


| Basic Information | |
|---|---|
| Family ID | F078440 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MLAPDEKLKLSPKPYLSATARFASGADTPRDFLERCLAD |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.14 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 87.07 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (59.483 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.586 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.931 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.517 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.36% β-sheet: 0.00% Coil/Unstructured: 71.64% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF12973 | Cupin_7 | 15.52 |
| PF01425 | Amidase | 12.07 |
| PF11010 | DUF2848 | 9.48 |
| PF13356 | Arm-DNA-bind_3 | 6.90 |
| PF04199 | Cyclase | 5.17 |
| PF03401 | TctC | 3.45 |
| PF01799 | Fer2_2 | 2.59 |
| PF03706 | LPG_synthase_TM | 1.72 |
| PF10387 | DUF2442 | 1.72 |
| PF02771 | Acyl-CoA_dh_N | 0.86 |
| PF09084 | NMT1 | 0.86 |
| PF01494 | FAD_binding_3 | 0.86 |
| PF01520 | Amidase_3 | 0.86 |
| PF00710 | Asparaginase | 0.86 |
| PF12399 | BCA_ABC_TP_C | 0.86 |
| PF04551 | GcpE | 0.86 |
| PF00561 | Abhydrolase_1 | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 12.07 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 5.17 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 3.45 |
| COG0252 | L-asparaginase/archaeal Glu-tRNAGln amidotransferase subunit D | Translation, ribosomal structure and biogenesis [J] | 1.72 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 1.72 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.72 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.86 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.86 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.86 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.86 |
| COG0821 | 4-hydroxy-3-methylbut-2-enyl diphosphate synthase IspG/GcpE | Lipid transport and metabolism [I] | 0.86 |
| COG0860 | N-acetylmuramoyl-L-alanine amidase | Cell wall/membrane/envelope biogenesis [M] | 0.86 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.86 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.48 % |
| Unclassified | root | N/A | 40.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17332883 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
| 2199352025|deepsgr__Contig_142300 | Not Available | 518 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10004591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3769 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10013483 | All Organisms → cellular organisms → Bacteria | 1969 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1042375 | Not Available | 641 | Open in IMG/M |
| 3300001989|JGI24739J22299_10178543 | Not Available | 625 | Open in IMG/M |
| 3300004152|Ga0062386_100257121 | All Organisms → cellular organisms → Bacteria | 1385 | Open in IMG/M |
| 3300004479|Ga0062595_101682289 | Not Available | 596 | Open in IMG/M |
| 3300005177|Ga0066690_10331206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1031 | Open in IMG/M |
| 3300005447|Ga0066689_10385250 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 876 | Open in IMG/M |
| 3300005713|Ga0066905_100652240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 897 | Open in IMG/M |
| 3300005713|Ga0066905_101207455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 676 | Open in IMG/M |
| 3300005764|Ga0066903_103034238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 909 | Open in IMG/M |
| 3300005764|Ga0066903_105066026 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 698 | Open in IMG/M |
| 3300005843|Ga0068860_101666649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 660 | Open in IMG/M |
| 3300006042|Ga0075368_10323886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 668 | Open in IMG/M |
