


| Basic Information | |
|---|---|
| Family ID | F078528 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 44 residues |
| Representative Sequence | SEETSTISVASHGLLHRHLTPQQVRDLLSGAISHLEGGERVTAPAS |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.86 % |
| % of genes near scaffold ends (potentially truncated) | 99.14 % |
| % of genes from short scaffolds (< 2000 bps) | 90.52 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (26.724 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.172 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (62.069 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.62% β-sheet: 0.00% Coil/Unstructured: 78.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF01168 | Ala_racemase_N | 46.55 |
| PF11028 | DUF2723 | 34.48 |
| PF05103 | DivIVA | 12.07 |
| PF08264 | Anticodon_1 | 0.86 |
| PF01048 | PNP_UDP_1 | 0.86 |
| PF00133 | tRNA-synt_1 | 0.86 |
| PF01252 | Peptidase_A8 | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG0597 | Lipoprotein signal peptidase | Cell wall/membrane/envelope biogenesis [M] | 1.72 |
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.86 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.86 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.86 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.86 |
| COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.86 |
| COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.86 |
| COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002122|C687J26623_10221060 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300002558|JGI25385J37094_10051823 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
| 3300002560|JGI25383J37093_10213274 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 507 | Open in IMG/M |
| 3300002908|JGI25382J43887_10238611 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 844 | Open in IMG/M |
| 3300002909|JGI25388J43891_1058346 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300002914|JGI25617J43924_10214175 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300005093|Ga0062594_102248367 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300005166|Ga0066674_10264141 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300005167|Ga0066672_10457867 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300005171|Ga0066677_10042591 | All Organisms → cellular organisms → Bacteria | 2233 | Open in IMG/M |
| 3300005172|Ga0066683_10135590 | All Organisms → cellular organisms → Bacteria | 1507 | Open in IMG/M |
| 3300005175|Ga0066673_10155376 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1277 | Open in IMG/M |
| 3300005176|Ga0066679_10930055 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 546 | Open in IMG/M |
| 3300005179|Ga0066684_11075301 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300005186|Ga0066676_11012349 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300005340|Ga0070689_100649085 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300005450|Ga0066682_10050285 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2526 | Open in IMG/M |
| 3300005454|Ga0066687_10597466 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300005552|Ga0066701_10362719 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300005555|Ga0066692_10005041 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 5786 | Open in IMG/M |
| 3300005556|Ga0066707_10878688 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 550 | Open in IMG/M |
| 3300005557|Ga0066704_10532753 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300005559|Ga0066700_10390362 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300005560|Ga0066670_10464783 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 779 | Open in IMG/M |
