


| Basic Information | |
|---|---|
| Family ID | F078967 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 36 residues |
| Representative Sequence | FAWKEFAGAGSRAKIYLSLMFVFYALAILLVARANG |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 93.97 % |
| % of genes from short scaffolds (< 2000 bps) | 87.07 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.310 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.241 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.207 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.172 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.75% β-sheet: 0.00% Coil/Unstructured: 56.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF01156 | IU_nuc_hydro | 21.55 |
| PF01425 | Amidase | 12.07 |
| PF01619 | Pro_dh | 10.34 |
| PF13620 | CarboxypepD_reg | 5.17 |
| PF13432 | TPR_16 | 2.59 |
| PF00343 | Phosphorylase | 1.72 |
| PF14559 | TPR_19 | 1.72 |
| PF01048 | PNP_UDP_1 | 1.72 |
| PF07676 | PD40 | 1.72 |
| PF01914 | MarC | 1.72 |
| PF00069 | Pkinase | 1.72 |
| PF07662 | Nucleos_tra2_C | 1.72 |
| PF02823 | ATP-synt_DE_N | 1.72 |
| PF00795 | CN_hydrolase | 0.86 |
| PF13857 | Ank_5 | 0.86 |
| PF01520 | Amidase_3 | 0.86 |
| PF01979 | Amidohydro_1 | 0.86 |
| PF13483 | Lactamase_B_3 | 0.86 |
| PF00383 | dCMP_cyt_deam_1 | 0.86 |
| PF00578 | AhpC-TSA | 0.86 |
| PF13435 | Cytochrome_C554 | 0.86 |
| PF02885 | Glycos_trans_3N | 0.86 |
| PF01451 | LMWPc | 0.86 |
| PF13247 | Fer4_11 | 0.86 |
| PF00401 | ATP-synt_DE | 0.86 |
| PF10343 | Q_salvage | 0.86 |
| PF01904 | DUF72 | 0.86 |
| PF09859 | Oxygenase-NA | 0.86 |
| PF12704 | MacB_PCD | 0.86 |
| PF08241 | Methyltransf_11 | 0.86 |
| PF07593 | UnbV_ASPIC | 0.86 |
| PF03988 | DUF347 | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG1957 | Inosine-uridine nucleoside N-ribohydrolase | Nucleotide transport and metabolism [F] | 21.55 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 12.07 |
| COG0506 | Proline dehydrogenase | Amino acid transport and metabolism [E] | 10.34 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 6.90 |
| COG0355 | FoF1-type ATP synthase, epsilon subunit | Energy production and conversion [C] | 2.59 |
| COG0058 | Glucan phosphorylase | Carbohydrate transport and metabolism [G] | 1.72 |
| COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 1.72 |
| COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 1.72 |
| COG1972 | Nucleoside permease NupC | Nucleotide transport and metabolism [F] | 1.72 |
| COG2095 | Small neutral amino acid transporter SnatA, MarC family | Amino acid transport and metabolism [E] | 1.72 |
| COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 1.72 |
| COG0860 | N-acetylmuramoyl-L-alanine amidase | Cell wall/membrane/envelope biogenesis [M] | 0.86 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.86 |
| COG4705 | Uncharacterized membrane-anchored protein | Function unknown [S] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.17 % |
| Unclassified | root | N/A | 19.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001180|JGI12695J13573_1008944 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300001471|JGI12712J15308_10179656 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300005184|Ga0066671_10157101 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
| 3300005533|Ga0070734_10474739 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300005542|Ga0070732_10199541 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300005560|Ga0066670_10755203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 589 | Open in IMG/M |
