


| Basic Information | |
|---|---|
| Family ID | F079001 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MNPKRIGFLGFEGVAASELTRAADVFAAATLDGGYGNRISCY |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 38.05 % |
| % of genes near scaffold ends (potentially truncated) | 96.55 % |
| % of genes from short scaffolds (< 2000 bps) | 87.07 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.034 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.965 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.172 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.828 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 44.29% β-sheet: 0.00% Coil/Unstructured: 55.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF08734 | GYD | 47.41 |
| PF13673 | Acetyltransf_10 | 3.45 |
| PF00753 | Lactamase_B | 2.59 |
| PF14659 | Phage_int_SAM_3 | 1.72 |
| PF00916 | Sulfate_transp | 1.72 |
| PF12833 | HTH_18 | 1.72 |
| PF00072 | Response_reg | 0.86 |
| PF00155 | Aminotran_1_2 | 0.86 |
| PF11138 | DUF2911 | 0.86 |
| PF02163 | Peptidase_M50 | 0.86 |
| PF01008 | IF-2B | 0.86 |
| PF00266 | Aminotran_5 | 0.86 |
| PF00378 | ECH_1 | 0.86 |
| PF00248 | Aldo_ket_red | 0.86 |
| PF03989 | DNA_gyraseA_C | 0.86 |
| PF14534 | DUF4440 | 0.86 |
| PF13508 | Acetyltransf_7 | 0.86 |
| PF00165 | HTH_AraC | 0.86 |
| PF13328 | HD_4 | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 47.41 |
| COG0659 | Sulfate permease or related transporter, MFS superfamily | Inorganic ion transport and metabolism [P] | 1.72 |
| COG2233 | Xanthine/uracil permease | Nucleotide transport and metabolism [F] | 1.72 |
| COG2252 | Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family | Nucleotide transport and metabolism [F] | 1.72 |
| COG0182 | 5-methylthioribose/5-deoxyribulose 1-phosphate isomerase (methionine salvage pathway), a paralog of eIF-2B alpha subunit | Amino acid transport and metabolism [E] | 0.86 |
| COG0188 | DNA gyrase/topoisomerase IV, subunit A | Replication, recombination and repair [L] | 0.86 |
| COG1184 | Translation initiation factor 2B subunit, eIF-2B alpha/beta/delta family | Translation, ribosomal structure and biogenesis [J] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.03 % |
| Unclassified | root | N/A | 18.97 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17307818 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria | 2731 | Open in IMG/M |
| 2170459009|GA8DASG02H25Z8 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 506 | Open in IMG/M |
| 2170459014|G1P06HT02H95Q3 | Not Available | 649 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101288866 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101289201 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300000559|F14TC_100726477 | Not Available | 594 | Open in IMG/M |
| 3300002899|JGIcombinedJ43975_10011784 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
| 3300003911|JGI25405J52794_10114373 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 606 | Open in IMG/M |
| 3300004114|Ga0062593_102294107 | Not Available | 607 | Open in IMG/M |
| 3300004463|Ga0063356_102436781 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria | 801 | Open in IMG/M |
| 3300004479|Ga0062595_101091846 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 696 | Open in IMG/M |
| 3300005338|Ga0068868_101540753 | Not Available | 623 | Open in IMG/M |
