


| Basic Information | |
|---|---|
| Family ID | F078901 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 46 residues |
| Representative Sequence | TLYVWQAKTKVPVGRFNKVEFSDGTVMRDTQTGADDGGRADTDVRQ |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.86 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.10 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.103 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (12.069 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.586 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.793 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 28.38% Coil/Unstructured: 71.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF00652 | Ricin_B_lectin | 6.90 |
| PF07859 | Abhydrolase_3 | 3.45 |
| PF13620 | CarboxypepD_reg | 3.45 |
| PF13418 | Kelch_4 | 1.72 |
| PF00593 | TonB_dep_Rec | 1.72 |
| PF04679 | DNA_ligase_A_C | 1.72 |
| PF00753 | Lactamase_B | 1.72 |
| PF00106 | adh_short | 0.86 |
| PF02276 | CytoC_RC | 0.86 |
| PF04542 | Sigma70_r2 | 0.86 |
| PF01193 | RNA_pol_L | 0.86 |
| PF01593 | Amino_oxidase | 0.86 |
| PF01575 | MaoC_dehydratas | 0.86 |
| PF00596 | Aldolase_II | 0.86 |
| PF08327 | AHSA1 | 0.86 |
| PF12852 | Cupin_6 | 0.86 |
| PF07995 | GSDH | 0.86 |
| PF05988 | DUF899 | 0.86 |
| PF07883 | Cupin_2 | 0.86 |
| PF13442 | Cytochrome_CBB3 | 0.86 |
| PF01507 | PAPS_reduct | 0.86 |
| PF13365 | Trypsin_2 | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 3.45 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 1.72 |
| COG0202 | DNA-directed RNA polymerase, alpha subunit/40 kD subunit | Transcription [K] | 0.86 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.86 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.86 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.86 |
| COG1761 | DNA-directed RNA polymerase, subunit L/RPAC2 | Transcription [K] | 0.86 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.86 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.86 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.10 % |
| Unclassified | root | N/A | 6.90 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_106162536 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300000956|JGI10216J12902_102188469 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 544 | Open in IMG/M |
| 3300003995|Ga0055438_10237782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300004156|Ga0062589_100429017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1086 | Open in IMG/M |
| 3300004156|Ga0062589_102226162 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300004157|Ga0062590_102314792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300004480|Ga0062592_102532358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300005166|Ga0066674_10170468 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1032 | Open in IMG/M |
| 3300005178|Ga0066688_10811381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300005332|Ga0066388_104427667 | Not Available | 716 | Open in IMG/M |
| 3300005367|Ga0070667_102170556 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300005441|Ga0070700_100443416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 986 | Open in IMG/M |
