


| Basic Information | |
|---|---|
| Family ID | F078997 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MSTVLAQQDDEAEKRKRGVRRTAIVFGLIALFFYVGFIVLTVVRASK |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 31.90 % |
| % of genes near scaffold ends (potentially truncated) | 15.52 % |
| % of genes from short scaffolds (< 2000 bps) | 82.76 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.897 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.241 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.621 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.552 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 60.00% β-sheet: 0.00% Coil/Unstructured: 40.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF00115 | COX1 | 38.79 |
| PF04442 | CtaG_Cox11 | 35.34 |
| PF00510 | COX3 | 6.03 |
| PF02104 | SURF1 | 2.59 |
| PF11137 | DUF2909 | 1.72 |
| PF13672 | PP2C_2 | 0.86 |
| PF02790 | COX2_TM | 0.86 |
| PF14849 | YidC_periplas | 0.86 |
| PF03006 | HlyIII | 0.86 |
| PF02628 | COX15-CtaA | 0.86 |
| PF00034 | Cytochrom_C | 0.86 |
| PF10003 | DUF2244 | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG3175 | Cytochrome c oxidase assembly protein Cox11 | Posttranslational modification, protein turnover, chaperones [O] | 35.34 |
| COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 6.03 |
| COG3346 | Cytochrome oxidase assembly protein ShyY1 | Posttranslational modification, protein turnover, chaperones [O] | 2.59 |
| COG1272 | Predicted membrane channel-forming protein YqfA, hemolysin III family | Intracellular trafficking, secretion, and vesicular transport [U] | 0.86 |
| COG1612 | Heme A synthase | Coenzyme transport and metabolism [H] | 0.86 |
| COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.62 % |
| Unclassified | root | N/A | 16.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_101333163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 609 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10195932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 820 | Open in IMG/M |
| 3300004092|Ga0062389_103201203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 613 | Open in IMG/M |
| 3300004635|Ga0062388_101406251 | Not Available | 701 | Open in IMG/M |
| 3300004799|Ga0058863_11333021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 574 | Open in IMG/M |
| 3300005260|Ga0074072_1000131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 46690 | Open in IMG/M |
| 3300005260|Ga0074072_1088554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 827 | Open in IMG/M |
| 3300005329|Ga0070683_101080976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 770 | Open in IMG/M |
| 3300005367|Ga0070667_100449157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1178 | Open in IMG/M |
| 3300005436|Ga0070713_100814054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 896 | Open in IMG/M |
| 3300005437|Ga0070710_10595393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 769 | Open in IMG/M |
| 3300005437|Ga0070710_11486053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 509 | Open in IMG/M |
| 3300005458|Ga0070681_10210885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1858 | Open in IMG/M |
| 3300005458|Ga0070681_10542201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1077 | Open in IMG/M |
| 3300005529|Ga0070741_10034256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 6878 | Open in IMG/M |