| 3300005712|Ga0070764_10494516 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300005764|Ga0066903_100832792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1656 | Open in IMG/M |
| 3300005764|Ga0066903_105701531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
| 3300005921|Ga0070766_10004381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 7137 | Open in IMG/M |
| 3300006047|Ga0075024_100540702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 617 | Open in IMG/M |
| 3300006059|Ga0075017_101522136 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300006176|Ga0070765_100518016 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300006176|Ga0070765_101559990 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Spirosoma → Spirosoma endophyticum | 621 | Open in IMG/M |
| 3300006176|Ga0070765_102061304 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300006796|Ga0066665_10474202 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300009088|Ga0099830_11056335 | Not Available | 673 | Open in IMG/M |
| 3300009090|Ga0099827_10833192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
| 3300009090|Ga0099827_11392920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300009094|Ga0111539_12781071 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8 | 567 | Open in IMG/M |
| 3300009519|Ga0116108_1177841 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300009523|Ga0116221_1366995 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300009623|Ga0116133_1002917 | All Organisms → cellular organisms → Bacteria | 4556 | Open in IMG/M |
| 3300009646|Ga0116132_1227750 | Not Available | 566 | Open in IMG/M |
| 3300009792|Ga0126374_10136281 | Not Available | 1463 | Open in IMG/M |
| 3300009792|Ga0126374_10796650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Hahellaceae → Hahella → Hahella chejuensis | 721 | Open in IMG/M |
| 3300010048|Ga0126373_11480968 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300010329|Ga0134111_10207034 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300010329|Ga0134111_10247869 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300010341|Ga0074045_10140625 | All Organisms → cellular organisms → Bacteria | 1645 | Open in IMG/M |
| 3300010343|Ga0074044_10672651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
| 3300010360|Ga0126372_12086143 | Not Available | 615 | Open in IMG/M |
| 3300010361|Ga0126378_10581383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1235 | Open in IMG/M |
| 3300010398|Ga0126383_11620582 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300012200|Ga0137382_10253256 | Not Available | 1220 | Open in IMG/M |
| 3300012207|Ga0137381_10631016 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300012207|Ga0137381_11061317 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300012350|Ga0137372_10551961 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300012362|Ga0137361_10022999 | All Organisms → cellular organisms → Bacteria | 4787 | Open in IMG/M |
| 3300012362|Ga0137361_11785479 | Not Available | 533 | Open in IMG/M |
| 3300012930|Ga0137407_11033140 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300014326|Ga0157380_10143794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Asticcacaulis | 2053 | Open in IMG/M |
| 3300014489|Ga0182018_10159604 | Not Available | 1284 | Open in IMG/M |
| 3300014495|Ga0182015_10146598 | Not Available | 1607 | Open in IMG/M |
| 3300014654|Ga0181525_10070566 | All Organisms → cellular organisms → Bacteria | 1956 | Open in IMG/M |