| 3300005451|Ga0066681_10743023 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300005466|Ga0070685_10341597 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300005471|Ga0070698_101817704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300005518|Ga0070699_101257882 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300005545|Ga0070695_101905786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300005568|Ga0066703_10697971 | Not Available | 584 | Open in IMG/M |
| 3300005718|Ga0068866_11273508 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300005764|Ga0066903_108490324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300006196|Ga0075422_10079288 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1232 | Open in IMG/M |
| 3300006358|Ga0068871_100380558 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
| 3300006800|Ga0066660_11361944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300006844|Ga0075428_100316740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1676 | Open in IMG/M |
| 3300006845|Ga0075421_101513107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300006852|Ga0075433_10757063 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300006903|Ga0075426_11427058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300006903|Ga0075426_11460802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300006914|Ga0075436_100166934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_60_22 | 1553 | Open in IMG/M |
| 3300006969|Ga0075419_11038698 | Not Available | 598 | Open in IMG/M |
| 3300009012|Ga0066710_100897263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1364 | Open in IMG/M |
| 3300009038|Ga0099829_10508259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1000 | Open in IMG/M |
| 3300009038|Ga0099829_11612601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300009100|Ga0075418_10042207 | All Organisms → cellular organisms → Bacteria | 4924 | Open in IMG/M |
| 3300009147|Ga0114129_13273146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300009156|Ga0111538_10079109 | All Organisms → cellular organisms → Bacteria | 4184 | Open in IMG/M |
| 3300009156|Ga0111538_12725888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300009156|Ga0111538_13053035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300009162|Ga0075423_12078186 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300009167|Ga0113563_11971727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300009610|Ga0105340_1149605 | Not Available | 962 | Open in IMG/M |
| 3300009810|Ga0105088_1082558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300010038|Ga0126315_10629965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
| 3300010322|Ga0134084_10448999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300010323|Ga0134086_10366468 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300010333|Ga0134080_10388572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300010362|Ga0126377_11793700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
| 3300010398|Ga0126383_13506214 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300010403|Ga0134123_13072415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300011120|Ga0150983_10941580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300011120|Ga0150983_14216379 | Not Available | 544 | Open in IMG/M |
| 3300011414|Ga0137442_1146263 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300011430|Ga0137423_1158306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
| 3300011431|Ga0137438_1102000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 873 | Open in IMG/M |