| 3300005365|Ga0070688_100356832 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300005434|Ga0070709_10408730 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1015 | Open in IMG/M |
| 3300005437|Ga0070710_10586972 | Not Available | 774 | Open in IMG/M |
| 3300005440|Ga0070705_100861646 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 726 | Open in IMG/M |
| 3300005467|Ga0070706_102118982 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300005518|Ga0070699_102199621 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 503 | Open in IMG/M |
| 3300005529|Ga0070741_11116265 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 669 | Open in IMG/M |
| 3300005546|Ga0070696_100429388 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1039 | Open in IMG/M |
| 3300005552|Ga0066701_10401921 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300005558|Ga0066698_10412135 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300005564|Ga0070664_102182229 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 525 | Open in IMG/M |
| 3300006163|Ga0070715_10005605 | All Organisms → cellular organisms → Bacteria | 4200 | Open in IMG/M |
| 3300006175|Ga0070712_101692035 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 554 | Open in IMG/M |
| 3300006791|Ga0066653_10209916 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 988 | Open in IMG/M |
| 3300006791|Ga0066653_10474607 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 635 | Open in IMG/M |
| 3300006796|Ga0066665_10518233 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300006796|Ga0066665_11544361 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300006844|Ga0075428_101159741 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300006871|Ga0075434_100388925 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300009012|Ga0066710_101053186 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300009012|Ga0066710_103264987 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 621 | Open in IMG/M |
| 3300010038|Ga0126315_10767373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 633 | Open in IMG/M |
| 3300010043|Ga0126380_10745383 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 794 | Open in IMG/M |
| 3300010046|Ga0126384_10995206 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300010321|Ga0134067_10426159 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 536 | Open in IMG/M |
| 3300010326|Ga0134065_10295711 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300010358|Ga0126370_11688165 | Not Available | 609 | Open in IMG/M |
| 3300010359|Ga0126376_12470308 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 567 | Open in IMG/M |
| 3300010361|Ga0126378_11154864 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300010361|Ga0126378_11939980 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 671 | Open in IMG/M |
| 3300010366|Ga0126379_13618348 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 518 | Open in IMG/M |
| 3300010373|Ga0134128_10487785 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1374 | Open in IMG/M |
| 3300011444|Ga0137463_1349081 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300012021|Ga0120192_10149327 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 510 | Open in IMG/M |
| 3300012180|Ga0153974_1118003 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 610 | Open in IMG/M |