| 3300005566|Ga0066693_10166217 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 836 | Open in IMG/M |
| 3300005568|Ga0066703_10514615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes | 708 | Open in IMG/M |
| 3300005569|Ga0066705_10961186 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005615|Ga0070702_100120169 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1644 | Open in IMG/M |
| 3300006791|Ga0066653_10042507 | All Organisms → cellular organisms → Bacteria | 1856 | Open in IMG/M |
| 3300006794|Ga0066658_10376286 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300006800|Ga0066660_10712975 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300006846|Ga0075430_101658129 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 525 | Open in IMG/M |
| 3300006852|Ga0075433_10055562 | All Organisms → cellular organisms → Bacteria | 3456 | Open in IMG/M |
| 3300007076|Ga0075435_101170432 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 673 | Open in IMG/M |
| 3300009089|Ga0099828_10831463 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 826 | Open in IMG/M |
| 3300009090|Ga0099827_10709152 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 870 | Open in IMG/M |
| 3300009137|Ga0066709_101759632 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 874 | Open in IMG/M |
| 3300009147|Ga0114129_12271216 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300010112|Ga0127458_1127953 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300010136|Ga0127447_1153564 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 924 | Open in IMG/M |
| 3300010320|Ga0134109_10015806 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2254 | Open in IMG/M |
| 3300010322|Ga0134084_10290130 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300010323|Ga0134086_10227611 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 704 | Open in IMG/M |
| 3300010323|Ga0134086_10509048 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 500 | Open in IMG/M |
| 3300010329|Ga0134111_10084928 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1197 | Open in IMG/M |
| 3300010333|Ga0134080_10378126 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 651 | Open in IMG/M |
| 3300010333|Ga0134080_10659549 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300010336|Ga0134071_10018103 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 2945 | Open in IMG/M |
| 3300010336|Ga0134071_10430550 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 675 | Open in IMG/M |
| 3300010364|Ga0134066_10295508 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 579 | Open in IMG/M |
| 3300010396|Ga0134126_13091448 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 502 | Open in IMG/M |
| 3300010896|Ga0138111_1065550 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 595 | Open in IMG/M |
| 3300011417|Ga0137326_1030747 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300012199|Ga0137383_10285658 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1208 | Open in IMG/M |
| 3300012201|Ga0137365_10199311 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1497 | Open in IMG/M |
| 3300012203|Ga0137399_10385268 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1168 | Open in IMG/M |
| 3300012203|Ga0137399_10430800 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300012203|Ga0137399_11198019 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 639 | Open in IMG/M |
| 3300012203|Ga0137399_11383879 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300012209|Ga0137379_11050524 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 720 | Open in IMG/M |