| 3300005529|Ga0070741_10123327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2670 | Open in IMG/M |
| 3300005538|Ga0070731_10627622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 715 | Open in IMG/M |
| 3300005548|Ga0070665_100006983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 11477 | Open in IMG/M |
| 3300005563|Ga0068855_102549001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 508 | Open in IMG/M |
| 3300005614|Ga0068856_101384721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 718 | Open in IMG/M |
| 3300005614|Ga0068856_102721922 | Not Available | 500 | Open in IMG/M |
| 3300006028|Ga0070717_11380849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300006175|Ga0070712_101803332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 536 | Open in IMG/M |
| 3300006237|Ga0097621_100225967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1633 | Open in IMG/M |
| 3300006806|Ga0079220_10753589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 727 | Open in IMG/M |
| 3300006954|Ga0079219_11771228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 576 | Open in IMG/M |
| 3300009093|Ga0105240_10018998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 9202 | Open in IMG/M |
| 3300009093|Ga0105240_10103894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3451 | Open in IMG/M |
| 3300009093|Ga0105240_10107005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3391 | Open in IMG/M |
| 3300009093|Ga0105240_10120541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3159 | Open in IMG/M |
| 3300009093|Ga0105240_10718825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1089 | Open in IMG/M |
| 3300009545|Ga0105237_10388099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1401 | Open in IMG/M |
| 3300009551|Ga0105238_10359307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1446 | Open in IMG/M |
| 3300009551|Ga0105238_11201980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 783 | Open in IMG/M |
| 3300010361|Ga0126378_11937573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 671 | Open in IMG/M |
| 3300010371|Ga0134125_10266295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1904 | Open in IMG/M |
| 3300010373|Ga0134128_11915303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 652 | Open in IMG/M |
| 3300010379|Ga0136449_100078700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 6975 | Open in IMG/M |
| 3300010396|Ga0134126_10000595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 45981 | Open in IMG/M |
| 3300011120|Ga0150983_10236938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 815 | Open in IMG/M |
| 3300011120|Ga0150983_10258740 | Not Available | 545 | Open in IMG/M |
| 3300012210|Ga0137378_11136953 | Not Available | 696 | Open in IMG/M |
| 3300012924|Ga0137413_10213096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1306 | Open in IMG/M |
| 3300012924|Ga0137413_10311521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1103 | Open in IMG/M |
| 3300012927|Ga0137416_10176516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1696 | Open in IMG/M |
| 3300012982|Ga0168317_1005402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4843 | Open in IMG/M |
| 3300013105|Ga0157369_10594509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1142 | Open in IMG/M |
| 3300013296|Ga0157374_11096333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 816 | Open in IMG/M |