| 3300012133|Ga0137329_1057984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300012137|Ga0137346_1012473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 952 | Open in IMG/M |
| 3300012202|Ga0137363_10563279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 960 | Open in IMG/M |
| 3300012225|Ga0137434_1075428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300012360|Ga0137375_11143561 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300012912|Ga0157306_10074493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 921 | Open in IMG/M |
| 3300012922|Ga0137394_10181948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1793 | Open in IMG/M |
| 3300012931|Ga0153915_13050222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300014166|Ga0134079_10586424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300014269|Ga0075302_1167360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300014325|Ga0163163_12277485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 601 | Open in IMG/M |
| 3300014862|Ga0180096_1015256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300015371|Ga0132258_10092520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 7099 | Open in IMG/M |
| 3300015372|Ga0132256_100574027 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300015372|Ga0132256_101874588 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300015373|Ga0132257_100832047 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300015373|Ga0132257_101234787 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300015374|Ga0132255_105352943 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300015374|Ga0132255_106111029 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300017792|Ga0163161_12051048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300017930|Ga0187825_10403216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300017936|Ga0187821_10277452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300018077|Ga0184633_10321869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 785 | Open in IMG/M |
| 3300019248|Ga0180117_1314082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 820 | Open in IMG/M |
| 3300020198|Ga0194120_10359710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
| 3300020583|Ga0210401_10021385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6204 | Open in IMG/M |
| 3300021051|Ga0206224_1019014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 807 | Open in IMG/M |
| 3300021362|Ga0213882_10412329 | Not Available | 572 | Open in IMG/M |
| 3300021420|Ga0210394_10074764 | All Organisms → cellular organisms → Bacteria | 2931 | Open in IMG/M |
| 3300022504|Ga0242642_1030456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 778 | Open in IMG/M |
| 3300022525|Ga0242656_1030426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 859 | Open in IMG/M |
| 3300022529|Ga0242668_1098322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300022717|Ga0242661_1037950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 858 | Open in IMG/M |
| 3300025555|Ga0210121_1028728 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300025901|Ga0207688_10179778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1261 | Open in IMG/M |
| 3300025921|Ga0207652_10456956 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300025931|Ga0207644_10162120 | All Organisms → cellular organisms → Bacteria | 1739 | Open in IMG/M |
