3300012208 | Vadose Zone Soil | MFGDAFQRYIETDLMKREPHPDAKPKGAFSIGQRAE* |
| Ga0137370_101596951 | 3300012285 | Vadose Zone Soil | VLFGEEFRRYVENDLMKRTPHPDAKPMGAFGIGRPSE* |
| Ga0137370_105339372 | 3300012285 | Vadose Zone Soil | FGDEFRCYIESDLMKRKPHPDAKPMGAFSLDRSAE* |
| Ga0137385_101328722 | 3300012359 | Vadose Zone Soil | MFGDAFQRYIETDLMKREPYPDAKPKGAFSIGQRAE* |
| Ga0137361_108893772 | 3300012362 | Vadose Zone Soil | FGEEFRRYVENDLMKREPHPDAKPMGAFSIGQSAT* |
| Ga0137404_104526511 | 3300012929 | Vadose Zone Soil | WEIARGYMFGEEFRRYVEDDLMKRAPYPDAKPMGAFSIGRPSE* |
| Ga0126375_105963033 | 3300012948 | Tropical Forest Soil | AYMFGDEFRRYIENDVMKREPHPDAKPMGAFSIAEVRNNELA* |
| Ga0164301_106315331 | 3300012960 | Soil | GGKAFWKDRAYMFGDEFRRYIEDEVMKKQPHPDAKPMGVFPIGQPAE* |
| Ga0126369_125100441 | 3300012971 | Tropical Forest Soil | LFGEEFRRYVEDDLMKRKPHPDAKPLGAFSIGKETS* |
| Ga0134110_102040502 | 3300012975 | Grasslands Soil | MFGEEFRRYLENDLMKREPHPDAKPFGAFPIGRRAE* |
| Ga0164309_119656151 | 3300012984 | Soil | MFGEEFRRYVENDLMKREPHPDAKPLGAFPIGRHAE* |
| Ga0157377_103842102 | 3300014745 | Miscanthus Rhizosphere | MFGEEFRRHVEDDLMKRTPHSDAKPMGAFSIGRRAE* |
| Ga0157379_110546962 | 3300014968 | Switchgrass Rhizosphere | AFWKDRAYMFGDEFRQHIESDLMKREPHADAKPMGAFAIGQPVQ* |
| Ga0132257_1022942232 | 3300015373 | Arabidopsis Rhizosphere | YLFGEEFRQYIENDLMKREPHPDAKPLGAFSISQAQSN* |
| Ga0132255_1017390951 | 3300015374 | Arabidopsis Rhizosphere | KDRAYMFGDEFRRYIETDLMKREPHPDAKPMGAFSLGRSAE* |
| Ga0182033_100352874 | 3300016319 | Soil | WKDRAYMFGDEFRRYIEDEVMKKQPHPDAKPMGVFSIGQRSE |
| Ga0182033_110307751 | 3300016319 | Soil | AFWKDRAYMFGDEFRRYIEDEVMKKQPHPDAKPMGVFPIGQSAT |
| Ga0182035_105626852 | 3300016341 | Soil | YMFGDEFRRYIEDEVMKKQPHPDAKPMGVFSIGQRSE |
| Ga0182032_100452601 | 3300016357 | Soil | DRAYMFGDEFRRYIEDEVMKKQPHPDAKPMGVFSIGQRSE |
| Ga0182040_100653733 | 3300016387 | Soil | FWKDRAYMFGDEFRRYIEDEVMKKQPHPDAKPMGVFSIGQRSE |
| Ga0184604_103257773 | 3300018000 | Groundwater Sediment | FGEEFRRYIENDLMIRPPHPDAKPLGAFTIGPRTE |
| Ga0184617_12394872 | 3300018066 | Groundwater Sediment | AFWKDRAYMFGDEFRRYIENDVMKREPHPDAKPMGAFSIGRPAE |
| Ga0184625_103747771 | 3300018081 | Groundwater Sediment | RAYMFGDEFRRYIENDLMKREPHPDAKPMGAFSIGQSAT |
| Ga0184625_106708142 | 3300018081 | Groundwater Sediment | LFGKEFGDYVENDVMKREPHPNARPMGAFSIGPDRT |
| Ga0066655_101931132 | 3300018431 | Grasslands Soil | MFGEEFRRYVENDLMKREPHPDAKPFGAFPIGRRAE |
| Ga0066669_100776604 | 3300018482 | Grasslands Soil | MFGEEFRHYVEDDLMKRTLHPDAKPMGAFPIGQRSE |
| Ga0137408_11949071 | 3300019789 | Vadose Zone Soil | DRGYMFGEEFRHYVEDDLMKRTPHPDAKPMGAFPIGQRSE |
| Ga0193729_10527821 | 3300019887 | Soil | YLFGEEFRRHVEDDLMKRTPHPDAKPMGAFSIGRRAE |
| Ga0193755_11671692 | 3300020004 | Soil | LFGEEFRRHVEDDLMKRTPHPDAKPMGAFSIGSPAN |
| Ga0193755_11998231 | 3300020004 | Soil | MFGDEFRRYIENDVMKREPHPDAKPMGAFSIAQAQSN |
| Ga0193732_10196483 | 3300020012 | Soil | KDRAYMFGDEFRRYVESDLMKREPHPDAKPMGAFPIGHR |
