


| Basic Information | |
|---|---|
| Family ID | F078523 |
| Family Type | Metagenome |
| Number of Sequences | 116 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MAQVITRCRLTGHYMFMGMDADPKEFTRSPGPFARKFCPFCAC |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.41 % |
| % of genes from short scaffolds (< 2000 bps) | 93.97 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.276 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.759 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.552 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.49% β-sheet: 11.27% Coil/Unstructured: 73.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF06707 | DUF1194 | 87.93 |
| PF03401 | TctC | 4.31 |
| PF00535 | Glycos_transf_2 | 1.72 |
| PF02743 | dCache_1 | 1.72 |
| PF13467 | RHH_4 | 0.86 |
| PF16925 | TetR_C_13 | 0.86 |
| PF05239 | PRC | 0.86 |
| PF00701 | DHDPS | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 4.31 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 1.72 |
| COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 1.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459022|GZEQPF101EQ0NN | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 2189573004|GZGWRS401CO942 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10026570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1371 | Open in IMG/M |
| 3300004480|Ga0062592_102599139 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300004633|Ga0066395_10662869 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300005177|Ga0066690_10486522 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300005329|Ga0070683_102425891 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300005332|Ga0066388_100567196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1762 | Open in IMG/M |
| 3300005445|Ga0070708_100947867 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300005467|Ga0070706_100433356 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
| 3300005536|Ga0070697_101017348 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300005616|Ga0068852_102047119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 594 | Open in IMG/M |
| 3300005764|Ga0066903_100170475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3182 | Open in IMG/M |
| 3300005937|Ga0081455_10248273 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300006028|Ga0070717_10616099 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300006791|Ga0066653_10117704 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
| 3300006852|Ga0075433_11853438 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300006871|Ga0075434_100798877 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300009143|Ga0099792_10020182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2960 | Open in IMG/M |
| 3300009156|Ga0111538_11966498 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300010048|Ga0126373_11683858 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300010361|Ga0126378_13172880 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300010366|Ga0126379_12532868 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300010398|Ga0126383_11353348 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300010398|Ga0126383_13507623 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300010403|Ga0134123_11914197 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300010863|Ga0124850_1087821 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300010868|Ga0124844_1049360 | All Organisms → cellular organisms → Bacteria | 1470 | Open in IMG/M |