| 3300012210|Ga0137378_10811942 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 848 | Open in IMG/M |
| 3300012285|Ga0137370_10210064 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300012349|Ga0137387_11035765 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 587 | Open in IMG/M |
| 3300012350|Ga0137372_10597252 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 810 | Open in IMG/M |
| 3300012351|Ga0137386_10533689 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300012359|Ga0137385_11252803 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300012532|Ga0137373_10734666 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 733 | Open in IMG/M |
| 3300012925|Ga0137419_10820133 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 762 | Open in IMG/M |
| 3300012944|Ga0137410_11355979 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 617 | Open in IMG/M |
| 3300012977|Ga0134087_10061375 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1505 | Open in IMG/M |
| 3300014154|Ga0134075_10004007 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas | 5416 | Open in IMG/M |
| 3300014154|Ga0134075_10462556 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 565 | Open in IMG/M |
| 3300014326|Ga0157380_12214750 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 613 | Open in IMG/M |
| 3300014883|Ga0180086_1040645 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300015054|Ga0137420_1262021 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 933 | Open in IMG/M |
| 3300015241|Ga0137418_10485831 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 991 | Open in IMG/M |
| 3300015356|Ga0134073_10019112 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
| 3300017656|Ga0134112_10152512 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 889 | Open in IMG/M |
| 3300017659|Ga0134083_10026281 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2094 | Open in IMG/M |
| 3300017659|Ga0134083_10562436 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 517 | Open in IMG/M |
| 3300018063|Ga0184637_10748290 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 527 | Open in IMG/M |
| 3300018078|Ga0184612_10500917 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 593 | Open in IMG/M |
| 3300018433|Ga0066667_10228388 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1392 | Open in IMG/M |
| 3300018433|Ga0066667_12091294 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 523 | Open in IMG/M |
| 3300018482|Ga0066669_10551581 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1004 | Open in IMG/M |
| 3300018482|Ga0066669_10580667 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 980 | Open in IMG/M |
| 3300021080|Ga0210382_10279756 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 732 | Open in IMG/M |
| 3300025327|Ga0209751_11254259 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 537 | Open in IMG/M |
| 3300025922|Ga0207646_10955689 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 759 | Open in IMG/M |
| 3300026296|Ga0209235_1149306 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300026301|Ga0209238_1004772 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 5435 | Open in IMG/M |
| 3300026307|Ga0209469_1029906 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1838 | Open in IMG/M |
| 3300026313|Ga0209761_1256520 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300026314|Ga0209268_1067144 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1088 | Open in IMG/M |
| 3300026326|Ga0209801_1066925 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1599 | Open in IMG/M |
| 3300026328|Ga0209802_1313014 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 519 | Open in IMG/M |