| 3300013296|Ga0157374_12867103 | Not Available | 509 | Open in IMG/M |
| 3300014201|Ga0181537_10665783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 708 | Open in IMG/M |
| 3300014325|Ga0163163_10235867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1879 | Open in IMG/M |
| 3300014325|Ga0163163_10418085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1399 | Open in IMG/M |
| 3300014968|Ga0157379_10416232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1237 | Open in IMG/M |
| 3300018088|Ga0187771_10136868 | Not Available | 2004 | Open in IMG/M |
| 3300018468|Ga0066662_11134067 | Not Available | 785 | Open in IMG/M |
| 3300019242|Ga0181502_1090430 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 984 | Open in IMG/M |
| 3300019889|Ga0193743_1248906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300020579|Ga0210407_10760900 | Not Available | 749 | Open in IMG/M |
| 3300020580|Ga0210403_10301104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1314 | Open in IMG/M |
| 3300020582|Ga0210395_11210613 | Not Available | 555 | Open in IMG/M |
| 3300021086|Ga0179596_10190312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 995 | Open in IMG/M |
| 3300021170|Ga0210400_10087039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 2461 | Open in IMG/M |
| 3300021170|Ga0210400_10629849 | Not Available | 884 | Open in IMG/M |
| 3300021170|Ga0210400_10690542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 840 | Open in IMG/M |
| 3300021170|Ga0210400_11388800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300021180|Ga0210396_10902961 | Not Available | 753 | Open in IMG/M |
| 3300021181|Ga0210388_10035878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 4096 | Open in IMG/M |
| 3300021402|Ga0210385_11183000 | Not Available | 587 | Open in IMG/M |
| 3300021406|Ga0210386_11526874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300021432|Ga0210384_10362349 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 1306 | Open in IMG/M |
| 3300021475|Ga0210392_10429685 | All Organisms → cellular organisms → Eukaryota | 966 | Open in IMG/M |
| 3300021475|Ga0210392_10446615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 948 | Open in IMG/M |
| 3300022527|Ga0242664_1076717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 654 | Open in IMG/M |
| 3300022530|Ga0242658_1202650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300022726|Ga0242654_10090444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 945 | Open in IMG/M |
| 3300025901|Ga0207688_10159593 | Not Available | 1336 | Open in IMG/M |
| 3300025912|Ga0207707_10336000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1303 | Open in IMG/M |
| 3300025912|Ga0207707_11606889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300025913|Ga0207695_10039415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 5078 | Open in IMG/M |
| 3300025913|Ga0207695_10046498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 4601 | Open in IMG/M |
| 3300025913|Ga0207695_10055046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 4149 | Open in IMG/M |
| 3300025913|Ga0207695_10074961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 3444 | Open in IMG/M |
| 3300025913|Ga0207695_10199457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1916 | Open in IMG/M |