| 3300010868|Ga0124844_1071232 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
| 3300011119|Ga0105246_10590908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 958 | Open in IMG/M |
| 3300012199|Ga0137383_10477761 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300012200|Ga0137382_10999443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 600 | Open in IMG/M |
| 3300012349|Ga0137387_11327909 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300012357|Ga0137384_10494521 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300012358|Ga0137368_10742464 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300012532|Ga0137373_10003696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 16683 | Open in IMG/M |
| 3300012975|Ga0134110_10486798 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300012985|Ga0164308_10597781 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300012987|Ga0164307_10940236 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300014968|Ga0157379_11297939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 703 | Open in IMG/M |
| 3300015245|Ga0137409_11615247 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300016270|Ga0182036_10298640 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
| 3300016294|Ga0182041_10935632 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300016294|Ga0182041_11166894 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300016404|Ga0182037_12034753 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300016445|Ga0182038_10823774 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300016445|Ga0182038_10980660 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300016445|Ga0182038_11372042 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300017965|Ga0190266_10873900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 587 | Open in IMG/M |
| 3300018028|Ga0184608_10341561 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300018433|Ga0066667_11187349 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300018468|Ga0066662_10235154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1483 | Open in IMG/M |
| 3300018468|Ga0066662_11012092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 824 | Open in IMG/M |
| 3300018468|Ga0066662_12198702 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300019361|Ga0173482_10792974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
| 3300021168|Ga0210406_11105051 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300021178|Ga0210408_10809037 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300021560|Ga0126371_12127755 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300024330|Ga0137417_1118844 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300025905|Ga0207685_10195037 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300025916|Ga0207663_10938919 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 693 | Open in IMG/M |
| 3300025927|Ga0207687_10709280 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300026067|Ga0207678_10016970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6394 | Open in IMG/M |
| 3300026095|Ga0207676_11936327 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300026334|Ga0209377_1319480 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300026494|Ga0257159_1007556 | All Organisms → cellular organisms → Bacteria | 1649 | Open in IMG/M |