| 3300012198|Ga0137364_10074013 | All Organisms → cellular organisms → Bacteria | 2337 | Open in IMG/M |
| 3300012198|Ga0137364_11295218 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 543 | Open in IMG/M |
| 3300012202|Ga0137363_11638189 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 536 | Open in IMG/M |
| 3300012205|Ga0137362_11142158 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 661 | Open in IMG/M |
| 3300012206|Ga0137380_10028472 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 5149 | Open in IMG/M |
| 3300012207|Ga0137381_10027654 | All Organisms → cellular organisms → Bacteria | 4550 | Open in IMG/M |
| 3300012207|Ga0137381_11398072 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 592 | Open in IMG/M |
| 3300012208|Ga0137376_10340879 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1301 | Open in IMG/M |
| 3300012209|Ga0137379_11261466 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 645 | Open in IMG/M |
| 3300012210|Ga0137378_10991175 | Not Available | 754 | Open in IMG/M |
| 3300012355|Ga0137369_10312403 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300012356|Ga0137371_11246713 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 553 | Open in IMG/M |
| 3300012360|Ga0137375_10424334 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300012362|Ga0137361_11334117 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300012362|Ga0137361_11379173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300012532|Ga0137373_10154670 | All Organisms → cellular organisms → Bacteria | 1931 | Open in IMG/M |
| 3300012532|Ga0137373_10737597 | Not Available | 732 | Open in IMG/M |
| 3300012683|Ga0137398_10005216 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 6074 | Open in IMG/M |
| 3300012922|Ga0137394_10244848 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1533 | Open in IMG/M |
| 3300012923|Ga0137359_11057070 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 695 | Open in IMG/M |
| 3300012925|Ga0137419_10513341 | Not Available | 953 | Open in IMG/M |
| 3300012960|Ga0164301_11059745 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300012988|Ga0164306_11801440 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 532 | Open in IMG/M |
| 3300013297|Ga0157378_11426328 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 736 | Open in IMG/M |
| 3300015371|Ga0132258_12330543 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
| 3300015374|Ga0132255_100197304 | All Organisms → cellular organisms → Bacteria | 2844 | Open in IMG/M |
| 3300015374|Ga0132255_101028517 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
| 3300016387|Ga0182040_11697825 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 539 | Open in IMG/M |
| 3300018028|Ga0184608_10012751 | All Organisms → cellular organisms → Bacteria | 2901 | Open in IMG/M |
| 3300018056|Ga0184623_10316955 | Not Available | 702 | Open in IMG/M |
| 3300018431|Ga0066655_10808238 | Not Available | 638 | Open in IMG/M |
| 3300019877|Ga0193722_1022541 | All Organisms → cellular organisms → Bacteria | 1628 | Open in IMG/M |
| 3300019888|Ga0193751_1124872 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 954 | Open in IMG/M |
| 3300020006|Ga0193735_1059658 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1119 | Open in IMG/M |
| 3300021560|Ga0126371_10377822 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1556 | Open in IMG/M |