| 3300026332|Ga0209803_1121935 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1041 | Open in IMG/M |
| 3300026334|Ga0209377_1119197 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1063 | Open in IMG/M |
| 3300026524|Ga0209690_1125318 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300026530|Ga0209807_1240675 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 613 | Open in IMG/M |
| 3300026532|Ga0209160_1003971 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 11945 | Open in IMG/M |
| 3300026540|Ga0209376_1036142 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 3017 | Open in IMG/M |
| 3300026548|Ga0209161_10217616 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300027324|Ga0209845_1067542 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 556 | Open in IMG/M |
| 3300027573|Ga0208454_1163523 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300027633|Ga0208988_1143594 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 577 | Open in IMG/M |
| 3300027725|Ga0209178_1295611 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300027787|Ga0209074_10388915 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300027909|Ga0209382_12029922 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300031152|Ga0307501_10168067 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 607 | Open in IMG/M |
| 3300031708|Ga0310686_115404385 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300031720|Ga0307469_12503551 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 504 | Open in IMG/M |
| 3300031740|Ga0307468_101712363 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 592 | Open in IMG/M |
| 3300031962|Ga0307479_10489970 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1213 | Open in IMG/M |
| 3300032897|Ga0335071_10429975 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300034177|Ga0364932_0031921 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1976 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 26.72% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.24% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 17.24% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 11.21% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.31% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.59% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.59% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.72% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.86% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.86% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.86% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.86% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002122 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_2 | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010112 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010136 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010896 | Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011417 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027324 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027573 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C687J26623_102210601 | 3300002122 | Soil | VVSEETSTISIASHGLLHRPLTPQQVRDLLSGAISHLEGGERVTAPA* |
| JGI25385J37094_100518233 | 3300002558 | Grasslands Soil | VVSEETSTISIASHGLLHRHLTAPQVRDLLSGAISHLEGGERVTAPAS* |
| JGI25383J37093_102132742 | 3300002560 | Grasslands Soil | TISVASHGLLYRHLTPPQVRDLLSGAVSHLEGGERVTQPVS* |
| JGI25382J43887_102386111 | 3300002908 | Grasslands Soil | STISVASHGLLHRHLTPQQVRDLLSGAISHLEGGERVTASAS* |
| JGI25388J43891_10583462 | 3300002909 | Grasslands Soil | SIASHGLLHRQLTPQQVRDLLSGAIAHLEGGERVTAPAEA* |