| 3300027610|Ga0209528_1053087 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300027643|Ga0209076_1099228 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300027824|Ga0209040_10237932 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300027875|Ga0209283_10527405 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300027882|Ga0209590_10362392 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300028710|Ga0307322_10183392 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300028712|Ga0307285_10021720 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1483 | Open in IMG/M |
| 3300028713|Ga0307303_10193735 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300028771|Ga0307320_10148391 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300028787|Ga0307323_10273958 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300028880|Ga0307300_10266064 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300028884|Ga0307308_10156501 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300031226|Ga0307497_10063738 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
| 3300031226|Ga0307497_10137327 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300031546|Ga0318538_10056049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1941 | Open in IMG/M |
| 3300031564|Ga0318573_10039434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2256 | Open in IMG/M |
| 3300031572|Ga0318515_10785701 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300031719|Ga0306917_10564601 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300031720|Ga0307469_11433007 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300031723|Ga0318493_10181845 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300031724|Ga0318500_10159078 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300031754|Ga0307475_10897435 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300031771|Ga0318546_10047103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2664 | Open in IMG/M |
| 3300031777|Ga0318543_10054574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1639 | Open in IMG/M |
| 3300031778|Ga0318498_10061704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1674 | Open in IMG/M |
| 3300031833|Ga0310917_10341626 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300031912|Ga0306921_11453134 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300031941|Ga0310912_10811610 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300031945|Ga0310913_11126978 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300031954|Ga0306926_10186916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2571 | Open in IMG/M |
| 3300031954|Ga0306926_11259731 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300031981|Ga0318531_10514884 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300032008|Ga0318562_10259827 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300032035|Ga0310911_10850934 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300032039|Ga0318559_10164388 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300032042|Ga0318545_10204058 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300032051|Ga0318532_10262097 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300032054|Ga0318570_10198218 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300032054|Ga0318570_10383799 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300032059|Ga0318533_10948113 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300032065|Ga0318513_10045385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1952 | Open in IMG/M |