| 3300025916|Ga0207663_11142957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 626 | Open in IMG/M |
| 3300025917|Ga0207660_10036631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 3411 | Open in IMG/M |
| 3300025921|Ga0207652_10189733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1849 | Open in IMG/M |
| 3300025921|Ga0207652_11598618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300025924|Ga0207694_10834395 | Not Available | 779 | Open in IMG/M |
| 3300025928|Ga0207700_11498862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300025944|Ga0207661_10928049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 802 | Open in IMG/M |
| 3300025945|Ga0207679_11521159 | Not Available | 614 | Open in IMG/M |
| 3300026142|Ga0207698_10688596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1016 | Open in IMG/M |
| 3300028536|Ga0137415_10193907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1853 | Open in IMG/M |
| 3300028573|Ga0265334_10009688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4073 | Open in IMG/M |
| 3300028800|Ga0265338_10790028 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 651 | Open in IMG/M |
| 3300029943|Ga0311340_11291756 | Not Available | 582 | Open in IMG/M |
| 3300030617|Ga0311356_10941620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 811 | Open in IMG/M |
| 3300030937|Ga0138302_1510215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 646 | Open in IMG/M |
| 3300031047|Ga0073995_12238674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 818 | Open in IMG/M |
| 3300031057|Ga0170834_111655055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300031057|Ga0170834_113578723 | Not Available | 506 | Open in IMG/M |
| 3300031090|Ga0265760_10157243 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 748 | Open in IMG/M |
| 3300031616|Ga0307508_10559672 | Not Available | 742 | Open in IMG/M |
| 3300031708|Ga0310686_112866201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 770 | Open in IMG/M |
| 3300031708|Ga0310686_112908604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1743 | Open in IMG/M |
| 3300031715|Ga0307476_10615713 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 805 | Open in IMG/M |
| 3300031715|Ga0307476_11021218 | Not Available | 609 | Open in IMG/M |
| 3300031718|Ga0307474_10776324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 758 | Open in IMG/M |
| 3300031754|Ga0307475_10270084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1364 | Open in IMG/M |
| 3300031962|Ga0307479_10794013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 922 | Open in IMG/M |
| 3300031962|Ga0307479_11403533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 657 | Open in IMG/M |
| 3300032160|Ga0311301_11228716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 957 | Open in IMG/M |
| 3300032180|Ga0307471_102286164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 682 | Open in IMG/M |
| 3300033475|Ga0310811_10331931 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1722 | Open in IMG/M |
| 3300033513|Ga0316628_102500204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 682 | Open in IMG/M |