| 3300025942|Ga0207689_10859366 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300025960|Ga0207651_10359073 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
| 3300025960|Ga0207651_10884244 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300026089|Ga0207648_11469865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300026116|Ga0207674_11602025 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300026550|Ga0209474_10403753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300027674|Ga0209118_1096727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 836 | Open in IMG/M |
| 3300027765|Ga0209073_10449218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300027835|Ga0209515_10027856 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4997 | Open in IMG/M |
| 3300027869|Ga0209579_10388635 | Not Available | 756 | Open in IMG/M |
| 3300027882|Ga0209590_10882430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300027917|Ga0209536_100490676 | Not Available | 1533 | Open in IMG/M |
| 3300027965|Ga0209062_1219147 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300028885|Ga0307304_10240265 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 786 | Open in IMG/M |
| 3300031231|Ga0170824_124509997 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
| 3300031455|Ga0307505_10098798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1309 | Open in IMG/M |
| 3300031538|Ga0310888_10034477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2262 | Open in IMG/M |
| 3300031547|Ga0310887_10688026 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300031716|Ga0310813_10051615 | All Organisms → cellular organisms → Bacteria | 3031 | Open in IMG/M |
| 3300031720|Ga0307469_10864390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 835 | Open in IMG/M |
| 3300031720|Ga0307469_11645864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300031965|Ga0326597_11575397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 627 | Open in IMG/M |
| 3300032180|Ga0307471_101120089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 953 | Open in IMG/M |
| 3300033412|Ga0310810_11350182 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300034149|Ga0364929_0098065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 922 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.07% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 6.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.17% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.17% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.31% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.45% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.59% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.59% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.72% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.72% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.72% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.86% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.86% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.86% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.86% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.86% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.86% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.86% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.86% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.86% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.86% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.86% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.86% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.86% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.86% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003995 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