| JGI25617J43924_102141752 | 3300002914 | Grasslands Soil | VFVVSEETSTISVASHGLLHRHLTAEQVRDLLSGAISHLEGGERVVASAT* |
| Ga0062594_1022483672 | 3300005093 | Soil | STISIASHGLLHRHLTAPQVRDLLSGAISHLEGGERVTAPAS* |
| Ga0066674_102641411 | 3300005166 | Soil | STISIASHGVLHRPVSPQQVRDLLSGVIHHLEGGERIAEATH* |
| Ga0066672_104578672 | 3300005167 | Soil | STISVASHGLLHRHLTPQQVRDLLSGAIAHLEGGERVTAAAG* |
| Ga0066677_100425914 | 3300005171 | Soil | LVVSEETSTISIASHGLLHRHLTAPQVRDLLSGAISHLEGGERVTAPAG* |
| Ga0066683_101355902 | 3300005172 | Soil | TVLVVSEETSTISVASHGLLYRHLTPQQVRDLLSGAVSHLEGGERVSQPAT* |
| Ga0066673_101553761 | 3300005175 | Soil | STISIASHGVLHRPVTPQQVRDLLSGVIHHLEGGERISEATH* |
| Ga0066679_109300551 | 3300005176 | Soil | TISVASHGLLHRHLTPQQVRDLLSGAISHLEGGERVTASAS* |
| Ga0066684_110753011 | 3300005179 | Soil | VSEETSTISVASHGLLYRHLTPPQVRDLLSGAVSHLEGGERVTQTVS* |
| Ga0066676_110123491 | 3300005186 | Soil | VLVVSEETSTISVASHGLLYRHLTPPQVRDLLSGAVSHLEGGERVTQPVS* |
| Ga0070689_1006490851 | 3300005340 | Switchgrass Rhizosphere | VVSEETSTISVASHGLLYRHLTPQQVRDLLSGAVSHLEGGERVTQPAS* |
| Ga0066682_100502851 | 3300005450 | Soil | TSTISVASHGLLHRPLTPQQVRDLLSGAISHLEGGERLIA* |
| Ga0066687_105974661 | 3300005454 | Soil | ATVLVVSEETSTISVASHGLLYRHLTPPQVRDLLSGAVSHLEGGERVTQTVS* |
| Ga0066701_103627192 | 3300005552 | Soil | DATVLVVSEETSTISVASHGLLHRHLSPEQVRDLLSGAISHLEGGERVIAAT* |
| Ga0066692_100050416 | 3300005555 | Soil | ETSTISVASHGLLHRHLSAPQVRDLLSGAISHLEGGERVTAPAS* |
| Ga0066707_108786881 | 3300005556 | Soil | TISVASHGLLHRHLTPQQVRDLLSGAIAHLEGGERVTAAAG* |
| Ga0066704_105327531 | 3300005557 | Soil | TVLVVSEETSTISIASHGLLHRHLTAPQVRDLLSGAISHLEGGERVTAPAG* |
| Ga0066700_103903621 | 3300005559 | Soil | ASHGLLHRPLTPQQVRDLLTGAISHLEGGERLIA* |
| Ga0066670_104647831 | 3300005560 | Soil | ASHGLLHRHLTPQQVRDLLSGAISHLEGGERVTAPAS* |
| Ga0066693_101662172 | 3300005566 | Soil | ETSTISVASHGLLYRHLTPQQVRDLLSGAVSHLEGGERVTQPAT* |
| Ga0066703_105146152 | 3300005568 | Soil | ATVLVVSEETSTISIASHGLLHRQLTPQQVRDLLSGAIAHLEGGERVTAPAEA* |
| Ga0066705_109611862 | 3300005569 | Soil | FVVSEETSTISVASHGLLHRHLTPQQVRDLLSGAIAHLEGGERVTAAAG* |
| Ga0070702_1001201691 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | ISVASHGLLYRHLTPQQVRDLLSGAVSHLEGGERVTQPAS* |
| Ga0066653_100425071 | 3300006791 | Soil | VLVVSEATSTISVASHGLLYRHLTPQQVRDLLSGAVSHLEGGERVTQPAT* |
| Ga0066658_103762862 | 3300006794 | Soil | EETSTISIASHGLLHRHLTAPQVRDLLSGAISHLEGGERVTAPAG* |
| Ga0066660_107129752 | 3300006800 | Soil | VASHGLLHRHLTPQQVRDLLSGAIAHLEGGERVTAAAG* |
| Ga0075430_1016581291 | 3300006846 | Populus Rhizosphere | SIASHGLLHRHLTPDQVRDLLSGAVSRLEGGERVTAPAG* |
| Ga0075433_100555621 | 3300006852 | Populus Rhizosphere | STISVASHGLLYRHLTPQQVRDLLSGAVAHLEGGERVTQPAS* |
| Ga0075435_1011704322 | 3300007076 | Populus Rhizosphere | SHGLLYRHLTPQQVRDLLSGAVSHLEGGERVTQPAT* |
| Ga0099828_108314631 | 3300009089 | Vadose Zone Soil | VLVVSEETSTISIASHGLLHRHLTAPQVRDLLSGAISHLEGGERVTAPAS* |
| Ga0099827_107091522 | 3300009090 | Vadose Zone Soil | ISVASHGLLHRHLTPQQVRDLLSGAISHLEGGERVTASAS* |
| Ga0066709_1017596321 | 3300009137 | Grasslands Soil | TSTISVASHGLLHRHLTPQQVRDLLSGAISHLEGGERITAPAS* |
| Ga0114129_122712162 | 3300009147 | Populus Rhizosphere | VSEETSTISVASHGLLHRHLTAPQVRDLLSGAISHLEGGERVTAPAS* |
| Ga0127458_11279532 | 3300010112 | Grasslands Soil | VLVVSEETSTISVASHGLLHRHLTAPQVRDLLSGAISHLEGGERVTASAS* |
| Ga0127447_11535642 | 3300010136 | Grasslands Soil | SHGLLHRHLSSEQVRDLLSGAISHLEGGERVIAVT* |
| Ga0134109_100158062 | 3300010320 | Grasslands Soil | LVVSEETSTISVASHGLLYRHLTPQQVRDLLSGAVSHLEGGERVTQPAT* |
| Ga0134084_102901302 | 3300010322 | Grasslands Soil | FVVSEETSTISVASHGLLHRPLTPQQVRGLLSGAISHLEGGERVTAPAS* |
| Ga0134086_102276112 | 3300010323 | Grasslands Soil | GLLYRHLTPQQVRDLLSGAVSHLEGGERVTQPAT* |