| 3300034268|Ga0372943_0116131 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1593 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.24% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 12.07% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 7.76% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.03% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.03% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.31% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.45% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.59% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.59% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.72% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.72% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.72% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.72% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.86% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.86% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.86% |
| Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.86% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.86% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005260 | Microbial communities on the surface of kaolinite enhanced biochar from soil with fertiliser in Sydney, Australia | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012982 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfield | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019242 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Host-Associated | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030937 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031047 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1013331632 | 3300002245 | Forest Soil | MSTALAQDYDTEKRKRGVRRTAIVFGLIALFFYVGFMVLIVVKGSK* |
| JGIcombinedJ51221_101959322 | 3300003505 | Forest Soil | MSMTLTQDDEAQKRKRGVRRTAIVFGLIALFFYVGFMVLIVVKGSK* |
| Ga0062389_1032012031 | 3300004092 | Bog Forest Soil | MSTVLAELDDAEKRKRGVRRTAIVFGLIALFFYVGFMVLIVVKGSK* |
| Ga0062388_1014062511 | 3300004635 | Bog Forest Soil | MSMTLTQDDEAEKRKRGVRRTAIVFGLIALFFYVGFMVLIVVKGSK* |
| Ga0058863_113330213 | 3300004799 | Host-Associated | MSIVLAQQDDIEKRKRGVRRTAILFGVIALFFYVGFIVLTIVRGSK* |
| Ga0074072_100013138 | 3300005260 | Soil | MSTVLAQQGSEIEKRKRGVRRTAIVVGLIALFFYVGFIVLTLVRASK* |
| Ga0074072_10885542 | 3300005260 | Soil | MSGKSPAAGIALIERGDETEKRKRGVRRTAIVVGLIALFFYVGFIVLTIVRGSK* |
| Ga0070683_1010809762 | 3300005329 | Corn Rhizosphere | MGTVLAQQDEEIEKRKRGVRRTAIVFSLIALFFYFGFIVLTIVRGSK* |
| Ga0070667_1004491572 | 3300005367 | Switchgrass Rhizosphere | LSSALAEDQEADKRRRGIRRTTLVVGLIALLFYVGFIVLTLVRGSK* |
| Ga0070713_1008140542 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTVLAQQDDEIGKRKRGVRRTAIVFGLIALFFYVGFMVLTIIRGSK* |
| Ga0070710_105953931 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VSTVLSQRDDETEKRKRGVRRTAIIVGLIAAFFYFGFIVLTLVRG |
| Ga0070710_114860532 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MESALAPDDQAEKRRRGVRRTAIIAGLVALFFYIGFIVLTVVRGSR* |
| Ga0070681_102108851 | 3300005458 | Corn Rhizosphere | MSTVLAQQDDEIEKRKRGVRRTAILFGVIALFFYVGFIVLTIVRGSK* |
| Ga0070681_105422012 | 3300005458 | Corn Rhizosphere | VAPSIDREMGSALDRDDEDQKRRRGIRRTTLIVGLIALLFYLGFIVLTVYRGSK* |
| Ga0070741_100342562 | 3300005529 | Surface Soil | MDNALARDDEADRRRRGVRRTALVFGLIALLFYVGFIVLTLVRGSK* |
| Ga0070741_101233272 | 3300005529 | Surface Soil | MSTVLAEQDDLAAKRKRGVRLTAIVCGLVAAFFYFGFIVMTLIKGWK* |
| Ga0070731_106276222 | 3300005538 | Surface Soil | MSSVLAQQDDEIEKRKRGVRRTAIIFGLIALFFYFGFIVLTLVRGSK* |
| Ga0070665_1000069838 | 3300005548 | Switchgrass Rhizosphere | LAEDQEADKRRRGIRRTTLVVGLIALLFYVGFIVLTLVRGSK* |