| 3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
| 3300011431 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2 | Environmental | Open in IMG/M |
| 3300012133 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT121_2 | Environmental | Open in IMG/M |
| 3300012137 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT560_2 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012225 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2 | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014269 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014862 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_1Da | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300019248 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020198 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021051 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1 | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025555 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027965 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1061625361 | 3300000955 | Soil | TRTTLNYGDVVTLYVWQAKTKVPVGRFNKVIFSDGTTMRDTQTGADDGGRADTDVRQ |
| JGI10216J12902_1021884692 | 3300000956 | Soil | QPGDVVTLYVWQAKTGALVGRFNKVDFPDGTTMRDSQTGADDGGRADTGVRQ* |
| Ga0055438_102377821 | 3300003995 | Natural And Restored Wetlands | VVTLYVWQAKTRLPVGRFNKVEFSDGTTMRDTQTGADDGGRADTGVRQ* |
| Ga0062589_1004290172 | 3300004156 | Soil | QAKTKEPVGRFNKVEFSDGTVLRDTQRGADDGGRADTGVRQ* |
| Ga0062589_1022261622 | 3300004156 | Soil | VWQAKTKLPVGRFNKVEFSDGTVMRDTQTGADDGGRADTDVRQ* |
| Ga0062590_1023147922 | 3300004157 | Soil | RTTIQPGDIVTLYVWQAKTGNLVGRFNKVDFPDGTTMRDSQTGADDGSRADTGVRQ* |
| Ga0062592_1025323581 | 3300004480 | Soil | GDVVTLYVWAAKTGAHAGRFNKVDFPDGTTMRDTQTGGDDGGRADTGVRQ* |
| Ga0066674_101704681 | 3300005166 | Soil | DVVTLYVWQAKTRAPVGRFNKVVFADGSTMRDTQTGADDGGRADTDVGR* |
| Ga0066688_108113811 | 3300005178 | Soil | VVTLYVWPAKTKLPVGRFNKVIFSDGTTMRDTQTGADDGGRADTDVRQ* |
| Ga0066388_1044276672 | 3300005332 | Tropical Forest Soil | KTKATVGRFNKVVLADGTIMRDTQTGADDGGRADTDVGR* |
| Ga0070667_1021705561 | 3300005367 | Switchgrass Rhizosphere | DVVTLYVWQAKTRKPVGRFNKVVFADGSTMRDTQTGADDGTRADTEVGRGGH* |
| Ga0070700_1004434161 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | GSLAAGDVVTLYVWQAKTKEPVGRFNKVEFSDGTVLRDTQRGADDGGRADTGVRQ* |
| Ga0066681_107430232 | 3300005451 | Soil | VTLYVWQAKTKVPVGRFNKVVFADGTTMRDTQTGADDGKRADTDVRQ* |
| Ga0070685_103415971 | 3300005466 | Switchgrass Rhizosphere | LGYGDVVTLYVWPAKTKLPVGRFNKVEFSDGTVMRDTQTGADDGGRADGDVRQ* |
| Ga0070698_1018177042 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | QTKTGAPVGRFNKVELPDGTTMRDTQTGADDGGRADTGQRN* |
| Ga0070699_1012578821 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | GDVVTLYVWQAKTKVPVGRFNKVIFSDGTTMRDTQTGADDGGRADTDVRQ* |
| Ga0070695_1019057861 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | GDVVTLYVWQAKTKAPVGRFNKVEFSDGTVMRDTQTGADDGGRADTDVRQ* |
| Ga0066703_106979711 | 3300005568 | Soil | TGLTVGRFNKVVFADGKVMRDTQTGADNGGRADTGVGR* |
