


| Basic Information | |
|---|---|
| Family ID | F078923 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 43 residues |
| Representative Sequence | DVLAAEADGKRSIYAPGYFTMVGNEIIDKVNSMTLKKYQD |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.92 % |
| % of genes near scaffold ends (potentially truncated) | 91.38 % |
| % of genes from short scaffolds (< 2000 bps) | 81.90 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (52.586 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater (21.552 % of family members) |
| Environment Ontology (ENVO) | Unclassified (53.448 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (85.345 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.18% β-sheet: 0.00% Coil/Unstructured: 58.82% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF13619 | KTSC | 5.17 |
| PF04404 | ERF | 1.72 |
| PF08299 | Bac_DnaA_C | 0.86 |
| PF12684 | DUF3799 | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 52.59 % |
| All Organisms | root | All Organisms | 47.41 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2236876005|none_p007929 | Not Available | 522 | Open in IMG/M |
| 2236876010|none_p0510236 | Not Available | 502 | Open in IMG/M |
| 3300000128|SA_S1_NOR08_45mDRAFT_c10033362 | All Organisms → Viruses → Predicted Viral | 2067 | Open in IMG/M |
| 3300000224|SI34jun09_10mDRAFT_1008788 | All Organisms → Viruses → Predicted Viral | 2131 | Open in IMG/M |
| 3300000928|OpTDRAFT_10050404 | All Organisms → cellular organisms → Bacteria | 2486 | Open in IMG/M |
| 3300001344|JGI20152J14361_10069014 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 816 | Open in IMG/M |
| 3300001344|JGI20152J14361_10090064 | Not Available | 638 | Open in IMG/M |
| 3300001344|JGI20152J14361_10112561 | Not Available | 526 | Open in IMG/M |
| 3300001352|JGI20157J14317_10187600 | Not Available | 602 | Open in IMG/M |
| 3300004113|Ga0065183_10521262 | Not Available | 595 | Open in IMG/M |
| 3300005589|Ga0070729_10071069 | All Organisms → Viruses → Predicted Viral | 2197 | Open in IMG/M |
| 3300005824|Ga0074474_1219835 | All Organisms → Viruses → Predicted Viral | 1656 | Open in IMG/M |
| 3300005837|Ga0078893_11925091 | All Organisms → Viruses → Predicted Viral | 1521 | Open in IMG/M |
| 3300005837|Ga0078893_14698291 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Thorarchaeota → Candidatus Thorarchaeota archaeon | 848 | Open in IMG/M |
| 3300006191|Ga0075447_10164248 | Not Available | 741 | Open in IMG/M |
| 3300006193|Ga0075445_10300383 | Not Available | 543 | Open in IMG/M |
| 3300006467|Ga0099972_11982805 | All Organisms → Viruses → Predicted Viral | 2215 | Open in IMG/M |
| 3300006484|Ga0070744_10030945 | All Organisms → Viruses → Predicted Viral | 1583 | Open in IMG/M |
| 3300006802|Ga0070749_10019943 | All Organisms → Viruses → Predicted Viral | 4256 | Open in IMG/M |
| 3300006925|Ga0098050_1038231 | All Organisms → Viruses → Predicted Viral | 1287 | Open in IMG/M |
| 3300007276|Ga0070747_1319448 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Thorarchaeota → Candidatus Thorarchaeota archaeon | 532 | Open in IMG/M |
| 3300007540|Ga0099847_1230467 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Thorarchaeota → Candidatus Thorarchaeota archaeon | 535 | Open in IMG/M |
| 3300007862|Ga0105737_1007347 | All Organisms → Viruses → Predicted Viral | 2426 | Open in IMG/M |
| 3300008470|Ga0115371_10887288 | Not Available | 619 | Open in IMG/M |
| 3300008999|Ga0102816_1072799 | Not Available | 1036 | Open in IMG/M |
| 3300008999|Ga0102816_1254432 | Not Available | 554 | Open in IMG/M |
| 3300009024|Ga0102811_1334274 | Not Available | 569 | Open in IMG/M |
| 3300009076|Ga0115550_1220422 | Not Available | 631 | Open in IMG/M |
| 3300009079|Ga0102814_10217157 | All Organisms → Viruses → Predicted Viral | 1042 | Open in IMG/M |
| 3300009426|Ga0115547_1276005 | Not Available | 524 | Open in IMG/M |
| 3300009426|Ga0115547_1292005 | Not Available | 508 | Open in IMG/M |