| Ga0068855_1025490011 | 3300005563 | Corn Rhizosphere | MSTTLAQQDDEAEKRKRGVRRTAIVFGLIALFFYVGFIVLTVVRASK* |
| Ga0068856_1013847212 | 3300005614 | Corn Rhizosphere | MSTVLAQQDDEAEKRKRGVRRTAIVFGLIALFFYVGFIVLTVYRGSK* |
| Ga0068856_1027219222 | 3300005614 | Corn Rhizosphere | MSSVLAPQDDEIEKRKRGVRRTAIVFGLIALFFYVGFIVLTIVRGSK* |
| Ga0070717_113808491 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | SYLMSTALTQRDTEIEKRRRGVRRTAFLFGFIALLFYVGFIVLTLVRGSK* |
| Ga0070712_1018033322 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VARSIDPDMGSALAPEDEAEKRRRGVRRTALIAGLVALFFYIGFIVLTVIRGSR* |
| Ga0097621_1002259672 | 3300006237 | Miscanthus Rhizosphere | MDDEIEKRKRGVRRTAIVAGLIALFFYVGFIVLTIVRGSK* |
| Ga0079220_107535892 | 3300006806 | Agricultural Soil | MSTVLAQQDDEIEKRKRGVRRTAILVGLVALFFYVGFIVLTIVRGSK* |
| Ga0079219_117712281 | 3300006954 | Agricultural Soil | MSTVLVQQGDDEAEKRKRGVRRTAIVFGLIALFFYVGFIVLTVYRGSK* |
| Ga0105240_100189989 | 3300009093 | Corn Rhizosphere | MSTVLAEQDDLAEKRKRGVRLTAIVCGLVAAFFYFGFIAMTLIKGWK* |
| Ga0105240_101038942 | 3300009093 | Corn Rhizosphere | MSTTLVQDDEEKRKRGVRRTAIVFGLVALFFYVGFIVLTIVRASK* |
| Ga0105240_101070052 | 3300009093 | Corn Rhizosphere | MSTVLAQQDDETEKRKRGVRRTAIVFGLIALFFYFGFIVLTLYRGWK* |
| Ga0105240_101205412 | 3300009093 | Corn Rhizosphere | MSTVVVRQDDEAEKRKRGIRRTAIVFGLIALFFYVGFIVLTVVRASK* |
| Ga0105240_107188252 | 3300009093 | Corn Rhizosphere | MSTVLAQQDDEIEKRKRGVRRTAIIAGLVALFFYVGFIVLMVVRGSK* |
| Ga0105237_103880993 | 3300009545 | Corn Rhizosphere | MSTVLAQQDDEAEKRKRGVRRTAIVFGLIALFFYVGFIVLTVVRASK* |
| Ga0105238_103593073 | 3300009551 | Corn Rhizosphere | MSTALVQDDEAEKRKRGIRRTAILCGLVALAFYIGFIVLTVVRGSK* |
| Ga0105238_112019802 | 3300009551 | Corn Rhizosphere | MSTTLAQQDDEAEKRKRGVRRTAIVFGLIALFFYVGFIVLTIYRGSK* |
| Ga0126378_119375732 | 3300010361 | Tropical Forest Soil | MSTVLIQQDDETEKRKRGVRRTAIFFGLIALFFYVGFIVLTLVRASAAHK* |
| Ga0134125_102662953 | 3300010371 | Terrestrial Soil | MTTVLTHHDDETEKRKRGVRRTAIVFGLIALFFYVGFIVLTLVKGSK* |
| Ga0134128_119153031 | 3300010373 | Terrestrial Soil | MSTVLVESDELAQKRRRGVRITAIVCGLVAAFFYFGFIVLTLVRAHK |
| Ga0136449_1000787005 | 3300010379 | Peatlands Soil | MSTALAQDLDAEKRKRGVRRTAIVFGLIALFFYVGFMVLIVVKGSK* |
| Ga0134126_1000059528 | 3300010396 | Terrestrial Soil | LAQQDDELEKRKRGVRRTAIVVGLIALFFYFGFIVLTLVRASR* |
| Ga0150983_102369382 | 3300011120 | Forest Soil | MSTALAEDFDAEKRKRGVRRTAIVFGLIALFFYVGFMVLIVVKGSK* |
| Ga0150983_102587402 | 3300011120 | Forest Soil | MSTVLAEQDELAEKRRRGVRRTAIVCGLVAAFFYFGFIVMTLIKGSR* |
| Ga0137378_111369531 | 3300012210 | Vadose Zone Soil | MSTALAQDDEAEKRKRGVRRTAIVFGLIALFFYVGFMVLIVVKGSK* |
| Ga0137413_102130962 | 3300012924 | Vadose Zone Soil | LESAGLSQVEDTERRKRSIRRTAIVFGLIALFFYFGFIVLTLVRGSK* |
| Ga0137413_103115212 | 3300012924 | Vadose Zone Soil | MSTVLAQDDEAEKRKRGVRRTAIVFGLIALFFYVGFMVLIVVKGSK* |
| Ga0137416_101765162 | 3300012927 | Vadose Zone Soil | LETAGLSQVDDAEKRKRGIRRTAIVFGLIALFFYFGFIVLTLVRGSK* |
| Ga0168317_10054023 | 3300012982 | Weathered Mine Tailings | MGTALAQQDDEIEKRKRGVRRTAIVFGLIALFFYVGFIVLTIVRGSK* |
| Ga0157369_105945092 | 3300013105 | Corn Rhizosphere | MGSALDRDDEDQKRRRGIRRTTLIVGLIALLFYLGFIVLTVYRGSK* |
| Ga0157374_110963332 | 3300013296 | Miscanthus Rhizosphere | MSIVLAQQDDIEKRKRGVRRTAILFGVIALFFSVGFIVLTIVRGSK* |
| Ga0157374_128671032 | 3300013296 | Miscanthus Rhizosphere | LAEDQEADKRRRGIRRTTLVVGLIALLFYVGFIALTVVRASR* |