| 3300006049|Ga0075417_10235301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 875 | Open in IMG/M |
| 3300006051|Ga0075364_10231535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1255 | Open in IMG/M |
| 3300006800|Ga0066660_10194943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1540 | Open in IMG/M |
| 3300006847|Ga0075431_102177550 | Not Available | 509 | Open in IMG/M |
| 3300006852|Ga0075433_10977024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 738 | Open in IMG/M |
| 3300006854|Ga0075425_100212667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2223 | Open in IMG/M |
| 3300006904|Ga0075424_100931367 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 927 | Open in IMG/M |
| 3300006953|Ga0074063_14240508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1177 | Open in IMG/M |
| 3300007255|Ga0099791_10609786 | Not Available | 534 | Open in IMG/M |
| 3300007788|Ga0099795_10278473 | Not Available | 729 | Open in IMG/M |
| 3300009088|Ga0099830_10474642 | Not Available | 1018 | Open in IMG/M |
| 3300009088|Ga0099830_10748302 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 805 | Open in IMG/M |
| 3300009100|Ga0075418_11721548 | Not Available | 681 | Open in IMG/M |
| 3300009147|Ga0114129_10040211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6592 | Open in IMG/M |
| 3300009792|Ga0126374_11557415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300009792|Ga0126374_11756943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 517 | Open in IMG/M |
| 3300010047|Ga0126382_10087708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1968 | Open in IMG/M |
| 3300010047|Ga0126382_10228503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1346 | Open in IMG/M |
| 3300010048|Ga0126373_10877021 | Not Available | 961 | Open in IMG/M |
| 3300010376|Ga0126381_102285912 | Not Available | 777 | Open in IMG/M |
| 3300010403|Ga0134123_10708422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 986 | Open in IMG/M |
| 3300012199|Ga0137383_10420909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 979 | Open in IMG/M |
| 3300012209|Ga0137379_11208588 | Not Available | 663 | Open in IMG/M |
| 3300012349|Ga0137387_11077347 | Not Available | 573 | Open in IMG/M |
| 3300012357|Ga0137384_10609025 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300012358|Ga0137368_10900999 | Not Available | 539 | Open in IMG/M |
| 3300012923|Ga0137359_10000786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 24370 | Open in IMG/M |
| 3300012925|Ga0137419_11835816 | Not Available | 519 | Open in IMG/M |
| 3300012948|Ga0126375_12036408 | Not Available | 508 | Open in IMG/M |
| 3300012957|Ga0164303_11430102 | Not Available | 519 | Open in IMG/M |
| 3300012971|Ga0126369_10562198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1206 | Open in IMG/M |
| 3300012971|Ga0126369_12914434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300012989|Ga0164305_10548452 | Not Available | 919 | Open in IMG/M |
| 3300014296|Ga0075344_1146856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 519 | Open in IMG/M |
| 3300016270|Ga0182036_10242091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1346 | Open in IMG/M |
| 3300016294|Ga0182041_10226338 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1507 | Open in IMG/M |
| 3300016319|Ga0182033_10073301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2421 | Open in IMG/M |
| 3300016319|Ga0182033_10145818 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1819 | Open in IMG/M |
| 3300016319|Ga0182033_10178087 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1670 | Open in IMG/M |
| 3300016319|Ga0182033_10897681 | Not Available | 784 | Open in IMG/M |
| 3300016357|Ga0182032_10193270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1543 | Open in IMG/M |