| 3300032065|Ga0318513_10456765 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300032076|Ga0306924_12470039 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300032180|Ga0307471_102298781 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300032205|Ga0307472_100873691 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300032261|Ga0306920_101466628 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300032261|Ga0306920_101469598 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300033289|Ga0310914_10615621 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300033289|Ga0310914_10916896 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300034147|Ga0364925_0122400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 933 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.21% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.34% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.17% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.17% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.17% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.45% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.59% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.59% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 1.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.72% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.86% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.86% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.86% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.86% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.86% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459022 | Grass soil microbial communities from Rothamsted Park, UK - FA2 (control condition) | Environmental | Open in IMG/M |
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FA2_00567010 | 2170459022 | Grass Soil | MAQVITRCRLTGHYMFMGMDADPKEFTRSPGPFARKFCPFCACDHLW |
| FG2_09496450 | 2189573004 | Grass Soil | MAQVITRCRLTGHYMFMGMEADPKEFTRSHGPFARKFCPFCACDHLWHKEDSK |
| AF_2010_repII_A001DRAFT_100265701 | 3300000793 | Forest Soil | MAQVITRCRLTGHYMFMGMDADPKEFTQSPGPFVRKFCPFCACEHSWYKEDSK |
| Ga0062592_1025991392 | 3300004480 | Soil | MAQIVTRCRLTGHYMFMAMDVDPKEFAGSRGPFTRKFCPFCSCEHLWHKED |
| Ga0066395_106628692 | 3300004633 | Tropical Forest Soil | MAQVITRCRLTGHYMFMGMDVDPKEFTRSPGPFTRKFCPFCACDHLWH |
| Ga0066690_104865221 | 3300005177 | Soil | MAQVITRCRLTGHYMFMGMDVDPREFTHASGSFARKFCPFCACEHSWYKEDS |
| Ga0070683_1024258912 | 3300005329 | Corn Rhizosphere | MAQVITRCRLTGHYMFMGMDADPKEFTRSPGPFARKFCPFCACDHLWHK |
| Ga0066388_1005671961 | 3300005332 | Tropical Forest Soil | MAQVITRCRLTGHYMFMGMDADPKEFTQSPGPFVRKFCPFCACEHSWYKEDSKFL |
| Ga0070708_1009478672 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQVITRCRLTGHYMFMGMDVDPKEFTRSPGPFTRKFCPFCACDHLWHKE |
| Ga0070706_1004333561 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQVITRCRLTGHYMFMGMDVDPKEFTRSPGPFTRKFCPFC |
| Ga0070697_1010173482 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQVITRCRLTGHYMFMGMDVDPKEFTHSFGSFARKFCAFCACEHFWYK |
| Ga0068852_1020471191 | 3300005616 | Corn Rhizosphere | MAQVITRCRLTGHYMFMGLDVDPKEFARSPGPFKRKFCPFCACDHLWHK |