| 3300009428|Ga0114915_1161791 | Not Available | 631 | Open in IMG/M |
| 3300009442|Ga0115563_1177890 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 833 | Open in IMG/M |
| 3300009496|Ga0115570_10309053 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Thorarchaeota → Candidatus Thorarchaeota archaeon | 684 | Open in IMG/M |
| 3300009507|Ga0115572_10334486 | Not Available | 854 | Open in IMG/M |
| 3300009601|Ga0114914_1060678 | Not Available | 594 | Open in IMG/M |
| 3300010150|Ga0098056_1096823 | All Organisms → Viruses → Predicted Viral | 1008 | Open in IMG/M |
| 3300010150|Ga0098056_1283762 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Thorarchaeota → Candidatus Thorarchaeota archaeon | 547 | Open in IMG/M |
| 3300010368|Ga0129324_10377976 | Not Available | 549 | Open in IMG/M |
| 3300011118|Ga0114922_11022955 | Not Available | 670 | Open in IMG/M |
| 3300011125|Ga0151663_1004753 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1198 | Open in IMG/M |
| 3300011253|Ga0151671_1133148 | Not Available | 785 | Open in IMG/M |
| 3300011257|Ga0151658_1140995 | Not Available | 605 | Open in IMG/M |
| 3300011258|Ga0151677_1093196 | Not Available | 956 | Open in IMG/M |
| 3300011261|Ga0151661_1146514 | Not Available | 592 | Open in IMG/M |
| 3300017709|Ga0181387_1130620 | Not Available | 518 | Open in IMG/M |
| 3300017727|Ga0181401_1148301 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Thorarchaeota → Candidatus Thorarchaeota archaeon | 573 | Open in IMG/M |
| 3300017735|Ga0181431_1052215 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 925 | Open in IMG/M |
| 3300020165|Ga0206125_10114439 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1123 | Open in IMG/M |
| 3300020182|Ga0206129_10013563 | Not Available | 7027 | Open in IMG/M |
| 3300020185|Ga0206131_10018813 | Not Available | 5784 | Open in IMG/M |
| 3300020187|Ga0206130_10251331 | Not Available | 801 | Open in IMG/M |
| 3300020187|Ga0206130_10441532 | Not Available | 509 | Open in IMG/M |
| 3300020595|Ga0206126_10266251 | Not Available | 780 | Open in IMG/M |
| 3300021959|Ga0222716_10490088 | Not Available | 693 | Open in IMG/M |
| 3300021959|Ga0222716_10501476 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Thorarchaeota → Candidatus Thorarchaeota archaeon | 682 | Open in IMG/M |
| 3300022072|Ga0196889_1104809 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Thorarchaeota → Candidatus Thorarchaeota archaeon | 513 | Open in IMG/M |
| 3300022178|Ga0196887_1065886 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Thorarchaeota → Candidatus Thorarchaeota archaeon | 882 | Open in IMG/M |
| 3300022221|Ga0224506_10399688 | Not Available | 606 | Open in IMG/M |
| 3300022308|Ga0224504_10043367 | All Organisms → Viruses → Predicted Viral | 1779 | Open in IMG/M |
| (restricted) 3300022913|Ga0233404_10057739 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 894 | Open in IMG/M |
| (restricted) 3300023089|Ga0233408_10047724 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 767 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10167130 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 946 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10214911 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 836 | Open in IMG/M |
| 3300024191|Ga0228636_1084830 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 727 | Open in IMG/M |
| 3300024229|Ga0233402_1102748 | Not Available | 593 | Open in IMG/M |
| 3300024242|Ga0228673_1000385 | Not Available | 8971 | Open in IMG/M |
| 3300024242|Ga0228673_1056695 | Not Available | 693 | Open in IMG/M |
| (restricted) 3300024264|Ga0233444_10142616 | All Organisms → Viruses → Predicted Viral | 1174 | Open in IMG/M |
| 3300024281|Ga0228610_1007433 | All Organisms → Viruses → Predicted Viral | 1087 | Open in IMG/M |