| 3300016357|Ga0182032_12014110 | Not Available | 507 | Open in IMG/M |
| 3300016371|Ga0182034_10330953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1231 | Open in IMG/M |
| 3300016445|Ga0182038_10148969 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1783 | Open in IMG/M |
| 3300018051|Ga0184620_10005832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2598 | Open in IMG/M |
| 3300020579|Ga0210407_11332720 | Not Available | 535 | Open in IMG/M |
| 3300021384|Ga0213876_10449412 | Not Available | 686 | Open in IMG/M |
| 3300022756|Ga0222622_11246008 | Not Available | 547 | Open in IMG/M |
| 3300025904|Ga0207647_10054334 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2464 | Open in IMG/M |
| 3300025906|Ga0207699_10179048 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
| 3300025915|Ga0207693_11051904 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300026095|Ga0207676_11234351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 741 | Open in IMG/M |
| 3300026118|Ga0207675_100171239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 2075 | Open in IMG/M |
| 3300026319|Ga0209647_1206118 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300026536|Ga0209058_1021215 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4252 | Open in IMG/M |
| 3300026552|Ga0209577_10042905 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3862 | Open in IMG/M |
| 3300027050|Ga0209325_1008935 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1107 | Open in IMG/M |
| 3300027523|Ga0208890_1061776 | Not Available | 604 | Open in IMG/M |
| 3300027907|Ga0207428_10612425 | Not Available | 784 | Open in IMG/M |
| 3300028381|Ga0268264_12483967 | Not Available | 523 | Open in IMG/M |
| 3300028876|Ga0307286_10093917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1048 | Open in IMG/M |
| 3300030905|Ga0308200_1120345 | Not Available | 579 | Open in IMG/M |
| 3300031170|Ga0307498_10359068 | Not Available | 562 | Open in IMG/M |
| 3300031543|Ga0318516_10051172 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2247 | Open in IMG/M |
| 3300031543|Ga0318516_10575707 | Not Available | 644 | Open in IMG/M |
| 3300031544|Ga0318534_10378200 | Not Available | 814 | Open in IMG/M |
| 3300031546|Ga0318538_10257560 | Not Available | 937 | Open in IMG/M |
| 3300031546|Ga0318538_10259703 | Not Available | 933 | Open in IMG/M |
| 3300031564|Ga0318573_10057705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1911 | Open in IMG/M |
| 3300031573|Ga0310915_10419617 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 950 | Open in IMG/M |
| 3300031640|Ga0318555_10066232 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1858 | Open in IMG/M |
| 3300031748|Ga0318492_10171294 | Not Available | 1102 | Open in IMG/M |
| 3300031754|Ga0307475_10883121 | Not Available | 707 | Open in IMG/M |
| 3300031765|Ga0318554_10300984 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 912 | Open in IMG/M |
| 3300031770|Ga0318521_10102790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1575 | Open in IMG/M |
| 3300031770|Ga0318521_10424581 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 794 | Open in IMG/M |
| 3300031777|Ga0318543_10093646 | Not Available | 1284 | Open in IMG/M |
| 3300031780|Ga0318508_1144256 | Not Available | 674 | Open in IMG/M |
| 3300031781|Ga0318547_10772018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300031782|Ga0318552_10199133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1013 | Open in IMG/M |
| 3300031793|Ga0318548_10029273 | Not Available | 2403 | Open in IMG/M |
| 3300031793|Ga0318548_10513045 | Not Available | 585 | Open in IMG/M |
| 3300031797|Ga0318550_10444531 | Not Available | 627 | Open in IMG/M |
| 3300031799|Ga0318565_10140754 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1168 | Open in IMG/M |