| Ga0066903_1001704754 | 3300005764 | Tropical Forest Soil | MAQVITRCRLTGHYMFMGMDADPREFVGASGPFVRKFCPF* |
| Ga0081455_102482733 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MAQVITRCRLTGHYMFMGIDADPKEFTRSPGPFTRKFCPFCACEHLWHKED |
| Ga0070717_106160992 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQVITRCRLTGHYMFMGMDVDPKEFTRSPGPFTRKFCPFCACDHLWHKEDSKFL |
| Ga0066653_101177043 | 3300006791 | Soil | MAQVITRCRLTGHYMFMGMEADPKAFIGSAGPFARKFCPFCACEHSWYKED |
| Ga0075433_118534382 | 3300006852 | Populus Rhizosphere | MAQVITRCRLTGHYMFMGMDADPKEFTRSPGPFARKFCPFCAC |
| Ga0075434_1007988771 | 3300006871 | Populus Rhizosphere | MAQVITRCRLSGHYMFMGMDVDPKEFTRSPGPFTRKFCPFCACDHLWHKEDSK |
| Ga0099792_100201824 | 3300009143 | Vadose Zone Soil | MAQVITRCRLTGHYLFMGMDADPKEFTQSPGPFARKFCPFCA |
| Ga0111538_119664982 | 3300009156 | Populus Rhizosphere | MAQVITRCRLTGHYMFMGMDADPKEFTRSPGPFARKFCPFCACD |
| Ga0126373_116838582 | 3300010048 | Tropical Forest Soil | MAQVITRCRLTGHYMFMGIDADPKEFARSTGPFTRKFCPYCACVHLWYKE |
| Ga0126378_131728802 | 3300010361 | Tropical Forest Soil | MEEAMAQVITRCRLTGHYMFMGMDADPREFIGKAGPFARKFCPFC |
| Ga0126379_125328681 | 3300010366 | Tropical Forest Soil | MAQVITRCGLTSHYMFMGMDVDPKEFTRSPGPFARKFCP |
| Ga0126383_113533481 | 3300010398 | Tropical Forest Soil | MAQVITRCRLTGHYMFMGMDVDPKEFTRSPGPFTRK |
| Ga0126383_135076231 | 3300010398 | Tropical Forest Soil | MAQVITRCRLTGHYMFMGMDVDTREFVASAGPFARKF |
| Ga0134123_119141971 | 3300010403 | Terrestrial Soil | MAQVITRCRLTGHYMIMGLDVDPKEFTRSPGPFKRKFCPFCACDHL |
| Ga0124850_10878212 | 3300010863 | Tropical Forest Soil | MAHVITRCRLTGHYMFMGMDVDPKEFTRSPGPFARKFCPFCACDHLWHKED |
| Ga0124844_10493603 | 3300010868 | Tropical Forest Soil | MAQVITRCRLTGHYMFMGMDVDPKDFTRSLGPFARKFCPFCACD |
| Ga0124844_10712321 | 3300010868 | Tropical Forest Soil | MAQVITRCRLTGHYMFMGMDVDPKDFTRSLGPFARKFCPFCACDHLW |
| Ga0105246_105909081 | 3300011119 | Miscanthus Rhizosphere | MAQVITKCRLTGHYMFMGMDADPKEFRRSAGPFTRKFCPF |
| Ga0137383_104777611 | 3300012199 | Vadose Zone Soil | MAQVITRCRLTGHYMFMGMDVDPREFTHASGSFARKFCPF |
| Ga0137382_109994431 | 3300012200 | Vadose Zone Soil | MAQVITRCRLTGHYMFMGMNADPKEFKQSAGAFARKFCPFCSCEHFWYKEDSKFL |
| Ga0137387_113279092 | 3300012349 | Vadose Zone Soil | MAQVITRCRLTGHYMFMGMDVDPKEFTQSFGSFARKFCPFCACEHFWY |
| Ga0137384_104945212 | 3300012357 | Vadose Zone Soil | MAQVVTRCRLTGHYMFMGMDVDPKEFAHSAGPFAGKFCPFCACEHFWYKEDSKFL |
| Ga0137368_107424642 | 3300012358 | Vadose Zone Soil | MAQVITRCRLTGHYMFMGMDVDPKEFTHSAGPFARKFCPFCACEHF* |
| Ga0137373_100036961 | 3300012532 | Vadose Zone Soil | MAQVITRCRLTGHYMFMGMDVDPKEFTHSAGPFARKFCPFCACEHF |
| Ga0134110_104867982 | 3300012975 | Grasslands Soil | MAQVITRCRLTGHYMFMGMDADPKEFKQSLGTFARKFCPFCSCEHFWYK |
| Ga0164308_105977811 | 3300012985 | Soil | MAQVITRCRLTGHYMFMGMDVDPKEFTSSPGPFTRKFCPFCACDHLWHKEESKF |
| Ga0164307_109402361 | 3300012987 | Soil | MAQVITRCRLTGHYMFMGMDADPKEFKQSVGAFARKF |
| Ga0157379_112979392 | 3300014968 | Switchgrass Rhizosphere | MAQVITKCRLTGHYMFMGMDADPKEFRRSAGPFTRKFCPFCA |
| Ga0137409_116152471 | 3300015245 | Vadose Zone Soil | MAKVITRCRLTGHYMFMGLDADPKEFARSSGKFARK |
| Ga0182036_102986401 | 3300016270 | Soil | MAQVITKCRLTGHYMFMGMDVDPKEFTGSTGPFARKYSPFCACEHA |
| Ga0182041_109356321 | 3300016294 | Soil | MAQVITRCRLTGHYMFMGMDADPKEFTRSFGPFMRKFCPFCAC |
| Ga0182041_111668942 | 3300016294 | Soil | MAQVITRCRLTSHYIFMGMDVYPKEFTRSPGPFARK |
| Ga0182037_120347531 | 3300016404 | Soil | MAQVITKCRLTGHYMFMGMDVDPKEFTGSSGPFARKYCPFCACEHA |