| 3300015051|Ga0137414_1119268 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300015372|Ga0132256_102571360 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300016357|Ga0182032_11686424 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300016404|Ga0182037_12111768 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300017924|Ga0187820_1022998 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1580 | Open in IMG/M |
| 3300017925|Ga0187856_1264776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300017941|Ga0187850_10175791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 991 | Open in IMG/M |
| 3300017943|Ga0187819_10495063 | Not Available | 697 | Open in IMG/M |
| 3300017975|Ga0187782_10218485 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
| 3300017995|Ga0187816_10483675 | Not Available | 556 | Open in IMG/M |
| 3300018006|Ga0187804_10319630 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300018022|Ga0187864_10306266 | Not Available | 708 | Open in IMG/M |
| 3300018047|Ga0187859_10079394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1728 | Open in IMG/M |
| 3300018058|Ga0187766_10947829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300018060|Ga0187765_10844624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300020579|Ga0210407_10745058 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300021088|Ga0210404_10270642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 928 | Open in IMG/M |
| 3300021406|Ga0210386_10537654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1010 | Open in IMG/M |
| 3300021406|Ga0210386_11116316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300021420|Ga0210394_10537389 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300021432|Ga0210384_10004166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 16274 | Open in IMG/M |
| 3300021433|Ga0210391_10265421 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300021474|Ga0210390_10353167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1244 | Open in IMG/M |
| 3300021474|Ga0210390_11261413 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300021477|Ga0210398_10327726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1249 | Open in IMG/M |
| 3300021478|Ga0210402_10925850 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300021559|Ga0210409_11527065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300022523|Ga0242663_1049891 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300024284|Ga0247671_1005948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2036 | Open in IMG/M |
| 3300026298|Ga0209236_1054266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. | 1981 | Open in IMG/M |
| 3300026489|Ga0257160_1008106 | All Organisms → cellular organisms → Bacteria | 1435 | Open in IMG/M |
| 3300026514|Ga0257168_1123651 | Not Available | 577 | Open in IMG/M |
| 3300026557|Ga0179587_10323637 | Not Available | 997 | Open in IMG/M |
| 3300026910|Ga0207840_1028265 | Not Available | 548 | Open in IMG/M |
| 3300027505|Ga0209218_1136244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300027651|Ga0209217_1056879 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1169 | Open in IMG/M |
| 3300027824|Ga0209040_10169333 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium | 1162 | Open in IMG/M |
| 3300027829|Ga0209773_10250250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 740 | Open in IMG/M |
| 3300027855|Ga0209693_10097960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1451 | Open in IMG/M |