| 3300024292|Ga0228630_1103348 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Thorarchaeota → Candidatus Thorarchaeota archaeon | 578 | Open in IMG/M |
| 3300024294|Ga0228664_1003110 | Not Available | 7439 | Open in IMG/M |
| 3300024314|Ga0228657_1077170 | Not Available | 685 | Open in IMG/M |
| 3300024413|Ga0233393_1013475 | All Organisms → Viruses → Predicted Viral | 2190 | Open in IMG/M |
| 3300024420|Ga0228632_1110894 | Not Available | 641 | Open in IMG/M |
| 3300025084|Ga0208298_1036493 | All Organisms → Viruses → Predicted Viral | 1006 | Open in IMG/M |
| 3300025276|Ga0208814_1130749 | Not Available | 589 | Open in IMG/M |
| 3300025621|Ga0209504_1008323 | Not Available | 5082 | Open in IMG/M |
| 3300025621|Ga0209504_1042460 | All Organisms → Viruses → Predicted Viral | 1455 | Open in IMG/M |
| 3300025626|Ga0209716_1013388 | All Organisms → Viruses → Predicted Viral | 3617 | Open in IMG/M |
| 3300025632|Ga0209194_1094429 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 766 | Open in IMG/M |
| 3300025636|Ga0209136_1064810 | All Organisms → Viruses → Predicted Viral | 1165 | Open in IMG/M |
| 3300025640|Ga0209198_1151548 | Not Available | 643 | Open in IMG/M |
| 3300025809|Ga0209199_1188520 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 728 | Open in IMG/M |
| 3300025832|Ga0209307_1184295 | Not Available | 614 | Open in IMG/M |
| 3300025860|Ga0209119_1057911 | All Organisms → Viruses → Predicted Viral | 1896 | Open in IMG/M |
| 3300025880|Ga0209534_10418761 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Thorarchaeota → Candidatus Thorarchaeota archaeon | 574 | Open in IMG/M |
| 3300026453|Ga0228644_1038772 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 927 | Open in IMG/M |
| 3300026460|Ga0247604_1038152 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1161 | Open in IMG/M |
| 3300026470|Ga0247599_1090212 | Not Available | 643 | Open in IMG/M |
| 3300026471|Ga0247602_1018496 | All Organisms → Viruses → Predicted Viral | 1889 | Open in IMG/M |
| 3300026505|Ga0228647_1034457 | All Organisms → Viruses → Predicted Viral | 1309 | Open in IMG/M |
| 3300026517|Ga0228607_1133715 | Not Available | 606 | Open in IMG/M |
| 3300027186|Ga0208797_1049491 | Not Available | 531 | Open in IMG/M |
| 3300027189|Ga0208675_1034211 | Not Available | 614 | Open in IMG/M |
| 3300027196|Ga0208438_1043015 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 752 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10189816 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 944 | Open in IMG/M |
| 3300028008|Ga0228674_1207058 | Not Available | 627 | Open in IMG/M |
| 3300028008|Ga0228674_1280374 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Thorarchaeota → Candidatus Thorarchaeota archaeon | 511 | Open in IMG/M |
| 3300028126|Ga0228648_1009639 | All Organisms → Viruses → Predicted Viral | 1668 | Open in IMG/M |
| 3300028126|Ga0228648_1074100 | Not Available | 645 | Open in IMG/M |
| 3300028273|Ga0228640_1038188 | Not Available | 944 | Open in IMG/M |
| 3300028280|Ga0228646_1077509 | Not Available | 818 | Open in IMG/M |
| 3300028416|Ga0228614_1026116 | All Organisms → Viruses → Predicted Viral | 1426 | Open in IMG/M |
| 3300031519|Ga0307488_10475410 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 753 | Open in IMG/M |
| 3300031658|Ga0307984_1046279 | Not Available | 1370 | Open in IMG/M |
| 3300031689|Ga0308017_1060890 | Not Available | 792 | Open in IMG/M |
| 3300031689|Ga0308017_1131405 | Not Available | 507 | Open in IMG/M |