| Ga0182038_108237742 | 3300016445 | Soil | MAQVITRCRLTGHYMFMGMDVDPKEFTRSPGPFAR |
| Ga0182038_109806602 | 3300016445 | Soil | MAQLITKCRLTGHYMFMGMDVDPKQFTGSSGPFARKYCPFCAC |
| Ga0182038_113720421 | 3300016445 | Soil | MAQVITKCRLTGHYMYMGMEADPREFIGRAGPFARKFCPFC |
| Ga0190266_108739001 | 3300017965 | Soil | MAQVITRCRLTGHYMFMGMDADPKEFARSPGPFKRKF |
| Ga0184608_103415611 | 3300018028 | Groundwater Sediment | MAQVITRCRLTGHYMFMGMDADPKEFARTPGPFTRKFCPFCACEHLWHKED |
| Ga0066667_111873492 | 3300018433 | Grasslands Soil | MAQVITRCRLTGHYMFMGMDADPKEFKQSLGTFARKFCPFCSCEHFWYKEDS |
| Ga0066662_102351541 | 3300018468 | Grasslands Soil | MAQVITRCRLTGHYMFMGMDVDPREFTHASGSFARKFCPFCACEH |
| Ga0066662_110120922 | 3300018468 | Grasslands Soil | MAQVITRCRLTGHYMFMGMDADPKEFQRSRGPFSRRFCPFCACEHDWYKEDSKFL |
| Ga0066662_121987021 | 3300018468 | Grasslands Soil | MARVITRCRLTGHYMFMGMDADPEEFVRAFGPFARKFCPF |
| Ga0173482_107929741 | 3300019361 | Soil | MAQVITKCRLTGHYMFMGMDADPKEFRRSVGPFTRKFCPF |
| Ga0210406_111050511 | 3300021168 | Soil | MAQVITRCRLTGHYMFMGMDVDPKEFTRSLGPFARKFCPFCACDHL |
| Ga0210408_108090372 | 3300021178 | Soil | MAQVVTRCRLTGHYMFMGMDVDPKTFPLTAGPFARKFC |
| Ga0126371_121277552 | 3300021560 | Tropical Forest Soil | MAQVITRCRLTGHYMFMGMDVDPKEFTRSPGPFARKFCPFCACDHLWHKEDSKFL |
| Ga0137417_11188441 | 3300024330 | Vadose Zone Soil | MAQVITRCRLTGHYMFMGMDVDPKEFTQSFGSFARKFCPFYACEHFWYRED |
| Ga0207685_101950371 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQVITRCRLTGHYMFMGLDVDPKDFARSPGPFKRKFCP |
| Ga0207663_109389191 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQVITRCRLTGHYMFMGMDVDPQEFARSPGPFARKFCPYCACEHLWNRE |
| Ga0207687_107092801 | 3300025927 | Miscanthus Rhizosphere | MAQVITRCRLTGHYMFMGMDADPKEFTRSPGPFARKFCPFCACDHLWHKED |
| Ga0207678_100169701 | 3300026067 | Corn Rhizosphere | MAQVITRCRLTGHYMFMGLDVDPKEFARSPGPFKRKFCPFCACDHLWHKEDS |
| Ga0207676_119363271 | 3300026095 | Switchgrass Rhizosphere | MAQIVTRCRLTGHYMFMAMDVDPKEFAGSRGPFTRKFCPF |
| Ga0209377_13194801 | 3300026334 | Soil | MAQVITRCRLTGHYMFMGMDVDPKEFTRSPGPFTRKFCPFCA |
| Ga0257159_10075564 | 3300026494 | Soil | MAQVITRCRLTGHYMFMGMDVDPKEFTQSFGSFARKSCP |
| Ga0209528_10530871 | 3300027610 | Forest Soil | MAQVITKCRLTGHYMFMGMDVDPKEFTGSPGPFARKYCPFCACEHVWYKEDT |
| Ga0209076_10992281 | 3300027643 | Vadose Zone Soil | MAQVITRCRLTGHYMFMGMDVDPKEFTQSFGSFARKFCPFYACEHFW |
| Ga0209040_102379321 | 3300027824 | Bog Forest Soil | MSQVITRCRLTGHYIFMGLEADPKEFIGSSGPFARKFCPFCACEHFWH |
| Ga0209283_105274051 | 3300027875 | Vadose Zone Soil | MAQIVTRCRLTGHYMFMAMDVDPKEFAGSRGPFTRKFCPFC |
| Ga0209590_103623922 | 3300027882 | Vadose Zone Soil | MAQVITRCRLTGHYMCMGMDVDSREFSGSAGPFAR |
| Ga0307322_101833921 | 3300028710 | Soil | MAQVITRCRLTGHYMFMGMDADPKEFARTPGPFTRKFC |
| Ga0307285_100217201 | 3300028712 | Soil | MAQVITRCRLTGHYMFMGMEADPKEFTRSPGPFARKFC |
| Ga0307303_101937352 | 3300028713 | Soil | MAQVITRCRLTGHYMFMGMEADPKEFTRSPGPFARKFCP |
| Ga0307320_101483912 | 3300028771 | Soil | MAQVITRCRLTGHYMFMGMDVDPKEFTRSPGPFARKFCPFCACDHLW |
| Ga0307323_102739581 | 3300028787 | Soil | MAQVITRCRLTGHYMFMGMEADPKEFTRSPGPFARKFCPFC |
| Ga0307300_102660641 | 3300028880 | Soil | MAQVITRCRLTGHYMFMGMEADPKEFTRSPGPFPRKFCPFCACDHLWHKED |
| Ga0307308_101565011 | 3300028884 | Soil | MAQVITRCRLTGHYMFMGMEADPKEFTRSPGPFTRKF |
| Ga0307497_100637381 | 3300031226 | Soil | MAQVITRCRLTGHYMFMGLDVDPKEFARSPGPFKRK |
| Ga0307497_101373272 | 3300031226 | Soil | MAQVITRCRLTGHYMFMGMEADPKEFTRSPGPFARKFCPFCACDHLWHKEDSK |