| 3300027855|Ga0209693_10444616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300027889|Ga0209380_10375389 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300027889|Ga0209380_10795605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300027898|Ga0209067_10907222 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300027903|Ga0209488_10996258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300027910|Ga0209583_10442205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300028906|Ga0308309_10186275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1700 | Open in IMG/M |
| 3300028906|Ga0308309_10942397 | Not Available | 749 | Open in IMG/M |
| 3300029982|Ga0302277_1011240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5376 | Open in IMG/M |
| 3300029999|Ga0311339_10168986 | All Organisms → cellular organisms → Bacteria | 2532 | Open in IMG/M |
| 3300030042|Ga0302300_1170311 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300030053|Ga0302177_10200361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1100 | Open in IMG/M |
| 3300030114|Ga0311333_10854566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 766 | Open in IMG/M |
| 3300030503|Ga0311370_12221578 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300030602|Ga0210254_10503782 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300030740|Ga0265460_12473051 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300031028|Ga0302180_10543256 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300031122|Ga0170822_11794339 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300031474|Ga0170818_112617648 | Not Available | 682 | Open in IMG/M |
| 3300031718|Ga0307474_11505279 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300031962|Ga0307479_11379996 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300032180|Ga0307471_100382415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1529 | Open in IMG/M |
| 3300032180|Ga0307471_100886603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1059 | Open in IMG/M |
| 3300032954|Ga0335083_11540103 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300033158|Ga0335077_10914928 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.24% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 9.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.17% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.31% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.31% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.45% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.45% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.45% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.45% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.59% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.59% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.72% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.72% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.72% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.72% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.86% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.86% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.86% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.86% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001180 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024284 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12 | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026910 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 65 (SPAdes) | Environmental | Open in IMG/M |