| 3300031703|Ga0308002_1136906 | Not Available | 514 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 21.55% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 11.21% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 6.03% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 6.03% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 5.17% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 5.17% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.17% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 5.17% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.45% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 3.45% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 2.59% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 2.59% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.59% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 1.72% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 1.72% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.72% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.72% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.72% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.86% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.86% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.86% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.86% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.86% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.86% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine Estuarine | 0.86% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine | 0.86% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 0.86% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.86% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.86% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.86% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2236876005 | Estuarine microbial communities from Columbia River, sample from South Channel ETM site, GS313-3LG-ETM-15m | Environmental | Open in IMG/M |
| 2236876010 | Marine microbial communities from Columbia River, CM, sample from Newport Hydroline, GS310-0p1-Hyp-75m | Environmental | Open in IMG/M |
| 3300000128 | Marine microbial communities from chronically polluted sediments in Adventfjord, Norway : sample - Svalbard Archipelago station 1 sample NOR 08_45m | Environmental | Open in IMG/M |
| 3300000224 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 10m | Environmental | Open in IMG/M |
| 3300000928 | Marine plume microbial communities from the Columbia River - 25 PSU | Environmental | Open in IMG/M |
| 3300001344 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 | Environmental | Open in IMG/M |
| 3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
| 3300003580 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA | Environmental | Open in IMG/M |
| 3300004113 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (version 2) | Environmental | Open in IMG/M |
| 3300005589 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 | Environmental | Open in IMG/M |
| 3300005824 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.180_BBC | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
| 3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007862 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2um | Environmental | Open in IMG/M |
| 3300008470 | Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563 | Environmental | Open in IMG/M |
| 3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
| 3300009024 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 | Environmental | Open in IMG/M |
| 3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009442 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 | Environmental | Open in IMG/M |
| 3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009601 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38 | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300011125 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, permeate | Environmental | Open in IMG/M |
| 3300011253 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate | Environmental | Open in IMG/M |
| 3300011257 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_3, 0.2 | Environmental | Open in IMG/M |
| 3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