| 3300022694|Ga0222623_10305153 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 611 | Open in IMG/M |
| 3300022756|Ga0222622_10096468 | All Organisms → cellular organisms → Bacteria | 1807 | Open in IMG/M |
| 3300023261|Ga0247796_1092475 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 572 | Open in IMG/M |
| 3300025315|Ga0207697_10109344 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1183 | Open in IMG/M |
| 3300026023|Ga0207677_12143434 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 520 | Open in IMG/M |
| 3300026277|Ga0209350_1014227 | All Organisms → cellular organisms → Bacteria | 2514 | Open in IMG/M |
| 3300026314|Ga0209268_1002585 | All Organisms → cellular organisms → Bacteria | 8543 | Open in IMG/M |
| 3300026316|Ga0209155_1003288 | All Organisms → cellular organisms → Bacteria | 7323 | Open in IMG/M |
| 3300026317|Ga0209154_1081879 | All Organisms → cellular organisms → Bacteria | 1391 | Open in IMG/M |
| 3300026326|Ga0209801_1072375 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 1524 | Open in IMG/M |
| 3300026532|Ga0209160_1009124 | All Organisms → cellular organisms → Bacteria | 7410 | Open in IMG/M |
| 3300026547|Ga0209156_10277761 | Not Available | 764 | Open in IMG/M |
| 3300027018|Ga0208475_1013848 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 787 | Open in IMG/M |
| 3300027548|Ga0209523_1033279 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1037 | Open in IMG/M |
| 3300027552|Ga0209982_1041939 | Not Available | 731 | Open in IMG/M |
| 3300028380|Ga0268265_10564232 | Not Available | 1083 | Open in IMG/M |
| 3300028719|Ga0307301_10156604 | Not Available | 734 | Open in IMG/M |
| 3300028787|Ga0307323_10194080 | Not Available | 733 | Open in IMG/M |
| 3300030916|Ga0075386_12034054 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300031231|Ga0170824_113627836 | Not Available | 657 | Open in IMG/M |
| 3300031474|Ga0170818_107549508 | Not Available | 609 | Open in IMG/M |
| 3300031474|Ga0170818_107550030 | Not Available | 594 | Open in IMG/M |
| 3300031719|Ga0306917_11166210 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300031736|Ga0318501_10535642 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300031912|Ga0306921_11087420 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300031954|Ga0306926_11130584 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 924 | Open in IMG/M |
| 3300032001|Ga0306922_10588350 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1180 | Open in IMG/M |
| 3300032035|Ga0310911_10659911 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300032059|Ga0318533_11434941 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 504 | Open in IMG/M |
| 3300032180|Ga0307471_104234962 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300032205|Ga0307472_102487847 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.31% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.45% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.59% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.59% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.59% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.72% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.72% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.72% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