| 3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029982 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030042 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030602 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR018SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12695J13573_10089441 | 3300001180 | Forest Soil | LVWKEFENSGPRAKTYLALMFVFYGLAIVLIARAYG* |
| JGI12712J15308_101796562 | 3300001471 | Forest Soil | LAWKEFKGAGSKAYIYLFFMFVFYCLAIALVARANG* |
| Ga0066671_101571011 | 3300005184 | Soil | WGILAWREFEGSAGRAKLYLTLMFIFYGLAILLVARANG* |
| Ga0070734_104747391 | 3300005533 | Surface Soil | WKEFRGASGKAYAYLALMFVFYVVAIALVARAIS* |
| Ga0070732_101995412 | 3300005542 | Surface Soil | WKEFAGAGSRAKAYLVLMFVSYGLAILLVARANG* |
| Ga0066670_107552032 | 3300005560 | Soil | FAWKEFKGAGSAAKIYLALMFVFYCLAIVLVARANG* |
| Ga0070764_104945162 | 3300005712 | Soil | FAWKEFAGAGGKAKAYLALMFVFYGLAILMVARANG* |
| Ga0066903_1008327923 | 3300005764 | Tropical Forest Soil | WKEFAGSEPRAKLYLALMFVFYILAILLVANANA* |
| Ga0066903_1057015312 | 3300005764 | Tropical Forest Soil | WKEFAGAGSRAKLYLVLMFVFYCLAILLVAKANG* |
| Ga0070766_100043818 | 3300005921 | Soil | GVLAWKEFEGAGSRAKLYLGLMFVFYCLAILLVARANG* |
| Ga0075024_1005407022 | 3300006047 | Watersheds | AWKEFKGAGSKAMMYLGLMFVFYCLAILLVAKANG* |
| Ga0075017_1015221362 | 3300006059 | Watersheds | LWGVLAWKEFGGANRQAKTFLALMFLFYLFAILLVAKANTST* |
| Ga0070765_1005180161 | 3300006176 | Soil | GIFAWKEFAGANRRAQAFLALMFIFYALAILLIARANTAN* |
| Ga0070765_1015599901 | 3300006176 | Soil | AWKEFEGAPTKAKMYLVLMFVFYCLGILLVARANG* |
| Ga0070765_1020613041 | 3300006176 | Soil | EFAGANTRAKVYSALMFVFYILAILLVARANTAS* |
| Ga0066665_104508731 | 3300006796 | Soil | EFEGSNRQAKTFLGLMFLFYVFAILLIAKANTAG* |
| Ga0066665_104742023 | 3300006796 | Soil | GILAWKEFEGSGGRAKLYLTLMFAFYALAILLIARANG* |
| Ga0099830_110563352 | 3300009088 | Vadose Zone Soil | VWKEFQGANRRAKTYLALMFLFYLFAILLVARANTAS* |
| Ga0099827_108331922 | 3300009090 | Vadose Zone Soil | VFVWKEFAGATGKAKAYLGGMFAFYCLAIIFVARANG* |
| Ga0099827_113929202 | 3300009090 | Vadose Zone Soil | GVLAWKEFEGAPGKAKVYLGLMFVFYCLGILLVARANG* |
| Ga0111539_127810712 | 3300009094 | Populus Rhizosphere | WKEFEGAGSRAKLYLGLMFVFYLLAILLVAKANG* |
| Ga0116108_11778413 | 3300009519 | Peatland | VLAWKEFEGAPGKAKMYLALMFVFYCLGILLVARANG* |
| Ga0116221_13669952 | 3300009523 | Peatlands Soil | WGILALKEFWNSGPRAKMYLALMFVFYGLAIVLVARANG* |
| Ga0116133_10029171 | 3300009623 | Peatland | WKEFAGAPGKAKLYLVFMFVFYCLGILLVAKANG* |
| Ga0116132_12277501 | 3300009646 | Peatland | WKEFEGAPGKAKMYLALMFVFYCLGILLVAKANG* |
| Ga0126374_101362812 | 3300009792 | Tropical Forest Soil | WKEFAGSGGRGKMYLVLMFVFYGLAILLIAKANG* |
| Ga0126374_107966501 | 3300009792 | Tropical Forest Soil | WKEFDGAGPRAKLYLALMFVFYGLAILLVAKANG* |
| Ga0126373_114809682 | 3300010048 | Tropical Forest Soil | LVWKEFDGGGSRAKVYLALMFVFYALAILLVARANG* |
| Ga0134111_102070342 | 3300010329 | Grasslands Soil | VLAWKEFEGATRSAKTFLALMFVFYILAIFLVARANTAS* |
| Ga0134111_102478692 | 3300010329 | Grasslands Soil | REFQGANRRAKTFLAFMFVFYILAILLVAKANTAS* |
| Ga0074045_101406252 | 3300010341 | Bog Forest Soil | GVFAWREFAGAPSKAKFYLFLMFVFYCLGILLVAKANG* |
| Ga0074044_106726512 | 3300010343 | Bog Forest Soil | VWKEFAGAGSRAKLYLSLMFVFYCLAILLVAKANG* |
| Ga0126372_120861432 | 3300010360 | Tropical Forest Soil | FVWKEFAGASSRAKMFLAGMFVFYGLAILLIARANG* |
| Ga0126378_105813832 | 3300010361 | Tropical Forest Soil | FAWKEFTGANAKAKLYLGLMFISYILAILLIARASAA* |
| Ga0126383_116205822 | 3300010398 | Tropical Forest Soil | KEFQGASRRAQIFLALMFVFYVLAIFIVAKANTAS* |
| Ga0137382_102532564 | 3300012200 | Vadose Zone Soil | LAWKEFDGSGPRAKLYLALMFVFYALAILLIARANG* |