| Ga0068866_112735081 | 3300005718 | Miscanthus Rhizosphere | KAPVGRFNKVEFADGTVMRDTQTGADDGGRADTEVRP* |
| Ga0066903_1084903241 | 3300005764 | Tropical Forest Soil | AKTKAPVGRFNKVEFSDGTTMRDTQTGADDGGRADTDVRQ* |
| Ga0075422_100792881 | 3300006196 | Populus Rhizosphere | RTTLSYGDVVTLYVWQAKTKAPVGRFNKVEFADGTVMRDTQTGADDGGRADTEVRP* |
| Ga0068871_1003805581 | 3300006358 | Miscanthus Rhizosphere | KTKLPVGRFNKVEFSDGTVMRDTQTGADDGGRADGDVRQ* |
| Ga0066660_113619442 | 3300006800 | Soil | LYVWQAKTKVPVGRFNKVVFADGTTMRDTQTGADDGGRADTDVRQ* |
| Ga0075428_1003167403 | 3300006844 | Populus Rhizosphere | YVWKAKTGATVGRFNKVDFADGTTMRDTQRGGDDGGRADTGVRQ* |
| Ga0075421_1015131072 | 3300006845 | Populus Rhizosphere | KVTLYVWRAKTGATVGRFNKVDFPDGTTMRDTQRGGDDGGRADTGQRN* |
| Ga0075433_107570632 | 3300006852 | Populus Rhizosphere | TKAPVGRFNKVEFSDGTTMRDTQTGADDGGRADTDVRQ* |
| Ga0075426_114270582 | 3300006903 | Populus Rhizosphere | KTKAPVGRFNKVVLADGTTMRDTQTGADDGGRADTDVGR* |
| Ga0075426_114608021 | 3300006903 | Populus Rhizosphere | VPVGRFNKVEFSDGTVMRDTQTGADDGGRADTDVRQ* |
| Ga0075436_1001669341 | 3300006914 | Populus Rhizosphere | LNYGDVVTLYVWQAKTKAPVGRFNKVIFSDGTTMRDTQTGADDGGRADTDVRQ* |
| Ga0075419_110386981 | 3300006969 | Populus Rhizosphere | AKTKAPVGRFNKVEFSDGTVMRDTQTGADDGGRADTDVRQ* |
| Ga0066710_1008972633 | 3300009012 | Grasslands Soil | GDVVTLYVWQAKTKVPVGRFNKVIFSDGTTMRDTQTGADDGGRADTDVRQ |
| Ga0099829_105082591 | 3300009038 | Vadose Zone Soil | ITVYVWQAKTRLPVGRVNKVMLADGTLLRDSQTGADNGGRADTDLR* |
| Ga0099829_116126011 | 3300009038 | Vadose Zone Soil | YGDVVTLYVWQAKTKVPVGRFNKVVFADGTTMRDTQTGADDGGRADTDVRQ* |
| Ga0075418_100422071 | 3300009100 | Populus Rhizosphere | KTGATVGRFNKVDFADGTTMRDTQRGGDDGGRADTGVRQ* |
| Ga0114129_132731462 | 3300009147 | Populus Rhizosphere | LYVWPAKTKLPVGRFNKVEFSDGTVMRDTQTGADDGGRADTDVRQ* |
| Ga0111538_100791095 | 3300009156 | Populus Rhizosphere | HAGRFNKVDLPDGTTMRDTQTGGDDGGRADTGVRQ* |
| Ga0111538_127258881 | 3300009156 | Populus Rhizosphere | TGATVGRFNKVDFPDGTTMRDTQRGGDDGGRADTGVRN* |
| Ga0111538_130530351 | 3300009156 | Populus Rhizosphere | IQPGDVVTLYVWQAKTRALVGRFNKVDFSDGTTMRDSQTGADDGSRADTGVRQ* |
| Ga0075423_120781862 | 3300009162 | Populus Rhizosphere | WQAKTKAPVGRFNKVEFSDGTTMRDTQTGADDGGRADTDVRQ* |
| Ga0113563_119717272 | 3300009167 | Freshwater Wetlands | APGDVVTLYVWQAKTGAYVGRFNKVDFPDGTTMRDTQTGADDGGRTDQGVRQ* |
| Ga0105340_11496051 | 3300009610 | Soil | AKTKEPVGRFNKVEFSDGTVLRDTQRGADDGGRADTGVRQ* |
| Ga0105088_10825582 | 3300009810 | Groundwater Sand | VTLYVWQAKTRLPVGRFNKVILADGSTMRDTQTGADDGGRADTEVGR* |
| Ga0126315_106299653 | 3300010038 | Serpentine Soil | VTLYVWRAKTGATVGRFNKVDFPDGTTMRDTQRGADDGGRTDGGVRN* |
| Ga0134084_104489991 | 3300010322 | Grasslands Soil | PVGRFNKVIFSDGTTMRDTQTGADDGGRADTDVRQ* |
| Ga0134086_103664681 | 3300010323 | Grasslands Soil | RTTLNYGDVVTLYVWQAKTKVPVGRFNKVVFADGTTMRDTQTGADDGGRADTDVRQ* |
| Ga0134080_103885721 | 3300010333 | Grasslands Soil | KVPVGRFNKVVFADGTTMRDTQTGADDGRRADTDVRQ* |
| Ga0126377_117937001 | 3300010362 | Tropical Forest Soil | KTKAPVGRFNKVEFSDGTVMRDTQTGADDGGRADTGVRQ* |
| Ga0126383_135062142 | 3300010398 | Tropical Forest Soil | VTLYVWQAKTHAPVGRFNKVILADGTTMRDTQTGADDGGRADTEVGR* |
| Ga0134123_130724152 | 3300010403 | Terrestrial Soil | LYAWQAKTRVPVGRFNKVVFSDGSTMRDTQTGADDGGRADTGQRN* |
| Ga0150983_109415801 | 3300011120 | Forest Soil | VTLYVWQAKTGLLVGRFNKVVFADGKVMRDTQTGADNGGRADTGVGR* |