.72% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.86% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.86% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.86% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.86% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.86% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.86% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.86% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.86% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.86% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2170459009 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
| 2170459014 | Litter degradation PV2 | Engineered | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300002899 | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) | Environmental | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012021 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1 | Environmental | Open in IMG/M |
| 3300012180 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG | Host-Associated | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300023261 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027018 | Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN575 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_02726150 | 2088090014 | Soil | MNPKRIGFLGFEGVAASELVRAADVLAAATLDGGYGSWISCYHVCTIGFTS |
| F47_02690040 | 2170459009 | Grass Soil | MNPKRIGFLGFEGVAASELTRAADVFAAATLDGGYGNRISCY |
| 2PV_02652440 | 2170459014 | Switchgrass, Maize And Mischanthus Litter | MNPKRIGFLGFDGVAASDLTRAADVFAAATLDGGYGNRISC |
| INPhiseqgaiiFebDRAFT_1012888661 | 3300000364 | Soil | MLAKRIGFLGFDGVTASHLVTPADTFAIATLDSGYGNRIRCYQTYTIGLNSEPFRA |
| INPhiseqgaiiFebDRAFT_1012892011 | 3300000364 | Soil | MLAKRIGFLGFEGVTASDLVAPADTFAIATLDSGYGNRIPCYQTYTIGLTSEPF |
| F14TC_1007264771 | 3300000559 | Soil | MNPXXIGFLGFEGVAASELTRAADALAAAILDGGYGNRISCY |
| JGIcombinedJ43975_100117844 | 3300002899 | Soil | MNPKRIGFLGFEGVAASELTRAADALAAAILDGGYGNRISCYHVCTIGLASEC |
| JGI25405J52794_101143732 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MNPKRVGFLGFDGVAASELTRAADVIAAASLDGGYGNRIACYQINMI |
| Ga0062593_1022941072 | 3300004114 | Soil | MNPKRIGFLGFEGVAASELTRAADVFAAATLDGGYGNRISCYHVCTI |
| Ga0063356_1024367811 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MNPKRIGFLGFDGVHASDLTRAADVFAAATLDGGYGNRISCYHVCTIGFAFECFRSES |
| Ga0062595_1010918461 | 3300004479 | Soil | MQPKRIGLVGFDGVAASDLMLAADVFAGATLDGGYGNRLSCYHISMIGFSFEI |
| Ga0068868_1015407531 | 3300005338 | Miscanthus Rhizosphere | MSYQVLRTMRYHGPGRAMNPKRIGFLGFEGVAASELTRAADVLAAATLDGGY |
| Ga0070688_1003568323 | 3300005365 | Switchgrass Rhizosphere | MLAKRIGFLGFENVTASDLVTPADIFAIAKLDSGYGNPIQCYQTYFIGLTSE |
| Ga0070709_104087303 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MNPKRIGFLGFEDVAASELTRAADVLAAATLDGGYGNRISCYQVSTIGFTSECFR |
| Ga0070710_105869722 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MNPKQIGFLGFEGVAASELTRAADVLAAATLDGGYGNRISCYQINTIGFTSECFR |
| Ga0070705_1008616461 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPKRIGFLGFDGVTACHLVGPADTFASAALDDGYGNRISCYQICTIGL |
| Ga0070706_1021189822 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAKRIGFLGFEGVTASDLVVPADTFAIATLDSGYGNRIPC |
| Ga0070699_1021996211 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MNPKRIGFLGFESVAASDLAEAADVFAAAVLDAGYGNRLSC |