| 3300011261 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, 0.02 | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022221 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300022308 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022913 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_2_MG | Environmental | Open in IMG/M |
| 3300023089 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_11_MG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300024191 | Seawater microbial communities from Monterey Bay, California, United States - 45D | Environmental | Open in IMG/M |
| 3300024229 | Seawater microbial communities from Monterey Bay, California, United States - 54D | Environmental | Open in IMG/M |
| 3300024242 | Seawater microbial communities from Monterey Bay, California, United States - 91D | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300024281 | Seawater microbial communities from Monterey Bay, California, United States - 11D | Environmental | Open in IMG/M |
| 3300024292 | Seawater microbial communities from Monterey Bay, California, United States - 37D | Environmental | Open in IMG/M |
| 3300024294 | Seawater microbial communities from Monterey Bay, California, United States - 78D | Environmental | Open in IMG/M |
| 3300024314 | Seawater microbial communities from Monterey Bay, California, United States - 70D | Environmental | Open in IMG/M |
| 3300024332 | Seawater microbial communities from Monterey Bay, California, United States - 73D | Environmental | Open in IMG/M |
| 3300024413 | Seawater microbial communities from Monterey Bay, California, United States - 21D | Environmental | Open in IMG/M |
| 3300024420 | Seawater microbial communities from Monterey Bay, California, United States - 40D | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025621 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300025636 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025640 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes) | Environmental | Open in IMG/M |
| 3300025809 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes) | Environmental | Open in IMG/M |
| 3300025832 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 (SPAdes) | Environmental | Open in IMG/M |
| 3300025860 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 (SPAdes) | Environmental | Open in IMG/M |
| 3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
| 3300026453 | Seawater microbial communities from Monterey Bay, California, United States - 56D | Environmental | Open in IMG/M |
| 3300026460 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 85R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026470 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026471 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 77R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026505 | Seawater microbial communities from Monterey Bay, California, United States - 59D | Environmental | Open in IMG/M |
| 3300026517 | Seawater microbial communities from Monterey Bay, California, United States - 8D | Environmental | Open in IMG/M |
| 3300027186 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 (SPAdes) | Environmental | Open in IMG/M |
| 3300027189 | Estuarine microbial communities from the Columbia River estuary - High salinity metaG S.579 (SPAdes) | Environmental | Open in IMG/M |
| 3300027196 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 (SPAdes) | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300028008 | Seawater microbial communities from Monterey Bay, California, United States - 1D_r | Environmental | Open in IMG/M |
| 3300028109 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028126 | Seawater microbial communities from Monterey Bay, California, United States - 60D | Environmental | Open in IMG/M |
| 3300028273 | Seawater microbial communities from Monterey Bay, California, United States - 51D | Environmental | Open in IMG/M |
| 3300028280 | Seawater microbial communities from Monterey Bay, California, United States - 58D | Environmental | Open in IMG/M |