| Ga0318538_100560494 | 3300031546 | Soil | MAQVITRCRLTGHYMFMGVDVDPKEFTRSAGPFARKFC |
| Ga0318573_100394341 | 3300031564 | Soil | MAQVITRCRLTGHYMFMGMDVDPKEFTHSPGPFTRKFCPFCAC |
| Ga0318515_107857011 | 3300031572 | Soil | MAQVITRCRLTGHYMFMGMDVDPKAFTRSPGPFARKFCPFCACDHLWH |
| Ga0306917_105646012 | 3300031719 | Soil | MAQVITRCRLTGHYMFMGMEADPKEFIGRSGPFARKFCPFC |
| Ga0307469_114330072 | 3300031720 | Hardwood Forest Soil | MAQVITRCRLTGHYMFMGMDVDPKEFTHSFGSFAR |
| Ga0318493_101818454 | 3300031723 | Soil | MAQVITRCRLTGHYMFMGLEADPKEFIGRSGAFAR |
| Ga0318500_101590782 | 3300031724 | Soil | MAQVITRCRLTGHYMFMGLEADPKEFIGRSGAFARKFCTFCAYEHFWHREDA |
| Ga0307475_108974352 | 3300031754 | Hardwood Forest Soil | MAQVITRCRLTGHYMFMGMDVDPKEFTRSLGPFARKF |
| Ga0318546_100471036 | 3300031771 | Soil | MAQVITRCRLTGHYMFMGLEADPKEFIGRSVAFAR |
| Ga0318543_100545743 | 3300031777 | Soil | MAQVITRCRLTGHYMFMGMDADPKEFTRSFGPFMRKFCPFCACEHSWYKE |
| Ga0318498_100617045 | 3300031778 | Soil | MAQVITRCRLTGHYMFMGMDVDPKEFTRSPGPFARKFCPFCA |
| Ga0310917_103416262 | 3300031833 | Soil | MAQVITRCRLTGHYMFMGMDVDPKEFTRSPGPFARKFCPFCACDHLWHKEDSKF |
| Ga0306921_114531341 | 3300031912 | Soil | MAQVITRCGLTSHYMFMGMDVDPKEFTRSPGPFARKFCPFCACDHLWHKE |
| Ga0310912_108116102 | 3300031941 | Soil | MAQVITRCRLTGHYMFMGMDADPKEFTRSFGPFMRKFCPFCACEH |
| Ga0310913_111269782 | 3300031945 | Soil | MAQVITRCRLTGHYMFMGMDVDPKEFTRSPGPFARKFCPFCACDHLWHKEDS |
| Ga0306926_101869161 | 3300031954 | Soil | MAQVITKCRLTGHYKFMGMDADPKRFTGSKGAFARTFCPFCACDHDWYKEDS |
| Ga0306926_112597311 | 3300031954 | Soil | MAQVITRCRLTSHYMFMGMDVDPKEFTRSPGPFARKFCPFCACDHLWHKE |
| Ga0318531_105148842 | 3300031981 | Soil | MAQVITRCRLTGHYMFMGLEADPKEFIGRSGAFARKFCPFCACEHFWHRE |
| Ga0318562_102598272 | 3300032008 | Soil | MAQVITRCRLTGHYMFMGMDVDPKEFTRSPGPFARKF |
| Ga0310911_108509342 | 3300032035 | Soil | MAQVITRCRLTGHYMFMGMDVDPKEFTRSPGPFTRKFC |
| Ga0318559_101643881 | 3300032039 | Soil | MAQVITRCRLTGHYMFMGMDVDPKEFTRSPGPFTRKFCPFCAC |
| Ga0318545_102040581 | 3300032042 | Soil | MAQVITRCRLTGHYMFMGLEADPKEFIGRSGAFARKFCPFCACEHFWHRED |
| Ga0318532_102620972 | 3300032051 | Soil | MAQLITKCRLTGHYMFMGMDVDPKQFTGSSGPFARKYC |
| Ga0318570_101982181 | 3300032054 | Soil | MAQVITRCRLTGHYMFMGLEADPKEFIGRSGAFARK |
| Ga0318570_103837991 | 3300032054 | Soil | MAQVITRCRLTGHYMFMGMDVDPKEFTRSPGPFARKFCPF |
| Ga0318533_109481131 | 3300032059 | Soil | MAQVITRCRLTGHYMFMGMDADPREFIGKAGPFARKFCPFCACEHSWY |
| Ga0318513_100453854 | 3300032065 | Soil | MAQVITRCRLTGHYMFMGMDVDPKEFTHSPGPFTRKF |
| Ga0318513_104567651 | 3300032065 | Soil | MAQVITRCRLTGHYMFMGTDVDPKEFTRSPGPFARKFCPFCACDH |
| Ga0306924_124700391 | 3300032076 | Soil | MAQVITRCRLTGHYMFMGLEADPKEFIGRSGAFARKFCPFCACEHFWHREDTKF |
| Ga0307471_1022987811 | 3300032180 | Hardwood Forest Soil | MAQVITRCRLTGHYMFMGMDVDPKEFTQSFGSFARKFCPFCACE |
| Ga0307472_1008736912 | 3300032205 | Hardwood Forest Soil | MAQVITRCRLTGHYMFMGMDVDPKEFTRSLGPFARKFCPFCACDHLWHKEDSK |
| Ga0306920_1014666282 | 3300032261 | Soil | MAQVITRCRLTGHYMFMGMDVDPKEFTRSLGPFARKFCPFCACDH |
| Ga0306920_1014695981 | 3300032261 | Soil | MAQVITKCRLTGHYKFMGMDADPKRFTGSKGAFARTFCP |
| Ga0310914_106156212 | 3300033289 | Soil | MAQVITRCRLTGHYMFMGMEADPKEFIGRSGPFARKF |
| Ga0310914_109168961 | 3300033289 | Soil | MAQVITRCRLTGHYMFMGMDADPREFIGKAGPFARKFCPFCACEHSWYR |
| Ga0364925_0122400_3_143 | 3300034147 | Sediment | MAQVITRCRLTGHYMFMGLDVDPKEFARSPGPFKRKFCPFCACDHLW |
| ⦗Top⦘ |