| Ga0070741_111162651 | 3300005529 | Surface Soil | MNPKLIGFLGFEGVAASELTLAADVLAAATLDGGYGNRISCY* |
| Ga0070696_1004293881 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MNPKRIGFLGFEGVAASNLTDAADVFAAAVLDGGYGSRIS |
| Ga0066701_104019211 | 3300005552 | Soil | MLPKRIGFLGFESVTASHFVIPADTFAAATLDTGYGRCIPCYQTYTIGVTP |
| Ga0066661_105034231 | 3300005554 | Soil | MLPKRIGFLGFESVTASHFVIPADTFAAATLDTGYGRCIPCY |
| Ga0066698_104121352 | 3300005558 | Soil | MVAKRIGFLGFEGVAASNLAGAADVFAAAVLDGGYGNR |
| Ga0070664_1021822292 | 3300005564 | Corn Rhizosphere | MNTKRIGFLGFEDISASDLTGAADVFAAATLDGGYGTRISCYQVCTIGFSSE |
| Ga0070715_100056051 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAKRIGFLGFESVTASHLVTPVDTFALAALDSGYGDRIPCYKTCTIGLNSEPFRAE |
| Ga0070712_1016920352 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MNPKRIGFLGFTGVAASELTSAVDVFAAATLDGGYGNR |
| Ga0066653_102099163 | 3300006791 | Soil | MVPKRIGFLGFEGVAASNLAGSADVFATGVLDGGYG |
| Ga0066653_104746073 | 3300006791 | Soil | MNPKRIGFLGFEGVAASELTRAADVLAAATLDGGYGNRI |
| Ga0066665_105182331 | 3300006796 | Soil | MVPKRIGFLGFEGVAASNLAGSADVFAAAVLDGGY |
| Ga0066665_115443611 | 3300006796 | Soil | MNPKRIGFVGFEGVAASELARAADVLAAATLDGGYGNRISCYQISTIGFT |
| Ga0075428_1011597411 | 3300006844 | Populus Rhizosphere | MNPKRIGFLGFDGVAASELTRAADVIAAASLDGGYGNRIACYQINMIGFTSECF |
| Ga0075434_1003889253 | 3300006871 | Populus Rhizosphere | MNPKRIGFLGFDGAAASDLTRAADVFATATLDGGYGNRISCYHVCTIG |
| Ga0066710_1010531864 | 3300009012 | Grasslands Soil | MNPKRIGFLGFEGVAASELTRAADVLAAATLDGGYGNRISCY |
| Ga0066710_1032649872 | 3300009012 | Grasslands Soil | MVPKRIGFLAFEDVAASNLTGAADVFAAAVLDGGYGNRISCYQIC |
| Ga0099829_106194522 | 3300009038 | Vadose Zone Soil | MLAKRIGFLGFEGVTASHLVAPADAFAVATLDSGYGDPIPCYQ |
| Ga0126315_107673732 | 3300010038 | Serpentine Soil | MKPKRIGFLGFERVAASDLTRAADVFAAATLDGGYGNRISCY |
| Ga0126380_107453831 | 3300010043 | Tropical Forest Soil | MNPKRLGFLGFEGVSTSDLTLAADVFAAATLDGGY |
| Ga0126384_109952062 | 3300010046 | Tropical Forest Soil | MNPKRIGFLGFEGASASDLTSAVDVFAAATLDGGYGNRISCYQVCTIGLSSDYFRSDSG |
| Ga0134067_104261591 | 3300010321 | Grasslands Soil | MNPKQIGFLGFEGVAASELTRAADVLAAATLDGGYGNRISC |
| Ga0134065_102957111 | 3300010326 | Grasslands Soil | MVPKRIGFLGFEGVTASHLAGPADTFAAAALEDGYGNSISCYQICTLG |
| Ga0126370_116881652 | 3300010358 | Tropical Forest Soil | MNPKRIGILGFDGVAASDLVRAADVFTAATLDGGYGNR |
| Ga0126376_124703081 | 3300010359 | Tropical Forest Soil | MSPKLVGFLGFDGVAASELTRAADVFAAATLHGGYGN |
| Ga0126378_111548642 | 3300010361 | Tropical Forest Soil | MSPKLVGFLGFDGVAASELTRAADVFAAATLHGGYGNRISCYQIT |
| Ga0126378_119399803 | 3300010361 | Tropical Forest Soil | MNPKRIGFLGFEGVAASDLSRAADVFAAATLDGGYGDRMSCYHVC |
| Ga0126379_136183482 | 3300010366 | Tropical Forest Soil | MNPKRIGFLGFEGVAASDLTRAADVFAAATLDGGYGNRILCYHVCTIGFAFECFRS |
| Ga0134128_104877853 | 3300010373 | Terrestrial Soil | MNPKRIGFLGFTGVAASELTSAVDVFAAATLDGGYGNRMSCYHVCTIGFTSECFRSES |
| Ga0137463_13490812 | 3300011444 | Soil | MVPKRIGFLGFEGVTASHLAGPADTFAAAALEDGYGNTISCYQICTL |
| Ga0120192_101493271 | 3300012021 | Terrestrial | MNPKRIGFLGFEGVAASELTRAVDVFAAATLDGGYGNRISCYQICTIGFDSEYFRAES |
| Ga0153974_11180032 | 3300012180 | Attine Ant Fungus Gardens | MSPKRIGFLSFEGVAASELTRAADVFAAASLDGGYGNRISCYHVCTIGFAFECFRSESGI |
| Ga0137364_100740131 | 3300012198 | Vadose Zone Soil | MNPKQIGFLGFEGVAASELTRAADVLAAATLDGGYGNRI |