| 3300028416 | Seawater microbial communities from Monterey Bay, California, United States - 15D | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031658 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78 | Environmental | Open in IMG/M |
| 3300031689 | Marine microbial communities from water near the shore, Antarctic Ocean - #280 | Environmental | Open in IMG/M |
| 3300031703 | Marine microbial communities from water near the shore, Antarctic Ocean - #34 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| none_0079291 | 2236876005 | Marine Estuarine | VLAAESAGKRSIYAPGYFTMVGNDIISKVNDMTVKEYQD |
| none_05102361 | 2236876010 | Marine Estuarine | KDVLAAEADGKRSIYAPGYFTLVGNEIIDKVNSMTLKKYQD |
| SA_S1_NOR08_45mDRAFT_100333621 | 3300000128 | Marine | ESEKDVLAVEADGKRSIYAPGYFTMVGNEIIDKVNSMTLKKYQD* |
| SI34jun09_10mDRAFT_10087881 | 3300000224 | Marine | IEEAEKDVLAAETDGKRSIYAPGYFTMVGNEIIDKVNSMTLKKYKD* |
| OpTDRAFT_100504048 | 3300000928 | Freshwater And Marine | EKDVLAAEADGKRSIYAPGYFTMVGNEIIDKVNRMTLKRYQD* |
| JGI20152J14361_100690141 | 3300001344 | Pelagic Marine | QTALKSAIEQAEEDVLAAEADGKRSIYAPGYFTMVGNDIIDKVNSMTLKKHQD* |
| JGI20152J14361_100900641 | 3300001344 | Pelagic Marine | ALKSAIEQAEEDVLAAEADGKRSIYAPGYFTLVGNEIIDKVNSMTLKKYQD* |
| JGI20152J14361_101125611 | 3300001344 | Pelagic Marine | ADGKRSIYAPGYFTLVGNEIIDKVNSMTLKKYQD* |
| JGI20157J14317_101876001 | 3300001352 | Pelagic Marine | LAAEADGKRSIYAPGYFTLVGNEIIDKVNSMTLKKYQD* |
| JGI26260J51721_10155781 | 3300003580 | Marine | LKNAIEEAEQDIKRLVSEGKRPIYAEGYFTMVGNEIIDKVNSMTLKKYQD* |
| Ga0065183_105212623 | 3300004113 | Pelagic Marine | AIEQAEEDVLAAEADGKRSIYAPGYFTMVGNDIIDKVNSMTLKKYQD* |
| Ga0070729_100710698 | 3300005589 | Marine Sediment | IKRLVSEGKRPIYAEGYFTMVGGDIIDKVNDMTLKKYQD* |
| Ga0074474_12198355 | 3300005824 | Sediment (Intertidal) | AEADGKRSIYAPGYFTMVGNEIIDKVNSMTLKKYKD* |
| Ga0078893_119250915 | 3300005837 | Marine Surface Water | EAESDVLATESAGKRSLYAPGYFTSVGNEIIDKVNSMTLKKYQD* |
| Ga0078893_146982912 | 3300005837 | Marine Surface Water | YFIQTALRSAIEQAELDVLAAESNGKRLMYAPGYFTSVGGEIIDKVN |
| Ga0075447_101642484 | 3300006191 | Marine | LKQAIEQAEEDVLAVEADGKRSIYAPGYFTLVGNEMINKINDMTLKRHQD* |
| Ga0075445_103003833 | 3300006193 | Marine | TDGKRSIYAPGYFTMVGNEIIDKVNSMTLKKYQD* |
| Ga0099972_119828058 | 3300006467 | Marine | EADGKRSIYAPGYFTMVGNEIIDKVNSMTLKKYQD* |
| Ga0070744_100309456 | 3300006484 | Estuarine | SEGKRPIYAEGYFTLVGNEIINKVNDMTLKKFQD* |
| Ga0098054_11953271 | 3300006789 | Marine | TALKAAIEQAEEDVTRLVSEGKRPIYAEGYFTLVSNEIIDKVNDMTLKKYQD* |
| Ga0070749_1001994312 | 3300006802 | Aqueous | RHAIEEAEKDVLAAEADGKRSIYAPGYFTLVGNEIIDKVNSMTLKKYQD* |
| Ga0070754_100343918 | 3300006810 | Aqueous | KNAIEEAEQDIKRLVSEGKRPIYAEGYFTMVGSDIIDKVNDMTLKKYQD* |
| Ga0098050_10382316 | 3300006925 | Marine | SEGKRPIYAEGYFTMVGNEIIDKVNDMTLKKYQD* |
| Ga0070747_13194481 | 3300007276 | Aqueous | KAAIEQAEEDVLAAETDGKRSIYAPGYFTMVGNEIIDKVNSMTLKKYQD* |
| Ga0099847_12304671 | 3300007540 | Aqueous | AERDVLAAEADGNRSLYAPGYFTNVGNEIINKVNSMTLKKFQD* |
| Ga0105737_10073471 | 3300007862 | Estuary Water | KHAIEEAEKDVLAAEADGKRSIYAPGYFTMVGNEIIDKVNSMTLKKYQD* |
| Ga0115371_108872884 | 3300008470 | Sediment | DVLEAQATGKRVIYAPGYFTLVGNEIIDKVHSMTLKKDQ* |
| Ga0102816_10727995 | 3300008999 | Estuarine | LRHAIEEAEKDILAAEAEGKRSIYAPGYFTMVGNEIIHKVNRMTLKKHQD* |
| Ga0102816_12544323 | 3300008999 | Estuarine | LAAESAGKRSIYAPGYFTMVGNEIIHKVNRMTLKKYQD* |
| Ga0102811_13342741 | 3300009024 | Estuarine | DVLAAEADGKRPIYAPGYFTMVGNEIIHKVNRMTLKRYQD* |
| Ga0115550_12204221 | 3300009076 | Pelagic Marine | QAEEDVLAAEADGKRSIYAPGYFTMVGNDIIDKVNSMTLKKYQD* |
| Ga0102814_102171571 | 3300009079 | Estuarine | HAIEEAEKDVLAAEADGKRSIYAPGYFTMVGNEIIDKVNSMTLKKYQD* |
| Ga0115547_12760051 | 3300009426 | Pelagic Marine | SAIEQAEEDVLAAEADGKRSIYAPGYFTLVGNEIIDKVNSMTLKKYQD* |
| Ga0115547_12920051 | 3300009426 | Pelagic Marine | KSAIEQAEEDVLAAEADGKRSIYAPGYFTMVGNDIIDKVNSMTLKKYQD* |