| Ga0181537_106657832 | 3300014201 | Bog | MPAKSGPVVVMMMSTTLTQDDDAEKRKRGVRRTAIVFGLIALFFYVGFMVLIVVKGSK* |
| Ga0163163_102358672 | 3300014325 | Switchgrass Rhizosphere | MGIALTQDDEAEKRKRGVRRTAIVFALIALFFYVGFIVLTVVRGSR* |
| Ga0163163_104180853 | 3300014325 | Switchgrass Rhizosphere | MGIALTQDDEAEKRKRGVRRTAIVFGLIALFFYVGFIVLTVIRGSK* |
| Ga0157379_104162323 | 3300014968 | Switchgrass Rhizosphere | TVLAQQDDEAEKRKRGVRRTAIVFGLIALFFYVGFIVLTVVRASK* |
| Ga0187771_101368683 | 3300018088 | Tropical Peatland | MSTVLAQQDDEIEKRKRGVRRTAIFFGLIALAFYVGFIVLTLVRASK |
| Ga0066662_111340671 | 3300018468 | Grasslands Soil | MSTALAQQDDETEKRKRGVRRTAIVFGLIALFFYVGFIILT |
| Ga0181502_10904301 | 3300019242 | Peatland | LSTVLAEQDELAEKRRRGVRRTAIVCGLVAAFFYFGFIVMTLIKGSK |
| Ga0193743_12489062 | 3300019889 | Soil | AQVDAAEKRKRGIRRTTMVFGLIALGFYFGFIVLTLIRGSK |
| Ga0210407_107609002 | 3300020579 | Soil | VLAQDDEAEKRKRGIRRTAIVFGLIALFFYVGFMVLIVVKGSK |
| Ga0210403_103011042 | 3300020580 | Soil | MNTALAQDDEAEKRKRGIRRTAIVFGLIALFFYVGFMILIVVKGSK |
| Ga0210395_112106131 | 3300020582 | Soil | MSMTLTQDDEAQKRKRGVRRTAIVFGLIALFFSVGF |
| Ga0179596_101903122 | 3300021086 | Vadose Zone Soil | MSTALAQDDEAEKRKRGIRRTAIVFGLIALFFYVGFMVLIVVKGSK |
| Ga0210400_100870393 | 3300021170 | Soil | MTNVAEDHETEKRKRGVRRTAIVFGLIALFFYVGFIVLTVIRGSR |
| Ga0210400_106298491 | 3300021170 | Soil | MNTALAQDDEAEKRKRGIRRTAIVFGLIALFFYVGFMILIVVRGLK |
| Ga0210400_106905422 | 3300021170 | Soil | LEIAGLSQVDDAEKRKRGVRRTAIVFGLIALFFYFGFIVLTLVRGSK |
| Ga0210400_113888002 | 3300021170 | Soil | RSTSRFVPMSTVLAEQDELAEKRRRGVRRTAIVCGLVAAFFYFGFIVMTLIKGSR |
| Ga0210396_109029612 | 3300021180 | Soil | MSMTLTQDDEAQKRKRGVRRTAIVFGLIALFFYVGFMVLIVVKGSK |
| Ga0210388_100358783 | 3300021181 | Soil | MSMTLTQDDEAEKRKRGVRRTAIVFGLIALFFYVGFMVLIVVKGSK |
| Ga0210385_111830002 | 3300021402 | Soil | MSMTLTQDDEAEKRKRGVRRTAIVFGLIALFFYVGFMILIVVKGSK |
| Ga0210386_115268742 | 3300021406 | Soil | LAQDDDAEKRKRGIRRTAIVFGLIALFFYVGFMVLIVVRGSK |
| Ga0210384_103623492 | 3300021432 | Soil | MNTALAQDDEAEKRKRGIRRTAIVFGLIALFFYVGFMILIVVK |
| Ga0210392_104296852 | 3300021475 | Soil | MSTVLAEQDELAEKRRRGVRRTAIVCGLVAAFFYFGFIVMTLIKGSR |
| Ga0210392_104466152 | 3300021475 | Soil | MSTALAQDDEAEKRKRGVRRTAIVFGLIALFFYVGFMVLIVVKGSK |
| Ga0242664_10767172 | 3300022527 | Soil | MNMALAQDDEAQRRKRGVRRTAIFFGLIALAFYVGFIVLTLVRAGAIK |
| Ga0242658_12026502 | 3300022530 | Soil | MSTALAQDLDDAEKRKRGVRRTAIVFGLIALFFYVGFMVLIVVKGSK |
| Ga0242654_100904442 | 3300022726 | Soil | MSTALAQNDEAEKRKRGIRRTAIVFGLIALFFYVGFIVLIVVKGSK |
| Ga0207688_101595931 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | VLTERDDEIEKRKRGVRRTAIVFGLIALFFYVGFIVLTIYRGSK |
| Ga0207707_103360001 | 3300025912 | Corn Rhizosphere | DIEKRKRGVRRTAILFGVIALFFYVGFIVLTIVRGSK |
| Ga0207707_116068891 | 3300025912 | Corn Rhizosphere | QKRRRGIRRTTLIVGLIALLFYLGFIVLTVYRGSK |
| Ga0207695_100394156 | 3300025913 | Corn Rhizosphere | MSTTLVQDDEEKRKRGVRRTAIVFGLVALFFYVGFIVLTIVRASK |
| Ga0207695_100464984 | 3300025913 | Corn Rhizosphere | MSTVLAEQDDLAEKRKRGVRLTAIVCGLVAAFFYFGFIAMTLIKGWK |
| Ga0207695_100550467 | 3300025913 | Corn Rhizosphere | MSTVLAQQDDETEKRKRGVRRTAIVFGLIALFFYFGFIVLTLYRGWK |
| Ga0207695_100749613 | 3300025913 | Corn Rhizosphere | MSTVVVRQDDEAEKRKRGIRRTAIVFGLIALFFYVGFIVLTVVRASK |
| Ga0207695_101994573 | 3300025913 | Corn Rhizosphere | LAEDQEADKRRRGIRRTTLVVGLIALLFYVGFIVLTLVRGSK |