| Ga0137381_106310162 | 3300012207 | Vadose Zone Soil | FAWKEFQGANRRAKTFLALMFLFYILAILLVAKANTAS* |
| Ga0137381_110613172 | 3300012207 | Vadose Zone Soil | VLAWKEFKGACSKAYVYLCLMFVFYALAIALVARANG* |
| Ga0137372_105519612 | 3300012350 | Vadose Zone Soil | WKEFAGSGIRAKVYLTLMFVFYAIAILMVARANG* |
| Ga0137361_100229991 | 3300012362 | Vadose Zone Soil | AWKEFEGAPGKAKMYLALMFVFYCVGILLVARANG* |
| Ga0137361_117854792 | 3300012362 | Vadose Zone Soil | GVLAWKEFEGAPGKAKMYLGLMFVFYCLGILLVARANG* |
| Ga0137390_104355643 | 3300012363 | Vadose Zone Soil | FAWKEFHGANRQAKTYLGLMFLFYILAILLIAKANTAG* |
| Ga0137419_104376142 | 3300012925 | Vadose Zone Soil | WKEFEGSNRQAKTFLGLMFLFYILAIILIAKANTAG* |
| Ga0137407_110331402 | 3300012930 | Vadose Zone Soil | WKEFAGANRQAKTYLALMFLFYIFAILLVAKANTGT* |
| Ga0157380_101437943 | 3300014326 | Switchgrass Rhizosphere | FAWKEFKGGGSKATMYLILMFVFYGLAIALVAKANG* |
| Ga0182018_101596042 | 3300014489 | Palsa | VLAWKEFDGAPAKAKMYLGLMFVFYCVGILLVARANG* |
| Ga0182015_101465982 | 3300014495 | Palsa | WKEFAGANKTARAYLALMFAFYAVAILLVARAHNGG* |
| Ga0181525_100705663 | 3300014654 | Bog | WKEFANSGPRAKLYLTLMFVFYALAIFLVVQANG* |
| Ga0137414_11192681 | 3300015051 | Vadose Zone Soil | WKEFEGAGSKARMYLGLMFVFYCLAILLVAKANG* |
| Ga0132256_1025713602 | 3300015372 | Arabidopsis Rhizosphere | WKEFKGAGSKAYVYLFLMFVFYCLAIALVARANG* |
| Ga0182032_116864241 | 3300016357 | Soil | VFAWKEFAGANSRAKIYLFLMFVFYCFAIALVARANG |
| Ga0182037_121117682 | 3300016404 | Soil | VLVWKEFKGAPRRAYLYLTLMFLFYVLAILLVSKANTAG |
| Ga0187820_10229983 | 3300017924 | Freshwater Sediment | VLAWKEFQGANRSAKTYLGLMFVFYVLAILLVARANTAT |
| Ga0187856_12647763 | 3300017925 | Peatland | VLAWKEFEGAPGKAKIYLALMFVFYCLGILLVARANG |
| Ga0187850_101757912 | 3300017941 | Peatland | AWKEFAGAGSRAKWYLVGMFVFYCIAILLVAKANG |
| Ga0187819_104950631 | 3300017943 | Freshwater Sediment | LAWREFEGAGSRAKLYLGLMFVFYCFAILLVAKANG |
| Ga0187782_102184852 | 3300017975 | Tropical Peatland | GLLAWKEFAGSGSRAKLYLVLMFAFYILAILLVARANG |
| Ga0187816_104836751 | 3300017995 | Freshwater Sediment | VLAWKEFEGAGSRAKLYLGLMFFFYCFAILLVAKANG |
| Ga0187804_103196301 | 3300018006 | Freshwater Sediment | FAWKEFAGAGSRAKIYLSLMFVFYALAILLVARANG |
| Ga0187864_103062661 | 3300018022 | Peatland | LAWKEFEGAESRAKLYLGLMFVFYCFAILLVAKANG |
| Ga0187859_100793943 | 3300018047 | Peatland | AWKEFAGAGSRAKVYLGLMFVFYCVAILLVARANG |
| Ga0187766_109478291 | 3300018058 | Tropical Peatland | KEFQDAKPQAKTYLALMFAFYLLAILLVAKANTVG |
| Ga0187765_108446242 | 3300018060 | Tropical Peatland | VFAWKEFAGAPGKAKTYLFLMFVFYCLAIALVAKANG |
| Ga0210407_105958872 | 3300020579 | Soil | GVLAWKEFQGANRQAKTYLGLMFLFYILAILLVAQANTAS |
| Ga0210407_107450581 | 3300020579 | Soil | GILAWKEFANSGPRAKAYLSLMFVFYGLAIFLVARANG |
| Ga0210404_102706421 | 3300021088 | Soil | AWKEFDGSGPRAKRYLALMFVFYGLAILFVAKANG |
| Ga0210386_105376541 | 3300021406 | Soil | LVWKEFDGATRKAKAYLALMFMFYLLAILLIARASG |
| Ga0210386_105625952 | 3300021406 | Soil | LAWKEFQGANRQAKTYLGLMFLFYILAILLVSQANTAS |
| Ga0210386_111163162 | 3300021406 | Soil | IFAWKEFDGSGPRAKLYLLLMFVFYGLAILFVAKANG |
| Ga0210394_105373891 | 3300021420 | Soil | KEFAGADRKARAYLALMFVFYLLAILLVARANTAS |
| Ga0210384_100041661 | 3300021432 | Soil | LAWKEFEGAPGKAKLYLGLMFVFYGLGILLVARANG |
| Ga0210391_102654214 | 3300021433 | Soil | VLAWKEFDGAPGKAKMYLVLMFVFYCVGILLVARANG |
| Ga0210390_103531672 | 3300021474 | Soil | IFAWKEFAGANSKAKSYLALMFIFYFLAILLIAHATA |
| Ga0210390_112614131 | 3300021474 | Soil | VLAWKEFAGSGSRAKVYLALMFVFYAFAILLVARANG |
| Ga0210398_103277261 | 3300021477 | Soil | KEFAGANKRAKAYLTLMFIFYILAILLVARASTASS |
| Ga0210402_109258501 | 3300021478 | Soil | WGVLAWKEFAGAGPRSKVYLALMFVSYGLAILLVARANG |