| Ga0114915_11617911 | 3300009428 | Deep Ocean | EEAEQDVLAAETDGKRSIYAPGYFTMVGNEIIDKVNSMTLKKYQD* |
| Ga0115563_11778904 | 3300009442 | Pelagic Marine | AAEADGKRSIYAPGYFTMVGNDIIDKVNSMTLKKYQD* |
| Ga0115570_103090531 | 3300009496 | Pelagic Marine | TALRSAIEQAELDVLAAESEGKRSIYAPGYFSMVGNEIIHKVNRMTLKKYQD* |
| Ga0115572_103344861 | 3300009507 | Pelagic Marine | ESNGKRVIFAPGYFTMVGNEIIDKVNSMTLKKFQD* |
| Ga0114914_10606783 | 3300009601 | Deep Ocean | AVEADGKRSIYAPGYFTLVGNEMINKINDMTLKKHQD* |
| Ga0098056_10968231 | 3300010150 | Marine | AAEADGKRSIYAPGYFTLVGNEIIDKVNSMTLKKYQD* |
| Ga0098056_12837621 | 3300010150 | Marine | TALKHAIEEAEKDVLAAEADGKRSIYAPGYFTMVGNEIIDKVNSMTLKKYQD* |
| Ga0129324_103779763 | 3300010368 | Freshwater To Marine Saline Gradient | KDVLAAEADGKRSIYAPGYFTMVGNEIIDKVNSMTLKKYQD* |
| Ga0114922_110229554 | 3300011118 | Deep Subsurface | AAEADGKRSIYAPGYFTMVGNEIIDKVNSMTLKKYQD* |
| Ga0151663_10047531 | 3300011125 | Marine | VLAAESAGNRYIYAPGYFTMVGNEIIDKVNSMTLKKYKD* |
| Ga0151671_11331481 | 3300011253 | Marine | EEAEKDVLAAEADGKRSIYAPGYFTLVGNEIIDKVNSMTLKKYKD* |
| Ga0151658_11409951 | 3300011257 | Marine | RHAIEEAEKDILAAEAKGKRSIYAPGYFTMVGNEIIHKVNRMTLKKHQD* |
| Ga0151677_10931961 | 3300011258 | Marine | HAIEEAEKDILAAEAKGKRSIYAPGYFTMVGNEIIHKVNRMTLKKHQE* |
| Ga0151661_11465143 | 3300011261 | Marine | EVDVLAAESAGNRSIYAPGYFTMVGTEIIDKVNSMTLKKFQD* |
| Ga0181387_11306203 | 3300017709 | Seawater | EDVKELISEGKRPLYSEGYFTMVGNEILDKVNSMTLKKYQD |
| Ga0181401_11483013 | 3300017727 | Seawater | DVLAAEADGKRSIYAPGYFTMVGNEIINKVNSMTLKKFQD |
| Ga0181431_10522154 | 3300017735 | Seawater | QTALKNAIEEAEQDIKRLVSEGKRPIYAEGYFTMVGNEIIDKVNSMTLKKYQD |
| Ga0206125_101144391 | 3300020165 | Seawater | EATGKRSIYAPGYFTMVGNEIIDKINSMTLKKYQD |
| Ga0206129_1001356320 | 3300020182 | Seawater | AIEQAELDVLAAESEGKRSIYAPGYFSMVGNEIIHKVNRMTLKKYQD |
| Ga0206131_1001881316 | 3300020185 | Seawater | TESAGKRSLYAPGYFTMVGNEIIDKVNSMTLKKHQD |
| Ga0206130_102513314 | 3300020187 | Seawater | ERAEAQLLAHQSAGSRTLYAPGYFVTVGQQVINKVNSMTLKKYQD |
| Ga0206130_104415323 | 3300020187 | Seawater | AAEVDGKRSIYAPGYFTMVGNEIIDKVNSMTLKKYQD |
| Ga0206126_102662515 | 3300020595 | Seawater | KYECKRSLYGPGYFTMVGNEILDKVNNMTLKKYQD |
| Ga0222716_104900884 | 3300021959 | Estuarine Water | DVKELISEGKRPLYSEGYFTMVGNEILDKVNSMTLKKYQD |
| Ga0222716_105014761 | 3300021959 | Estuarine Water | DVLAAEADGKRSIYAPGYFTMVGNEIIDKVNSMTLKKYQD |
| Ga0196889_11048093 | 3300022072 | Aqueous | KSAIEQAEEDVLAAEADGKRSIYAPGYFTMVGNEIIDKVNSMTLKKFQD |
| Ga0196887_10658861 | 3300022178 | Aqueous | IEQAEEDVLAAETDGKRSIYAPGYFTMVGNEIIDKVNSMTLKKYQD |
| Ga0224506_103996883 | 3300022221 | Sediment | LATESEGKRSLYAPGYFTMVGNEIIDKVNSMTLKKYQD |
| Ga0224504_100433677 | 3300022308 | Sediment | QAEQDVKELISEGKRPLYSEGYFTMVGNEILDKVNSMTLKKYKD |
| (restricted) Ga0233404_100577394 | 3300022913 | Seawater | HAIEEAEKDVLAAEADGKRSIYAPGYFTMVGNEIIDKVNSMTLKRYQD |
| (restricted) Ga0233408_100477241 | 3300023089 | Seawater | VSEGKRPIYAEGYFTMVGGDIIDKVNDMTLKKYQD |
| (restricted) Ga0233412_101671305 | 3300023210 | Seawater | DVLAAEADGKRSIYAPGYFTMVGNEIIKKVNHMTLKKHQD |
| (restricted) Ga0233412_102149111 | 3300023210 | Seawater | HAIEEAEKDVLAVEAEGKRSIYAPGYFTMVGNEIINKVNDMTLKKYQD |
| (restricted) Ga0255039_104515603 | 3300024062 | Seawater | AIEQAEEDIKAAEADGKRPIYAQGYFTMVGNEIIDKVNDMTLKKYKD |
| Ga0228636_10848301 | 3300024191 | Seawater | EEDVKELISEGKRPLYSEGYFTMVGNEILDKVNSMTLKKYQD |
| Ga0233402_11027483 | 3300024229 | Seawater | VLAAEADGKRSIYAPGYFTLVGNEIIDKVNSMTLKKYQD |
| Ga0228673_10003851 | 3300024242 | Seawater | ISEGKRPLYSEGYFTMVGNEILDKVNSMTLKKYQD |
| Ga0228673_10566951 | 3300024242 | Seawater | AEEDVKELISEGKRPLYSEGYFTMVGNEILDKVNSMTLKKYQD |
| (restricted) Ga0233444_101426161 | 3300024264 | Seawater | DVLAAEADGKRSIYAPGYFTLVGNEIIDKVNSMTLKKYQD |
| Ga0228610_10074331 | 3300024281 | Seawater | EAEKDVLAAEADGKRSIYAPGYFTMVGNEIIDKVNSMTLKKYQD |