| Ga0207663_111429571 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | TVLAQQDEMEKRKRGVRRTAIIVGLIAAFFYFGFIVLTLVRGSK |
| Ga0207660_100366312 | 3300025917 | Corn Rhizosphere | MSIVLAQQDDIEKRKRGVRRTAILFGVIALFFYVGFIVLTIVRGSK |
| Ga0207652_101897332 | 3300025921 | Corn Rhizosphere | MSIVLAQQDDIEKRKRGVRRTAILFGVIALFFYVGFIVLTIVRGAK |
| Ga0207652_115986181 | 3300025921 | Corn Rhizosphere | STVLAQQDDEIEKRKRGVRRTAIIAGLVALFFYVGFIVLMVVRGSK |
| Ga0207694_108343951 | 3300025924 | Corn Rhizosphere | MGIALTQDDEAEKRKRSVRRTAIVFGLIALFFYVGFIVLTLVRGSK |
| Ga0207700_114988621 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSVLAQQDDEIEKRKRGVRRTAIVFGLIALFFYVGFIVLTIVRGSK |
| Ga0207661_109280492 | 3300025944 | Corn Rhizosphere | MGTVLAQQDEEIEKRKRGVRRTAIVFSLIALFFYVGFIVLTIVRGSK |
| Ga0207679_115211592 | 3300025945 | Corn Rhizosphere | MSTVLAQQDDIEKRKRGVRRTAILFGVIALFFYVGFIVLTIVRGSK |
| Ga0207698_106885962 | 3300026142 | Corn Rhizosphere | MTTVLTHHDDETEKRKRGVRRTAIVFGLIALFFYVGFIVLTLVKGSK |
| Ga0137415_101939072 | 3300028536 | Vadose Zone Soil | LETAGLSQVDDAEKRKRGIRRTAIVFGLIALFFYFGFIVLTLVRGSK |
| Ga0265334_100096883 | 3300028573 | Rhizosphere | MSTVLAQQDDEIEKRKRGVRRTAIAFGLIALFFYVGFIVLTIVRGSK |
| Ga0265338_107900282 | 3300028800 | Rhizosphere | MSTALAQDDEAEKRKRGVRRTAIVFGLIALFFYVGFMVLIVVRGLK |
| Ga0311340_112917561 | 3300029943 | Palsa | MSTVLAQDYDAEKRKRGVRRTAIVFGLIALFFYVGFMVLIVV |
| Ga0311356_109416202 | 3300030617 | Palsa | VLAQDYDAEKRKRGVRRTAIVFGLIALFFYVGFMVLIVVKGSK |
| Ga0138302_15102152 | 3300030937 | Soil | MSITLAQDDDAEKRKRGVRRTAIVFGLIALFFYVGFMVLIVVKGSK |
| Ga0073995_122386742 | 3300031047 | Soil | MSTALAEDLHAEKRKRGVRRTAIVFGLIALFFYVGFMVLIVVKGSK |
| Ga0170834_1116550552 | 3300031057 | Forest Soil | MSTVLAERDELAQKRRRGVRITAIVCGLVAAFFYFGFIVLTLVRAHK |
| Ga0170834_1135787231 | 3300031057 | Forest Soil | MDMALAQDDEAQKRKRGVRRTAIFFGLIALFFYFGFIVLTLVRASHAHK |
| Ga0265760_101572432 | 3300031090 | Soil | MSMALTQDDEAEKRKRGVRRTAIVFGLIALFFYVGFMVLIVVKGSK |
| Ga0307508_105596722 | 3300031616 | Ectomycorrhiza | MSTALAQFDDAEKRKRGIRRTAIVFGLIALFFYVGFMVLIVVKGSK |
| Ga0310686_1128662012 | 3300031708 | Soil | MMMSTALTQDDEAQKRKRGVRRTAIVFGLIALFFYVGFMVLIVVKGSK |
| Ga0310686_1129086042 | 3300031708 | Soil | MSTALAQDLDAEKRKRGIRRTAIVFGLIALFFYVGFMVLIVVKGSK |
| Ga0307476_106157132 | 3300031715 | Hardwood Forest Soil | MSTVLAQQDDETEKRKRGVRRTAIFFGLIALFFYFGFIVLTLVRAGAIK |
| Ga0307476_110212182 | 3300031715 | Hardwood Forest Soil | MSTALAQDDDAEKRKRGIRRTAIVFGLIALFFYVGFMVLIVVKGSK |
| Ga0307474_107763241 | 3300031718 | Hardwood Forest Soil | TVLAQQDDEAQKRKRGVRRTAIFFGLIALAFYVGFIVLTLVRAGAIK |
| Ga0307475_102700843 | 3300031754 | Hardwood Forest Soil | MSTVLARQDDETEKRKRGVRRTAIFFGLIALFFYVGFIVLTVVRGMK |
| Ga0307479_107940132 | 3300031962 | Hardwood Forest Soil | MSTVLAQQDDETEKRKRGVRRTAIFFGLIALFFYFGFIVLTLVRAAGASK |
| Ga0307479_114035332 | 3300031962 | Hardwood Forest Soil | MSTVLTQHDDETEKRKRGVRRTAIFFGLIALAFYVGFIVLTLVRAGAIK |
| Ga0311301_112287162 | 3300032160 | Peatlands Soil | MSTALAQDLDAEKRKRGVRRTAIVFGLIALFFYVGFMVLIVVKGSK |
| Ga0307471_1022861642 | 3300032180 | Hardwood Forest Soil | MDMALAQDDEAQKRKRGIRRTAIFFGLIALFFYVGFIVLIVVRGSK |
| Ga0310811_103319312 | 3300033475 | Soil | MSTVLTERDDEIEKRKRGVRRTAIFFGLIALFFYVGFIVLTVVRGSK |
| Ga0316628_1025002042 | 3300033513 | Soil | MSTVVAQDDEAEKRKRGIRRTAIVAGLVALFFYIGFIVLTVVRGSK |
| Ga0372943_0116131_387_527 | 3300034268 | Soil | MSSALTQDDEADKRRRGIRRTTLIVGLIALLFYVGFIALTLLRASK |
| ⦗Top⦘ |