| Ga0137364_112952182 | 3300012198 | Vadose Zone Soil | MNPKQIGFLGFEGVAASELTRAADVLAAATLDGGY |
| Ga0137363_116381891 | 3300012202 | Vadose Zone Soil | MNPKRIGFLGFEGVAASDLTRAADAFTGVTLDGGYG |
| Ga0137362_111421581 | 3300012205 | Vadose Zone Soil | MNPKRIGFLGFDGVAASDLTRAADVFGAATLDGGYGNRISCYHVC |
| Ga0137380_100284721 | 3300012206 | Vadose Zone Soil | MVPKRIGFVGFEGVAASNLAGSADVFSAAVLDGGYGNRISCYQICTIG |
| Ga0137381_100276541 | 3300012207 | Vadose Zone Soil | MVPKRIGFLGFEGVAASNLAGSADVFAAAVLDGGYGTRISCYQICTIGFSS |
| Ga0137381_113980721 | 3300012207 | Vadose Zone Soil | MNPKRIGFLGFEGVVASDLMLAADVFAAAMLDGGY |
| Ga0137376_103408791 | 3300012208 | Vadose Zone Soil | MNPKQIGFLGFEGVAASELTRAADVLAAATLDGGYGNRISCYHVC |
| Ga0137379_112614662 | 3300012209 | Vadose Zone Soil | MVPKRIGFVGFEGVAASNLAGSADVFSAAVLDGGYG |
| Ga0137378_109911752 | 3300012210 | Vadose Zone Soil | MNPKQIGFLGFEGVAASELTRAADVLAAATLDGGYGNRISCYHVCTIGFTSERFRSESG |
| Ga0137369_103124031 | 3300012355 | Vadose Zone Soil | MNPKLIGFLGFEGVAASELTRAADVLAAATLDGGYGSRISCYHVCTIGLTSE |
| Ga0137371_112467131 | 3300012356 | Vadose Zone Soil | MVAKRIGFLGFEGVAASNLVGAADVFATGVLDGGYGTRISCYQICTIGVSSEWLRAES |
| Ga0137375_104243342 | 3300012360 | Vadose Zone Soil | MNPKLIGFLGFEGVAASELTRAADVLAAATLDGGYGSRISCYHVCTIGL |
| Ga0137361_113341171 | 3300012362 | Vadose Zone Soil | MLAKRIGFLGFESVTASHLVTPVDTFALAALDSGYGDRIPCYKTCTIGLNS |
| Ga0137361_113791731 | 3300012362 | Vadose Zone Soil | MLAKRIGFLGFEGVTASDLVAPADTFAIATLDSGYGNRIPCYQTYTIG |
| Ga0137373_101546701 | 3300012532 | Vadose Zone Soil | MNPKLIGFLGFEGVAASELTRAADVLAAAALDGGYGNRISCYQISVIGFTSECFRAE |
| Ga0137373_107375971 | 3300012532 | Vadose Zone Soil | MNPKRVGFLGFEGVAASELTRAADVLAAATLDGGYGNRFSCYHVCTIGFT |
| Ga0137398_100052168 | 3300012683 | Vadose Zone Soil | MNPKRIGFLGFEGVAASDLTRAADAFTGVTLDGGY |
| Ga0137394_102448484 | 3300012922 | Vadose Zone Soil | MNPKRIGFLGFEGVAASELVRAADVLAAATLDGGYGSRI |
| Ga0137359_110570703 | 3300012923 | Vadose Zone Soil | MNPKRIGFLGFEGVAASELTRAADVLAAATLDGGYGNRISCYQISTIGFTSECFRA |
| Ga0137419_105133413 | 3300012925 | Vadose Zone Soil | MKPKRIGFLGFEGVAASNLTDAADVFAAATLDGGYGSR |
| Ga0164301_110597452 | 3300012960 | Soil | MSLKLVGFLGFDGVAESELTRAADVFAAATLHGGYG |
| Ga0164306_118014401 | 3300012988 | Soil | MSPKLVGFLGFDGVAASELTLAADVFAAATLHGGYGNRIS |
| Ga0157378_114263281 | 3300013297 | Miscanthus Rhizosphere | MNPKRIGFLGFEGVAASELTRAADVLAAATLDGGYGNRISCYQVCTIGFT |
| Ga0132258_123305431 | 3300015371 | Arabidopsis Rhizosphere | MNPKLIGFLGFEGVAASELTRAADVLAAATLDGGYGNRISCYQVCIIGFTSESFHAESGI |
| Ga0132255_1001973046 | 3300015374 | Arabidopsis Rhizosphere | MNPKRIGFLGFEGVAASELTRAADVLAAAPLDGGYGNRISCYQVCTIGFTSECF |
| Ga0132255_1010285171 | 3300015374 | Arabidopsis Rhizosphere | MNTKRIGFLGFEDISASDLTGAADVFAAATLDGGYGTRISCYQVCTIGFSSERLRSESG |
| Ga0182040_116978252 | 3300016387 | Soil | MLPKRIGFLGFDGVAASNLVDALDVFATAVLDGGYGNRISCYRI |
| Ga0184608_100127515 | 3300018028 | Groundwater Sediment | MNPKRIGFLGFEGVTSSHLVGPADTFAAAALDGGYGNPIPCYQICTIGLTP |
| Ga0184623_103169551 | 3300018056 | Groundwater Sediment | MRYLGSRRAMNPKRIGFLGFEGVAASELTRAADVLAVATLDGGYGNRISC |
| Ga0184635_103804961 | 3300018072 | Groundwater Sediment | VIEQMVPKRIGFLGFEGVTASHLAGPADTFAAAALEDGYGNTISCYQ |
| Ga0066655_108082381 | 3300018431 | Grasslands Soil | MNPKRIGFLGFEGVAASELTRAADVLAAATLDGRYGNRDFVLPDQHDRLYFR |
| Ga0193722_10225411 | 3300019877 | Soil | MNPKRIGFLGFEGVAASELTRAADVLAAATLDGGYGNRISCYQISTIGFTSECFR |