| Ga0210409_115270652 | 3300021559 | Soil | GLFVWKEFAGAGGKAKTYLALMFLFYVLAIAFVALAH |
| Ga0242663_10498911 | 3300022523 | Soil | AWKEFAGSGSRAKVYLALMFVFYAFAILLVARANG |
| Ga0247671_10059482 | 3300024284 | Soil | VFAWKEFQGAKPQAKTYLALMFLFYLLAILLVAKANTAT |
| Ga0209236_10542663 | 3300026298 | Grasslands Soil | AWKEFEGSGSRAKAYLTLMFVFYGLAILLVARANG |
| Ga0257160_10081061 | 3300026489 | Soil | FAWKEFAGAPQKAKMYLVLMFVFYCVGILLVAKANG |
| Ga0257168_11236512 | 3300026514 | Soil | GIFAWKEFAGANRKARAYLALMFIFYMLAILLVARANTAS |
| Ga0179587_103236371 | 3300026557 | Vadose Zone Soil | LVWKEFAGANRQSKTYLALMFLFYIFAILLVAKANTGT |
| Ga0207840_10282652 | 3300026910 | Tropical Forest Soil | IFAWKEFTGANSKAKTYLFLMFVFYCLGIVLVARANG |
| Ga0209218_11362442 | 3300027505 | Forest Soil | KEFAGANKLAKAFLAMMFIFYILAILLIARANTAS |
| Ga0209217_10568793 | 3300027651 | Forest Soil | VLAWKEFEAAPGKAKMYLALMFVFYCVGILLVARANG |
| Ga0209040_101693331 | 3300027824 | Bog Forest Soil | AWKEFAGASSRAKSYLVGMFVFYCVAILLVAKANG |
| Ga0209773_102502502 | 3300027829 | Bog Forest Soil | LAWKEFEGAGSGAKLYLSLMFVFYCFAILLVARANG |
| Ga0209180_104268891 | 3300027846 | Vadose Zone Soil | ALWGVLAWKEFQGANRPAKAFLGLMFLFYILAILLIAKANTAG |
| Ga0209693_100979602 | 3300027855 | Soil | VWKEFAGANKRAQAFLALMFIFYFLAIFLIARANTAG |
| Ga0209693_104446161 | 3300027855 | Soil | LAWKEFQGAKPQAKTYLALMFLFYLLAILLVAKANTAT |
| Ga0209380_103753893 | 3300027889 | Soil | FVWKEFAGANKRAQAFLALMFVFYFLAIFLIARANTAG |
| Ga0209380_107956052 | 3300027889 | Soil | WKEFGGANTRAKAYLTLMFVFYILAILLVARANTAS |
| Ga0209067_109072222 | 3300027898 | Watersheds | LWGVLAWKEFAGSGSRARVYLALMFVSYAFAILLVARANG |
| Ga0209488_109962582 | 3300027903 | Vadose Zone Soil | VFAWKEFAGAPQKAKLYLALMFVFYCVGILLVAKANG |
| Ga0209583_104422051 | 3300027910 | Watersheds | VLAWKEFAGGGSRSKLYLALMFVFYALAILLVAHANG |
| Ga0308309_101862751 | 3300028906 | Soil | AWKEFEGAPGTAKLYLGLMFVFYGLGILLVARANG |
| Ga0308309_109423971 | 3300028906 | Soil | WKEFDGANKKARAYLALMFMFYFLAILLIARANNF |
| Ga0302277_10112406 | 3300029982 | Bog | AWKEFENSGPRAKVYLALMFVFYGIAIFLVARANG |
| Ga0311339_101689861 | 3300029999 | Palsa | AWKEFAGAGSRAKIFLVLMFVFYGLAILLLAHASS |
| Ga0302300_11703111 | 3300030042 | Palsa | LAWKEFANSGPRAKAYLGLMFVFYGLAIFLIARANG |
| Ga0302177_102003611 | 3300030053 | Palsa | AWKEFAGANKRSQAYLAMMFIFYMLAILLIARANTAG |
| Ga0311333_108545662 | 3300030114 | Fen | VFAWKEFAGAPGKAKIYLLGMFAFYCLAIIFVAKAY |
| Ga0311370_122215781 | 3300030503 | Palsa | LAWKEFANSGSRAKAYLALMFVFYGLAIFLVARANG |
| Ga0210254_105037822 | 3300030602 | Soil | LFFFFAWKEFAGAGSRAKIFLVLMFVFYGLAILLLTHASG |
| Ga0265460_124730511 | 3300030740 | Soil | GILAWKEFENSGPRAKTYLGLMFVFYALAIFLVARANG |
| Ga0302180_105432561 | 3300031028 | Palsa | LAWKEFENSGPRAKTYLGLMFVFYGLAIFLVARANG |
| Ga0170822_117943391 | 3300031122 | Forest Soil | GVLAWKEFAGSGSRAKVYLALMFVFYAFAILLVARANG |
| Ga0170818_1126176482 | 3300031474 | Forest Soil | LAWKEFAGSGPRAKLYLTLMFVFYALAILLVARANG |
| Ga0307476_110038281 | 3300031715 | Hardwood Forest Soil | KEFQGAHRQAKTFLGLTFLFYILAILLIASASTGS |
| Ga0307474_115052791 | 3300031718 | Hardwood Forest Soil | GVLAWKEFANSGPRAKVYLGLMFVFYGLAIFLVARANG |
| Ga0307479_113799962 | 3300031962 | Hardwood Forest Soil | AWKEFTGSGLRAKLYLALMFVFYGLAILLVARANG |
| Ga0307471_1003824152 | 3300032180 | Hardwood Forest Soil | WKEFEGAKPQAKTYLALMFVFYLLAILLVAKANTAT |
| Ga0307471_1008866031 | 3300032180 | Hardwood Forest Soil | IFAWKEFAGANRKARAFLALMFIFYILAILLVARANTAS |
| Ga0335083_115401031 | 3300032954 | Soil | AWKEFQGSGSQAKIYLVLMFVFYGLAILLVARANG |
| Ga0335077_109149281 | 3300033158 | Soil | AWKEFAGAGPKAKLYLVLMFVFYGLAILLVAKANG |
| ⦗Top⦘ |