| Ga0134086_105090481 | 3300010323 | Grasslands Soil | TISVASHGLLHRPLTPQQVRGLLSGAISHLEGGERVTAPVH* |
| Ga0134111_100849281 | 3300010329 | Grasslands Soil | HGLLHRPLTPQQVRGLLSGAISHLEGGERVTAPVH* |
| Ga0134080_103781262 | 3300010333 | Grasslands Soil | TDATVFVVSEETSTISVASHGLLHRPLTPQQVRGLLSGAISHLEGGERVTAPAR* |
| Ga0134080_106595492 | 3300010333 | Grasslands Soil | VVSEETSTISIASHGVLHRQVSPQQVRDLLSGVINHLEGGERIAEATH* |
| Ga0134071_100181035 | 3300010336 | Grasslands Soil | SVASHGLLHRHLTPQQVRDLLSGAISHLEGGERVTAPAS* |
| Ga0134071_104305502 | 3300010336 | Grasslands Soil | EETSTISVASHGLLHRHLTPQQVRDLLSGAISHLEGGERITAPAS* |
| Ga0134066_102955081 | 3300010364 | Grasslands Soil | ISVASHGLLYRHLIPQQVRDLLSGAISHLEGGERVTQPAL* |
| Ga0134126_130914481 | 3300010396 | Terrestrial Soil | STISIASHGLLYRHLTPQTVRDLLSGAVSHLEGGERVTAPAT* |
| Ga0138111_10655501 | 3300010896 | Grasslands Soil | TDATVFVVSEETSTISVASHGLLHRPLTPQQVRGLLSGAISHLEGGERVTAPAG* |
| Ga0137326_10307473 | 3300011417 | Soil | ISVASHGLLHRQLTPQQVRDLLSGVISHLEGGERLIAAPG* |
| Ga0137383_102856581 | 3300012199 | Vadose Zone Soil | TVFVVSEETSTISVASHGLLHRHLTPQQVRDLLSGAISHLEGGERITAPAS* |
| Ga0137365_101993112 | 3300012201 | Vadose Zone Soil | VVSEETSTISVASHGLLYRHLTPQQVRDLLSGAVSHLEGGERVTQPAT* |
| Ga0137399_103852682 | 3300012203 | Vadose Zone Soil | VVSEETSTISVASHGLLYRHLNPQQVRDLLSGAVSHLEGGERVTQPAT* |
| Ga0137399_104308001 | 3300012203 | Vadose Zone Soil | ISIASHGLLHRQLTPQQVRDLLSGAIAHLEGGERVTAPAEA* |
| Ga0137399_111980192 | 3300012203 | Vadose Zone Soil | SEETSTISVASHGLLYRHLTPQQVRDLLSGAVSHLEGGERVTQPAT* |
| Ga0137399_113838792 | 3300012203 | Vadose Zone Soil | TVLVVSEETSTISVASHGLLHRHLTAPQVRDLLSGAISHLEGGERVTAPAS* |
| Ga0137379_110505241 | 3300012209 | Vadose Zone Soil | ATVLVVSEETSTISVASHGLLYRHLTPQQVRDLLSGAVSHLEGGERVTQPAT* |
| Ga0137378_108119422 | 3300012210 | Vadose Zone Soil | SVASHGLLHRHLTAEQVRDLLSGAISHLEGGERVIAPAT* |
| Ga0137370_102100641 | 3300012285 | Vadose Zone Soil | TSTISVASHGLLHRHLTAPQVRDLLSGAISHLEGGERVTAPVS* |
| Ga0137387_110357651 | 3300012349 | Vadose Zone Soil | ISVASHGLLYRHLTPQQVRDLLSGAVSHLEGGERVTQPAI* |
| Ga0137372_105972522 | 3300012350 | Vadose Zone Soil | VSEETSTISVASHGLLYRHLTPQKVRDLLSGAVSHLEGGERVTAPAG* |
| Ga0137386_105336892 | 3300012351 | Vadose Zone Soil | ISIASHGLLHRHLTAPQVRDLLSGAISHLEGGERVTAPAG* |
| Ga0137385_112528031 | 3300012359 | Vadose Zone Soil | IASHGLLHRALTPQQVRDLLSGAISHLEGGERLIAATG* |
| Ga0137373_107346662 | 3300012532 | Vadose Zone Soil | STISVASHGLLHRHLTAPQVRDLLSGAISHLEGGERVTAPAS* |
| Ga0137419_108201331 | 3300012925 | Vadose Zone Soil | SHGLLYRHLTPQQVRDLLSGAVSHLEGGERVTQPAI* |
| Ga0137410_113559792 | 3300012944 | Vadose Zone Soil | IASHGLLYRHLTPQQVRDLLSGAVSHLEGGERVTTPAA* |
| Ga0134087_100613754 | 3300012977 | Grasslands Soil | VSEETSTISVASHGLLHRHLTPQQVRDLLSGAISHLEGGERVTAPAS* |
| Ga0134075_100040071 | 3300014154 | Grasslands Soil | ASHGLLHRHLSSEQVRDLLSGAISHLEGGERVIAVT* |
| Ga0134075_104625562 | 3300014154 | Grasslands Soil | FVVSEETSTISVASHGLLHRHLTPQQVRDLLSGAIAHLEGGERVTAAAS* |
| Ga0157380_122147502 | 3300014326 | Switchgrass Rhizosphere | TSTISVASHGLLYRHLTPQQVRDLLSGAVSHLEGGERVTQPAS* |
| Ga0180086_10406453 | 3300014883 | Soil | YATVLVVSEETSTISVASHGLLHRQLTPQQVRDLLSGVISHLEGGERLIAAPG* |
| Ga0137420_12620212 | 3300015054 | Vadose Zone Soil | TISVASHGLLYRHLTPQQVRDLLSGAVSHLEGGERVTQPAT* |
| Ga0137418_104858313 | 3300015241 | Vadose Zone Soil | GLLHRHLTAPQVRDLLSGAISHLEGGERVTAPAS* |
| Ga0134073_100191124 | 3300015356 | Grasslands Soil | HGLLHRHLTPQQVRDLLSGAIAHLEGGERVTAAAG* |
| Ga0134112_101525122 | 3300017656 | Grasslands Soil | SEETSTISVASHGLLHRHLTPQQVRDLLSGAISHLEGGERVTAPAS |
| Ga0134083_100262812 | 3300017659 | Grasslands Soil | TISVASHGLLYRHLTPQQVRDLLSGAVSHLEGGERVTQPAT |