| Ga0193733_10683352 | 3300020022 | Soil | KERSYLFGEEFRRYIENDLMIRPPHPGAKPLGAFTIGPHTE |
| Ga0179590_11524672 | 3300020140 | Vadose Zone Soil | KERAYMFGDEFRRYIENDVMKREPHPDAKPMGAFSIAQVQKN |
| Ga0208219_10104713 | 3300025625 | Arctic Peat Soil | GYLFGQDFRNHFENDLMKRTPHRAAKPMGAFSIGQKPEGQAAATKT |
| Ga0207693_100406671 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | AYMFGDEFRCYIETDLMKREPHPDAKPMGAFAIGQPVK |
| Ga0207663_102695103 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MFGEEFRHYVEDDLMKRTPHPDAKPMGAFPIGQRSE |
| Ga0207644_109151501 | 3300025931 | Switchgrass Rhizosphere | YLFGEEFRRYIENDLMKREPHPDAKPLGAFSISQAQSN |
| Ga0207706_101222501 | 3300025933 | Corn Rhizosphere | AYMFGDEFRRHIESDLMKRQPHPDAKPMGAFSLGQSTEQESAR |
| Ga0207706_108955412 | 3300025933 | Corn Rhizosphere | SYLFGEEFRRYVEDDLMKRTPHPEAKPMGAFSIGTPAR |
| Ga0207712_100469241 | 3300025961 | Switchgrass Rhizosphere | AFWKDRAYMFGDEFRRHIENDLMKRQPHPDAKPMGAFSLGQSTEQESAR |
| Ga0207658_114774923 | 3300025986 | Switchgrass Rhizosphere | WTERGYLFGEDFRRHVENDLMKRKPHAKAKPMGAFSIGEGGS |
| Ga0207678_109069431 | 3300026067 | Corn Rhizosphere | WKERNYLFGEEFRRYIENDLMKREPHPDAKPLGAFSISQAQSN |
| Ga0209473_10094942 | 3300026330 | Soil | MFGEEFRHYVEDDLMKRTPYPDAKPMGAFPIGRRSE |
| Ga0208475_10094242 | 3300027018 | Soil | RGYLFGEEFRRYIENDLMKRTPHPDAKPMGAFSIAEVRNN |
| Ga0137415_114669511 | 3300028536 | Vadose Zone Soil | FGDEFRRYIEEDLIKREPHPDAKPIGAFSIGQRAE |
| Ga0247828_103979022 | 3300028587 | Soil | RAYMFGDEFRRHIEDDLMKREPHPDARPMGAFSIGPGAE |
| Ga0307302_102005161 | 3300028814 | Soil | ERAYMIGDEFRQYIETDLMKREPHPDAKPMGAFSIGQSAT |
| Ga0307277_103015382 | 3300028881 | Soil | FGDEFRQYIETDLMKREPHPDAKPMGAFSIGQSAT |
| Ga0075377_116309861 | 3300030844 | Soil | YMFGDEFRRYVESDLMKREPHPDAKPMGAFSIGQSAR |
| Ga0170820_113400631 | 3300031446 | Forest Soil | RAYMFGDEFRRYVESDLMKREPHPDAKPMGAFSIGQSAT |
| Ga0306917_109622122 | 3300031719 | Soil | ERAGYLVGEEFRRHVEDDLMKRTLHPDAKPFGVFSIAGIK |
| Ga0318543_104090462 | 3300031777 | Soil | GGKAFWKDRAYMFGDEFRRYIEDDVMKKKPHPDAKPMGVFSIGQRSE |
| Ga0306919_102660542 | 3300031879 | Soil | KDRAYMFGDEFRRYIEDEVMKKQPHPDAKPMGVFSIGQRSE |
| Ga0310913_109667852 | 3300031945 | Soil | FGEEFRRHVEGDLMKRTPHPDAKPLGAFSIGRSDQ |
| Ga0310910_107677382 | 3300031946 | Soil | WKDRAYMFGDEFRRYIEDDVMKKKPHPDAKPMGVFSIGQRSE |
| Ga0306926_117684771 | 3300031954 | Soil | GKAFWKDRAYMFGDEFRRYIEDEVMKKKPHPDAKPMGVFSIAGVTD |
| Ga0307471_1001511223 | 3300032180 | Hardwood Forest Soil | ERAYMFGDEFRRYIETDLMKREPHPDAKPMGAFAIGQPVK |
| Ga0307471_1018097042 | 3300032180 | Hardwood Forest Soil | KERAYMFGDEFRRYIETDLMKREPHPDAKPMGAFAIGQPAK |
| Ga0307472_1006331842 | 3300032205 | Hardwood Forest Soil | ERAYMFGDEFRRYIENDLMKREPHPDARPMGAFSIGRPAE |
| Ga0310812_105545082 | 3300032421 | Soil | MFGDEFRRYIENDVMKKEPHPDAKPMGAFSIGQSAT |
| Ga0310914_104360611 | 3300033289 | Soil | GKVFWKDRAYMFGDEFRRYIEDEVMKKQPHPDAKPMGVFSIGQRSE |
| ⦗Top⦘ |