| Ga0228630_11033481 | 3300024292 | Seawater | EADGKRSIFAQGYFTMVGNEIIDKVNDMTLKKYQD |
| Ga0228664_10031101 | 3300024294 | Seawater | YAIEEAEKDVLAAEATGKRSIYAPGYFTMVGNEIIDKINSMTLKKYQD |
| Ga0228657_10771701 | 3300024314 | Seawater | DVLATESEGKRSLYAPGYFTMVGNEIIDKVNSMTLKKYQD |
| Ga0228659_10493091 | 3300024332 | Seawater | AIIEAEEDIKRLVSEGKRPIYAEGYFTMVGNEIIDKVNDMTLKKYQD |
| Ga0233393_10134756 | 3300024413 | Seawater | VLAAEAEGKRSIYAPGYFTLVGNEIIDKVNSMTLKKYQD |
| Ga0228632_11108941 | 3300024420 | Seawater | EADGKRSIYAPGYFTLVGNEIIDKVNSMTLKKYQD |
| Ga0208298_10364931 | 3300025084 | Marine | LKHAIEEAEKDVLAAEADGKRSIYAPGYFTLVGNEIIDKVNNMTLKKYQD |
| Ga0208792_10309535 | 3300025085 | Marine | EEDIKRLVSEGKRPIYAEGYFTLVGNEIIDKVNDMTLKKYQD |
| Ga0208814_11307493 | 3300025276 | Deep Ocean | EADGKRSIYAPGYFTLVGNEMINKINDMTLKKHQD |
| Ga0209504_10083236 | 3300025621 | Pelagic Marine | LKHAIEQAEEDVLAAEADGKRSIYAPGYFTMVGNDIIDKVNSMTLKKYQD |
| Ga0209504_10424607 | 3300025621 | Pelagic Marine | AAEADGKRSIYAPGYFTMVGNEIIEKVNSMTLKKYQD |
| Ga0209716_101338810 | 3300025626 | Pelagic Marine | LKSAIEQAEEDVLAAEADGKRSIYAPGYFTMVGNDIIDKVNSMTLKKYQD |
| Ga0209194_10944294 | 3300025632 | Pelagic Marine | EAEKDVLAAEATGKRSIYAPGYFTMVGNEIIDKINSMTLKKYQD |
| Ga0209136_10648104 | 3300025636 | Marine | TALRHAIEEAEKDVLAAEADGKRSIYAPGYFTMVGNEIIDKVNSMTLKKYKD |
| Ga0209198_11515481 | 3300025640 | Pelagic Marine | EEDVLAAEADGKRSIYAPGYFTMVGNDIIDKVNSMTLKKYQD |
| Ga0209199_11885201 | 3300025809 | Pelagic Marine | EADGKRSIYAPGYFTMVGNEIIDKVNSMTLKKYQD |
| Ga0209307_11842953 | 3300025832 | Pelagic Marine | LKSAIEQAEEDVLAAEADGKRSIYAPGYFTMVGNEIIDKVNSMTLKKYQD |
| Ga0209119_10579111 | 3300025860 | Pelagic Marine | EADGKRSIYAPGYFTMVGNDIIDKVNSMTLKKYQD |
| Ga0209534_104187613 | 3300025880 | Pelagic Marine | IQTALKSAIEQAEEDVLAAEADGKRSIYAPGYFTMVGNEIIDKVNSMTLKKYQD |
| Ga0228644_10387721 | 3300026453 | Seawater | LISEGKRPLYSEGYFTMVGNEILDKVNSMTLKKYQD |
| Ga0247604_10381521 | 3300026460 | Seawater | ATESEGKRSLYAPGYFTMVGNEIIDKVNSMTLKKFQD |
| Ga0247599_10902121 | 3300026470 | Seawater | AAEADGKRFIYAPGYFTLVGNEIIDKVNSMTLKKYQD |
| Ga0247602_10184961 | 3300026471 | Seawater | IEQAEVDVLAAESNGKRSIYAPGYFTMVGNEIIDKVNSMTLKKYQD |
| Ga0228647_10344575 | 3300026505 | Seawater | EVDVLAAESNGKRSIYAPGYFTMVGNEIIDKVNSMTLKKYQD |
| Ga0228607_11337153 | 3300026517 | Seawater | VLAAESNGKRSIYAPGYFTMVGNEIIDKVNSMTLKKFQD |
| Ga0208797_10494913 | 3300027186 | Estuarine | ALRHAIEEAEKDVLAAEADGKRSIYAPGYFTMVGNEIIDKVNRMTLKKYQD |
| Ga0208675_10342111 | 3300027189 | Estuarine | LAAESAGKRSIYAPGYFTMVGNEIIHKVNRMTLKKHQD |
| Ga0208438_10430151 | 3300027196 | Estuarine | LKHAIEEAEKDVLAAEADGKRSIYAPGYFTMVGNEIIDKVNSMTLKKYQD |
| (restricted) Ga0233415_101898161 | 3300027861 | Seawater | IKQAEQDVKELISEGKRPLYSEGYFTMVGNEIIDKVNSMTLKKYQD |
| Ga0228674_12070583 | 3300028008 | Seawater | IKRLVSEGKRPIYAEGYFTMVGNEIIDKVNDMTLKKYQD |
| Ga0228674_12803741 | 3300028008 | Seawater | TDVLATESEGKRSLYAPGYFTMVGNEIIDKVNSMTLKKYQD |
| Ga0247582_11257963 | 3300028109 | Seawater | LKNAIEEAESDIKRLVSEGKRPIYAEGYFTMVGNDIIDKVNDMTLKKYQD |
| Ga0228648_10096396 | 3300028126 | Seawater | EVDVLAAESNGKRSIYAPGYFTMVCNEIIDKVNSMTLKKYQD |
| Ga0228648_10741003 | 3300028126 | Seawater | TALKAAIEQAEVDVLAAKSNGKNVIYAPGYFTMVGNEIIDKVNSMTLKKYQD |
| Ga0228640_10381881 | 3300028273 | Seawater | EEDVKKLVNEGKRPLYSEGYFTMVGNEILDKVNSMTLKKYQD |
| Ga0228646_10775094 | 3300028280 | Seawater | ALKHAIEQAEVDVLAAESNGKRSIYAPGYFTMVGNEIIDKVNSMTLKKYQD |
| Ga0228614_10261165 | 3300028416 | Seawater | QTALKHAIEEAEKDVLAAEADGKRSIYAPGYFTLVGNEIIDKVNSMTLKKYQD |
| Ga0307488_104754105 | 3300031519 | Sackhole Brine | EADGKRSIYAPGYFTMVGKEIISKVNDMTLKKYQDVE |
| Ga0307984_10462791 | 3300031658 | Marine | EKEGKNMIYAPGYFTMVGEELLEKVDSMTLKKDRV |
| Ga0308017_10608901 | 3300031689 | Marine | EQDGKRPIFAQGYFTMVGKELIEKVNSMTLKKDQKQ |
| Ga0308017_11314053 | 3300031689 | Marine | EADGKRSIYAPGYFTLVGNEMINKINYMTLKKHQD |
| Ga0308002_11369063 | 3300031703 | Marine | IEADGKRSIYAPGYFTLVGNEMINKINDMTLKKHQD |
| ⦗Top⦘ |