| Ga0134083_105624362 | 3300017659 | Grasslands Soil | SEETSTISVASHGLLYRHLTPQQVRDLLSGAVSHLEGGERVTQPA |
| Ga0184637_107482902 | 3300018063 | Groundwater Sediment | VSEETSTISVASHGLLYRHLTPQQVRDLLSGAVSHLEGGERVTQPAT |
| Ga0184612_105009171 | 3300018078 | Groundwater Sediment | TVLVVSEETSTISVASHGLLYRHLTPQKVRDLLSGTVSHLEGGERVTAPAT |
| Ga0066667_102283882 | 3300018433 | Grasslands Soil | SEETSTISVASHGLLYRHLTPQQVRDLLSGAVSHLEGGERVTQPAT |
| Ga0066667_120912941 | 3300018433 | Grasslands Soil | TSTISVASHGLLHRHLTPQQVRDLLSGAISHLEGGERVTASAS |
| Ga0066669_105515813 | 3300018482 | Grasslands Soil | SEETSTISVASHGLLHRHLTPQQVRDLLSGAIAHLEGGERVTAAAG |
| Ga0066669_105806671 | 3300018482 | Grasslands Soil | VASHGLLHRHLTPQQVRDLLSGAISHLEGGERVTAPAS |
| Ga0210382_102797561 | 3300021080 | Groundwater Sediment | EETSTISVASHGLLYRHLTPQQVRDLLSGAVSHLEGGERVTAPAT |
| Ga0209751_112542592 | 3300025327 | Soil | STISVASHGLLYRHLTPPQVRDLLSGAVSHLEGGERVTQPAT |
| Ga0207646_109556891 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | SEETSTISVASHGLLYRHLTPQQVRDLLSGAVSHLEGGERVTQPAS |
| Ga0209235_11493061 | 3300026296 | Grasslands Soil | VVSEETSTISIASHGLLHRQLTPQQVRDLLSGAIAHLEGGERVTAPAEA |
| Ga0209238_10047721 | 3300026301 | Grasslands Soil | ETSTISVASHGLLHRHLTPQQVRDLLSGAIAHLEGGERVTAAAG |
| Ga0209469_10299063 | 3300026307 | Soil | VVSEETSTISIASHGVLHRPVSPQQVRDLLSGVIHHLEGGERIAEATH |
| Ga0209761_12565201 | 3300026313 | Grasslands Soil | TISIASHGLLHRHLTAPQVRDLLSGAISHLEGGERVTAPAS |
| Ga0209268_10671443 | 3300026314 | Soil | EETSTISIASHGVLHRPVSPQQVRDLLSGVIHHLEGGERIAEATH |
| Ga0209801_10669254 | 3300026326 | Soil | HGLLHRPLTPQQVRGLLSGAISHLEGGERVTAPAR |
| Ga0209802_13130142 | 3300026328 | Soil | SEETSTISVASHGLLYRHLTPPQVRDLLSGAVSHLEGGERVTQPVS |
| Ga0209803_11219352 | 3300026332 | Soil | SHGLLYRHLTPQQVRDLLSGAVSHLEGGERVTQPAT |
| Ga0209377_11191971 | 3300026334 | Soil | VSEETSTISVASHGLLHRHLTPQQVRDLLSGAISHLEGGERITAPAS |
| Ga0209690_11253181 | 3300026524 | Soil | VVSEETSTISIASHGVLHRPLTSQQVRDLLSGAISHLEGGERISVQPTAS |
| Ga0209807_12406751 | 3300026530 | Soil | HGLLHRHLTPQQVRDLLSGAIAHLEGGERVTAAAG |
| Ga0209160_10039711 | 3300026532 | Soil | EETSTISIASHGLLHRHLTAPQVRDLLSGAISHLEGGERVTAPAG |
| Ga0209376_10361425 | 3300026540 | Soil | VLVVSEETSTISVASHGLLHRHLTAPQVRDLLSGAISHLEGGERVTAPAS |
| Ga0209161_102176163 | 3300026548 | Soil | ATVLVVSEETSTISIASHGVLHRPVSPQQVRDLLSGVINHLEGGERIVEATH |
| Ga0209845_10675421 | 3300027324 | Groundwater Sand | TVLVVSEETSTISVASHGLLHRHLTPQQVRDLLSGAISHLEGGERVTAPAV |
| Ga0208454_11635231 | 3300027573 | Soil | VLVVSEETSTISVASHGLLHRQLTPQQVRDLLSGVISHLEGGERLIAAPG |
| Ga0208988_11435941 | 3300027633 | Forest Soil | ATVLVVSEETSTISVASHGLLHRHLTAPQVRDLLSGAISHLEGGERVTAPAS |
| Ga0209178_12956111 | 3300027725 | Agricultural Soil | ASHGLLHRHLSAPQVRDLLSGAISHLEGGERVTAPAS |
| Ga0209074_103889152 | 3300027787 | Agricultural Soil | EETSTISVASHGLLHRHLTAPQVRDLLSGAISHLEGGERVSAPAS |
| Ga0209382_120299222 | 3300027909 | Populus Rhizosphere | VSERIQYPAASTVLVVSEETSSISIASHGLLHRHLTPDQVRDLLSGAVSRLEGGERVTAPAG |
| Ga0307501_101680672 | 3300031152 | Soil | TSTISVASHGLLYRHLTPQQVRDLLSGAVSHLQGGERVTQPAT |
| Ga0310686_1154043851 | 3300031708 | Soil | VASHGVLHRPLTPQQVRELLSGTISHLEGGERLVASAP |
| Ga0307469_125035511 | 3300031720 | Hardwood Forest Soil | VSEETSTISIASHGLLYRHLTPQQVRDLLSGAVSHLEGGERVTTPAA |
| Ga0307468_1017123632 | 3300031740 | Hardwood Forest Soil | VASHGLLYRHLTPPQVRDLLSGAVSHLEGGERVTQPAT |
| Ga0307479_104899703 | 3300031962 | Hardwood Forest Soil | VSEETSTISVASHGLLHRHLTPQQVRDLLSGAIAHLEGGERVTAAAG |
| Ga0335071_104299753 | 3300032897 | Soil | SEETSTISVASHGILHRPLTPDQVRDLLSGVSTKLEGTERLSTRMPALS |
| Ga0364932_0031921_2_115 | 3300034177 | Sediment | ASHGLLYRHLTPPQVRDLLSGAVSHLEGGERVTQPAT |
| ⦗Top⦘ |