| 3300031821|Ga0318567_10596457 | Not Available | 627 | Open in IMG/M |
| 3300031835|Ga0318517_10030427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2162 | Open in IMG/M |
| 3300031893|Ga0318536_10473264 | Not Available | 631 | Open in IMG/M |
| 3300031912|Ga0306921_11260970 | Not Available | 820 | Open in IMG/M |
| 3300031941|Ga0310912_10007265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6818 | Open in IMG/M |
| 3300031962|Ga0307479_11987824 | Not Available | 530 | Open in IMG/M |
| 3300032055|Ga0318575_10153392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1145 | Open in IMG/M |
| 3300032067|Ga0318524_10614392 | Not Available | 572 | Open in IMG/M |
| 3300032076|Ga0306924_10273785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1939 | Open in IMG/M |
| 3300032090|Ga0318518_10070623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1701 | Open in IMG/M |
| 3300032090|Ga0318518_10600956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300032091|Ga0318577_10201731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 951 | Open in IMG/M |
| 3300032094|Ga0318540_10311620 | Not Available | 759 | Open in IMG/M |
| 3300032261|Ga0306920_102011658 | Not Available | 809 | Open in IMG/M |
| 3300033290|Ga0318519_10500954 | Not Available | 731 | Open in IMG/M |
| 3300034690|Ga0364923_0003027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3470 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.21% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.76% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.59% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.59% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.72% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.72% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.86% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.86% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.86% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.86% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.86% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.86% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Host-Associated | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014296 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300030905 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034690 | Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_03193850 | 2088090014 | Soil | MLAPDEKLKLSPKPYLSATAHFASGTDTPRDFLERCLADLAALEPKI |
| deepsgr_02321940 | 2199352025 | Soil | MLAPDEKLKLSPKPYLSATPGFTGGTDTPRDFLERCLADLAALEPK |
| AF_2010_repII_A1DRAFT_100045916 | 3300000597 | Forest Soil | MLAPEDKPKLATKPYLAATARFANSADTPRDFLERCLADLAALE |
| AF_2010_repII_A001DRAFT_100134833 | 3300000793 | Forest Soil | MLAPEDKPKLATKPYLAATARFANSADTPRDFLER |
| AP72_2010_repI_A100DRAFT_10423752 | 3300000837 | Forest Soil | MLAPDEKLKFSPKPYLSATGRFASGADTPRDFLERCLADLAAL |
| JGI24739J22299_101785432 | 3300001989 | Corn Rhizosphere | MLAQDDKLKLSPKPYLSATPGFAKGADTPRDFLERC |
| Ga0062386_1002571211 | 3300004152 | Bog Forest Soil | MLAPEEKLKLSPKPYLSVTRRFVDGADSPREFLERCLADLSMLEP |
| Ga0062595_1016822892 | 3300004479 | Soil | MLAPEDKLKFTPKPYLSATARFANGGDTPRDFLERCLADLAALEPKI |
| Ga0066690_103312063 | 3300005177 | Soil | MLAPDEKLKLSPKPYLSATARFASGADTPRDFLERCLADIAALEPKIG |
| Ga0066689_103852501 | 3300005447 | Soil | MLAPDEKLKLSPKPYLSATARFKTGSETPRDFLERCLAEIEE |
| Ga0066905_1006522403 | 3300005713 | Tropical Forest Soil | MLAPEETLKLSTKPYLSATPRFAGGSDTPREFLERCLADL |
| Ga0066905_1012074551 | 3300005713 | Tropical Forest Soil | MLAPDEKLKLSPKPYLSATARFASGADTPRDFLER |
| Ga0066903_1030342381 | 3300005764 | Tropical Forest Soil | MLAPEDKLKFTPKPYLAATARFASGGDTPRDFLERCLADL |
| Ga0066903_1050660262 | 3300005764 | Tropical Forest Soil | MLAPDEKLKLSPKPYLSATARFTSGADTPRDFLERCLADIAALEPKIG |
| Ga0068860_1016666491 | 3300005843 | Switchgrass Rhizosphere | MLAPDEKLKLSPKPYLSATPRFASGADTPRDFLERCLADLAALEP |