| Ga0193751_11248721 | 3300019888 | Soil | MNPKRIGFLGFEGVAASELTRAADVLAAATLDGGYGNRISCYEISTIGFTSECFR |
| Ga0193735_10596583 | 3300020006 | Soil | MNPKRIGFLGFEGVAASELTRAADVLAAATLDGGYGNRISCYHVCTIGFTSECFHAESGIGF |
| Ga0126371_103778221 | 3300021560 | Tropical Forest Soil | MNPKRIGFLGFEGVAASDLSRAGDVFAAASLDTGYGNP |
| Ga0222623_103051532 | 3300022694 | Groundwater Sediment | MVSLTMNPKRIGFLGFEGVTSSHLVGPADTFAAAALDGGYGNRISC |
| Ga0222622_100964681 | 3300022756 | Groundwater Sediment | MNPKRIGFLGFEGVAASELTRAADVFAAATLDGGYGNRISCYHVCTIGFTSECFHAESGIGF |
| Ga0247796_10924751 | 3300023261 | Soil | MNPKRIGFLGFEGVAASELTRAADVLAAATLDGGYGNRISCYHVCTIG |
| Ga0207697_101093442 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MNPKRIGFLGFEGVAASELARAADVLAAATLDGGYGSRISCYHV |
| Ga0207677_121434341 | 3300026023 | Miscanthus Rhizosphere | MNPKRIGFLGFEGVAASELTRAADVFAAATLDGGYGNRISC |
| Ga0209350_10142275 | 3300026277 | Grasslands Soil | MAARRSMNPKRIGFLGFEGVAASELTRAADVLAAATLDGGYGNR |
| Ga0209268_100258512 | 3300026314 | Soil | MNPKRIGFLGFEGVAASELTRAADVLAAATLDGRYGNRDFVLPDQH |
| Ga0209155_10032881 | 3300026316 | Soil | MNPKRIGFLGFEGVAASELTRAADVLAAATLDGRYGNRDFVL |
| Ga0209154_10818791 | 3300026317 | Soil | MNPKRIGFLGFDGVAASDLTRAADVFGAATLDGGYGNRI |
| Ga0209801_10723753 | 3300026326 | Soil | MIAKRIGFLGFEGVAASNLAGAADVFAAAVLDGGYGNR |
| Ga0209160_10091241 | 3300026532 | Soil | MAARRSMNPKRIGFLGFEGVAASELTRAADVLAAATL |
| Ga0209156_102777612 | 3300026547 | Soil | MNPKRIGFLGFEGVAASELTRAADVLAAATLDGGYG |
| Ga0208475_10138482 | 3300027018 | Soil | MLPKRIGFLGFESVAASNLADAADIFAAAALDGGYGNRISCYEICTIGFS |
| Ga0209523_10332791 | 3300027548 | Forest Soil | MNPKRIGFLGFEGVAASNLTDAADVFAAAVLDGGYGSRISCYQVCTIGFSYECF |
| Ga0209982_10419391 | 3300027552 | Arabidopsis Thaliana Rhizosphere | MNPKRIGFLGFDGVAASDLTRAADIFAAATLDGGYGN |
| Ga0268265_105642323 | 3300028380 | Switchgrass Rhizosphere | MNPKRIGFLGFDGVTSLHFVGPADTFASVALDGGYGSRIPCYQICTIGLTPEPFRAE |
| Ga0307301_101566041 | 3300028719 | Soil | MLPKRIGFLGFESVAASNLADAADIFAAAALDGGYGNRISCYEICTIGFSSECF |
| Ga0307323_101940801 | 3300028787 | Soil | MNPKRIGFLGFEGVAASELTRAADVFAAATLDGGYGN |
| Ga0075386_120340541 | 3300030916 | Soil | MSPKLVGFLGFDGVAASELTRAADVFAAATLHGGYGNRISCYQIS |
| Ga0170824_1136278362 | 3300031231 | Forest Soil | MNPKRIGFLGFDGVAASELTRAADVLTAAALDGGYGNRISCYQISTIGFASECFRGESG |
| Ga0170818_1075495081 | 3300031474 | Forest Soil | MNPKRIGFLGFDGVAAAELTRAADVLAAAALDGGYGNRI |
| Ga0170818_1075500301 | 3300031474 | Forest Soil | MNPKRTGFLGFKGVAASELTRAADVLAAAALDGGYG |
| Ga0306917_111662101 | 3300031719 | Soil | MSPKLVGFLGFDGVAASELTRAADVFAAATLHGGYGNRISCYQITMI |
| Ga0318501_105356421 | 3300031736 | Soil | MLPKRIGFLGFDGVAASDLVESLDVFATAVLDGGYGNRISCYRICIIGLT |
| Ga0306921_110874201 | 3300031912 | Soil | MNPKRIGILGFESVIASHITGPADAFTATTLDNGY |
| Ga0306926_111305842 | 3300031954 | Soil | MLPKRIGFLGFDGVAASNLVEALDVFATAVLDGGYGNRISCYRICIIGLTSECFRAES |
| Ga0306922_105883501 | 3300032001 | Soil | MLPKRIGFLGFDGVAASDLVESLDVFATAVLDGGYGNRIS |
| Ga0310911_106599112 | 3300032035 | Soil | MLPKRIGFLGFDGVAASNLVEALDVFATAVLDGGYGNRISCYQICII |
| Ga0318533_114349411 | 3300032059 | Soil | MSPKLVGFLGFDGVAASELTRAADVFAAATLHGGYG |
| Ga0307471_1042349621 | 3300032180 | Hardwood Forest Soil | MLAKRIGFLGFESVTASHLVTPVDTFALAALDSGYGDRIPCYKTCTIGLNAEP |
| Ga0307472_1024878471 | 3300032205 | Hardwood Forest Soil | MSPKLVGLLGFDGVAASELTPAADVFAAATLHGGYGNRISCY |
| ⦗Top⦘ |