| Ga0150983_142163791 | 3300011120 | Forest Soil | HLTVGRFNKVVLADGSTMRDTQTGADDGRRADTGVGR* |
| Ga0137442_11462632 | 3300011414 | Soil | TKVPVGRFNKVIFSDGTTMRDTQTGADDGGRADTDVRQ* |
| Ga0137423_11583061 | 3300011430 | Soil | WKAKTGATVGRFNKVDFADGTTMRDTQRGGDDGGRADTGLRQ* |
| Ga0137438_11020002 | 3300011431 | Soil | VTLYVWQAKTKVPVGRFNKVIFSDGTTMRDTQTGADDGGRADTDVRQ* |
| Ga0137329_10579841 | 3300012133 | Soil | DVVTLYVWKAKTGANAGRFNKVDLPDGTTMRDTQTGGDDGGRADTGLRQ* |
| Ga0137346_10124731 | 3300012137 | Soil | TRTTVAPGDVVTLYVWRAKTGAHAGRFNKVEFADGTTMRDTQTGGDDGGRADTGLRQ* |
| Ga0137363_105632791 | 3300012202 | Vadose Zone Soil | LPVGRFNKVVFADGKVMRDTQTGADNGGRADTGVGR* |
| Ga0137434_10754282 | 3300012225 | Soil | VTLYVWRAKTGAHAGRFNKVEFADGTTMRDTQTGGDEGGRADTGLRQ* |
| Ga0137375_111435611 | 3300012360 | Vadose Zone Soil | LYVWQAKTKVPVGRFNKVIFSDGTTMRDTQTGADDGGRADTDVRQ* |
| Ga0157306_100744931 | 3300012912 | Soil | VVTLYVWQAKTKEPVGRFNKVEFSDGTVLRDTQRGADDGGRADTGVRQ* |
| Ga0137394_101819482 | 3300012922 | Vadose Zone Soil | VWQAKTRVPVGRFNKVIFADGTTMRDTQTGADDGGRADTDVRQ* |
| Ga0153915_130502222 | 3300012931 | Freshwater Wetlands | AYGDVVTLYVWQAKTKLPVGRFNKVVFSDGTTMRDTQTGADDGGRADTGVRQ* |
| Ga0134079_105864241 | 3300014166 | Grasslands Soil | KAPVGRFNKVEFSDGTVMRDTQTGADDGGRADTDVRQ* |
| Ga0075302_11673602 | 3300014269 | Natural And Restored Wetlands | VTLYVWQAKTRLPVGRFNKVEFSDGTTMRDTQTGADDGGRADTGVRQ* |
| Ga0163163_122774852 | 3300014325 | Switchgrass Rhizosphere | WTRTTLGYGDVVTLYVWPAKTKLPVGRFNKVEFSDGTVMRDTQTGADDGGRADTDVRQ* |
| Ga0180096_10152562 | 3300014862 | Soil | WTRTTLAPGDVVNLYVWKAKTGAHAGRFNKVEFADGTTMRDTQTGGDDGGRTDTGVRQ* |
| Ga0132258_100925201 | 3300015371 | Arabidopsis Rhizosphere | TTLGFGDVVTLYVWPAKTKLPVGRFNKVEFSDGTVMRDTQTGADDGGRADTDVRQ* |
| Ga0132256_1005740271 | 3300015372 | Arabidopsis Rhizosphere | YGDVVTLYVWPAKTKLPVGRFNKVEFSDGTVMRDTQTGADDGGRADGDVRQ* |
| Ga0132256_1018745881 | 3300015372 | Arabidopsis Rhizosphere | TKLPVGRFNKVEFSDGTVMRDTQTGADDGGRADGDVRQ* |
| Ga0132257_1008320472 | 3300015373 | Arabidopsis Rhizosphere | GDVVTLYVWPAKTKLPVGRFNKVEFSDGTVMRDTQTGADDGGRADGDVRQ* |
| Ga0132257_1012347872 | 3300015373 | Arabidopsis Rhizosphere | GYGDVVTLYVWPAKTKLPVGRFNKVEFSDGTVMRDTQTGADDGGRADGDVRQ* |
| Ga0132255_1053529431 | 3300015374 | Arabidopsis Rhizosphere | KLPVGRFNKVEFSDGTVMRDTQTGADDGGRADTDVRQ* |
| Ga0132255_1061110292 | 3300015374 | Arabidopsis Rhizosphere | CPAKTKLPVGRFNKVEFSDGTVMRDTQTGADDGGRADTDVRQ* |
| Ga0163161_120510481 | 3300017792 | Switchgrass Rhizosphere | KAPVGRFNKVEFADGTVMRDTQTGADDGGRADTEVRP |
| Ga0187825_104032161 | 3300017930 | Freshwater Sediment | DVVTLYVWQAKTGLPVGRFNKVVFADGKVMRDTQTGADNGGRADTGVGR |
| Ga0187821_102774522 | 3300017936 | Freshwater Sediment | VTLYVWQAKTGLPVGRFNKVVFADGKVMRDTQTGADNGGRADTGVGR |
| Ga0184633_103218692 | 3300018077 | Groundwater Sediment | TLQPGDVVTLYVWQAKTGATVGRFNKVDLADGTTMRDTQRGGDDGGRADTGVRQ |
| Ga0180117_13140822 | 3300019248 | Groundwater Sediment | GVVTLYVWQAKTKVPVGRFNKVEFSDGTTMRDTQTGADDGGRADTGVRQ |
| Ga0194120_103597101 | 3300020198 | Freshwater Lake | HVGRFNKVDFADGTTMRDTQRGGDDGGRSDTGVRQ |
| Ga0210401_100213851 | 3300020583 | Soil | VTLYVWQAKTGLLVGRFNKVVFADGKVMRDTQTGADNGGRADTGVGR |
| Ga0206224_10190141 | 3300021051 | Deep Subsurface Sediment | KTGAHVGRFNKVDFADGTTMRDTQTGGDDGGRADTGLRQ |
| Ga0213882_104123291 | 3300021362 | Exposed Rock | HLPVGRFNKVLFKDGSVLRDTQTGADDGGRADTGVRN |
| Ga0210394_100747644 | 3300021420 | Soil | VVTLYVWQAKTGLLVGRFNKVVFADGKVMRDTQTGADNGGRADTGVGR |
| Ga0242642_10304561 | 3300022504 | Soil | HLTVGRFNKVVFADGTVMRDTQTGTDTGGRADTGVGR |
| Ga0242656_10304261 | 3300022525 | Soil | RSSLKPGDVVSLYVWQAKTHVTVGRFNKVVFADGTVMRDTQTGTDTGGRADTGVGR |
| Ga0242668_10983221 | 3300022529 | Soil | TSLKPGDVVTLYVWQTKNGLFVGRLNKVVFDDCTVMRDTQTGADNGGRADTGVGR |
| Ga0242661_10379502 | 3300022717 | Soil | SLYVWQAKTHVTVGRFNKVVFADGTVMRDTQTGTDTGGRADTGVGR |
| Ga0210121_10287281 | 3300025555 | Natural And Restored Wetlands | VWQAKSGEHVGRFNKVEFDDGTVLRDSQRGADDGGRSDGGLRQ |
| Ga0207688_101797783 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | KTKLPVGRFNKVEFSDGTVMRDTQTGADDGGRADTDVRQ |
| Ga0207652_104569561 | 3300025921 | Corn Rhizosphere | KTKLPVGRLNKVEFSDGTVMRDTQTGADDGGRADTGVRQ |
| Ga0207644_101621202 | 3300025931 | Switchgrass Rhizosphere | TLYVWPAKTKLPVGRFNKVEFSDGTVMRDTQTGADDGGRADTDVRQ |
| Ga0207689_108593661 | 3300025942 | Miscanthus Rhizosphere | LYVWQAKTKVPVGRFNKVEFSDGTVMRDTQTGADDGGRADTDVRQ |
| Ga0207651_103590732 | 3300025960 | Switchgrass Rhizosphere | PVGRFNKVEFSDGTVMRDTQTGADDGGRADTDVRQ |
| Ga0207651_108842443 | 3300025960 | Switchgrass Rhizosphere | YVWQAKTRVPVGRLNKVEFPDGTTMRDTQTGADDGGRADTDVRQ |
| Ga0207648_114698651 | 3300026089 | Miscanthus Rhizosphere | KAKTGATVGRFNKVDFADGTTMRDTQRGGDDGGRADTGVRQ |
| Ga0207674_116020251 | 3300026116 | Corn Rhizosphere | VVTLYVWQAKTKLPVGRLNKVEFSDGTVMRDTQTGADDGGRADTGVRQ |
| Ga0209474_104037532 | 3300026550 | Soil | QAKTKVPVGRFNKVVFADGTTMRDTQTGADDGKRADTDVRQ |
| Ga0209118_10967271 | 3300027674 | Forest Soil | WTRTTMKPGDVITLYLWKAKTGLQVGRLNKVILADGTVMRDTQTGADNGARADTGVGR |
| Ga0209073_104492182 | 3300027765 | Agricultural Soil | KQGDVVTLYVWQAKTGLTVGRFNKVVFADGKVMRDTQTGADNGGRADTGVGR |
| Ga0209515_100278561 | 3300027835 | Groundwater | LAYGDVVTLYVWQAKTRVPVGRFNKVVFADGSTMRDTQTGADDGGRADTDVGR |
| Ga0209579_103886353 | 3300027869 | Surface Soil | TIYIWKSKTGRTVGRLNKVILADGTTMRDTQTGADNGGRADTTVGR |
| Ga0209590_108824302 | 3300027882 | Vadose Zone Soil | TLYVWQAKTKVPVGRFNKVIFSDGTTMRDTQTGADDGGRADTDVRQ |
| Ga0209536_1004906762 | 3300027917 | Marine Sediment | HVGRFNKVEFDDGTVLRDSQRGADDGGRSDAGLRQ |
| Ga0209062_12191471 | 3300027965 | Surface Soil | PVGRFNKVVLADGKVMRDTQTGADNGGRADKDVGR |
| Ga0307304_102402652 | 3300028885 | Soil | DVVTLYVWQAKTRVPVGRFNKVVFADGTTMRDTQTGADDGGRADTDVRQ |
| Ga0170824_1245099971 | 3300031231 | Forest Soil | TLKPGDVVTLYVWQAKTGLTVGRFNKVVFADGKVMRDTQTGTDNGGRADTDVGR |
| Ga0307505_100987982 | 3300031455 | Soil | GDVVTLYVWQAKTGVTVGRFNKVDFSDGTTMRDTQTGGDDGGRADTGQRN |
| Ga0310888_100344773 | 3300031538 | Soil | GATVGRFNKVDFADGTTMRDTQRGGDDGGRADTGVRQ |
| Ga0310887_106880262 | 3300031547 | Soil | TLYVWQAKTKVPVGRFNKVEFSDGTVMRDTQTGADDGGRADTDVRQ |
| Ga0310813_100516151 | 3300031716 | Soil | NTLGYGDVVTLYVWPAKTKLPVGRFNKVEFSDGTVMRDTQTGADDGGRADGDVRQ |
| Ga0307469_108643901 | 3300031720 | Hardwood Forest Soil | VVTLYVWQAKTKAPVGRFNKVEFSDGTVMRDTQTGADDGGRADTDVRQ |
| Ga0307469_116458642 | 3300031720 | Hardwood Forest Soil | AKTKLPVGRFNKVEFSDGTVMRDTQTGADDGGRADTDVRQ |
| Ga0326597_115753972 | 3300031965 | Soil | EPVGRFNKVEFADGTVMRDTQRGADDGGRADVGVRD |
| Ga0307471_1011200892 | 3300032180 | Hardwood Forest Soil | GAPVGRFNKVDLPDGTTMRDTQTGADDGGRADTGQRN |
| Ga0310810_113501821 | 3300033412 | Soil | AKTKLPVGRFNKVEFSDGTVMRDTQTGADDGGRADGDVRQ |
| Ga0364929_0098065_3_161 | 3300034149 | Sediment | APGDVVNLYVWKAKTGAHAGRFNKVEFADGTTMRDTQTGGDEGGRADTGVRQ |
| ⦗Top⦘ |