| Ga0075368_103238863 | 3300006042 | Populus Endosphere | MLAQDDKLKLSPKPYLSAAQGFAKGAGTPRDFLERCLADLAALEPRI |
| Ga0075417_102353011 | 3300006049 | Populus Rhizosphere | MLAPDETLKLSTKPYLSATPRFAGGSDTPREFLERCLADLAALEPKIGAF |
| Ga0075364_102315353 | 3300006051 | Populus Endosphere | MLAPEETLKLSTKPYLSATPRFAGGSDTPREFLERCLADLAALEPK |
| Ga0066660_101949431 | 3300006800 | Soil | MLAPDEKLKLSPKPYLSATARFKTGSETPRDFLERCLAEI |
| Ga0075431_1021775501 | 3300006847 | Populus Rhizosphere | MLAPDEKMKLSPKPYLSATAHFANGTDTPRDFLERC |
| Ga0075433_109770243 | 3300006852 | Populus Rhizosphere | MLAQDDKLKLSPKPYLSAAPGFAKGADTPRDFLERCLADLAALEP |
| Ga0075425_1002126674 | 3300006854 | Populus Rhizosphere | MLAPDEKLKLSPKPYLSATPRFASGADTPRDFLERCLADL |
| Ga0075424_1009313671 | 3300006904 | Populus Rhizosphere | MLAPDEKLKFVEKPYLAAAARFASGADTPRHFLERCLADIDRLEP |
| Ga0074063_142405083 | 3300006953 | Soil | MLAPDEKLKLSPKPYLSATARFASGADTPRDFLERCLA |
| Ga0099791_106097862 | 3300007255 | Vadose Zone Soil | MTMLAPEEKLKLSTRPYLSATRRFADGSDSPREFLERCLAEIAALEPKIREFC |
| Ga0099795_102784732 | 3300007788 | Vadose Zone Soil | MLAPDEKLKLSPKPYLSATARFASGAATPRDFLERCLADLA |
| Ga0099830_104746422 | 3300009088 | Vadose Zone Soil | MLAPDDKLKFSVKPYLAATPRFASGADTPRDFLERCLAD |
| Ga0099830_107483021 | 3300009088 | Vadose Zone Soil | MTMLAPDEKLKLSPRPYLAATIGFANGADTPRDVLERCLAELAALEPKIGA |
| Ga0075418_117215482 | 3300009100 | Populus Rhizosphere | MLAPDQKLKLTARPYLPATPRFASGEDTPRDFLERCLADL |
| Ga0114129_100402117 | 3300009147 | Populus Rhizosphere | MLAPDEKLKLSPKPYLSATARFKRGEDTPRDFLERCLADLAALEP |
| Ga0126374_115574151 | 3300009792 | Tropical Forest Soil | MLAPEEKLKLATKPYLASTARFSNGADTPRDFLERCLADLAA |
| Ga0126374_117569431 | 3300009792 | Tropical Forest Soil | MLAPDEKLKLSPKPYLSATARFATGADTPRDFLERCLADLAALEPKI |
| Ga0126382_100877084 | 3300010047 | Tropical Forest Soil | MLAPEETLKLSTKPYLSATPRFAGGSDTPREFLERCLA |
| Ga0126382_102285033 | 3300010047 | Tropical Forest Soil | MLAPEDKLKLVPKPYLEATARFANGVDRPRDFLERCLADLATLEPK |
| Ga0126373_108770213 | 3300010048 | Tropical Forest Soil | VKRAAEGIAMLAPDEKLKLSPKPYLSATARFASGVDTPRDFLERCLADVAALEPKIGAFVNL |
| Ga0126381_1022859121 | 3300010376 | Tropical Forest Soil | MLAPDEKLKLSPKPYLSATARFASGADTPRDFLERCLADI |
| Ga0134123_107084223 | 3300010403 | Terrestrial Soil | MLAPDEKLKLSPKPYLSATAHFASGTDTPRDFLERCLADLAALEPKIG |
| Ga0137383_104209093 | 3300012199 | Vadose Zone Soil | MLVPDEKLKLSPKPYLSATARFASGADTPRDFLERCLADIAALEPK |
| Ga0137379_112085881 | 3300012209 | Vadose Zone Soil | MLAPDEKLKLSPKPYLSATARFKSGDDTPRDFLERC |
| Ga0137387_110773471 | 3300012349 | Vadose Zone Soil | MLAPDEKLKLSPKPYLSATARFKTGSETLRDFLERCLAEIAALDPKIGAFVNLNPEGA |
| Ga0137384_106090251 | 3300012357 | Vadose Zone Soil | MLAPEEKLKLATKPYLATTARFANGADTPRDFLERCLADLAAL |
| Ga0137368_109009991 | 3300012358 | Vadose Zone Soil | MLAPDEKLKLSPKPYLSATARFKSGADTPRDFLERCLAD |
| Ga0137359_100007861 | 3300012923 | Vadose Zone Soil | MLAPEEKLKLATKPYLATTARFANGADTPRDFLERCL |
| Ga0137419_118358162 | 3300012925 | Vadose Zone Soil | MLAPDEKLKLSPKPYLSATPGFAGGADTPRDFLERCLADLAALE |
| Ga0126375_120364082 | 3300012948 | Tropical Forest Soil | MLAPDATLKLATKPYLSATANFASGSDTPRQFLERCLADLAALEPKIG |
| Ga0164303_114301021 | 3300012957 | Soil | MLAPDEKLKLSPKPYFSATTGFASGADTPRDFLERCL |
| Ga0126369_105621981 | 3300012971 | Tropical Forest Soil | MLAPEEKLRLSPKPYLSATARFASGADTPRDFLERC |
| Ga0126369_129144342 | 3300012971 | Tropical Forest Soil | MLAPEEKLKLVPKPYLDATARFASGADTPRDFLER |
| Ga0164305_105484523 | 3300012989 | Soil | MLAPDEKLKLSPKPYLSATAHFASGTDTPRDFLERCLADL |
| Ga0075344_11468562 | 3300014296 | Natural And Restored Wetlands | MPSSDEKLKLSPKPYLSATAAFAGGADTPRDFLERCLADL |
| Ga0182036_102420911 | 3300016270 | Soil | MLAPEEKLKLVQKPYLDATARFANGADTPRDFLERCLADLA |
| Ga0182041_102263383 | 3300016294 | Soil | MLAPDEKLKLSPKPYLSATARFASGVDTPRDFLERCLADIA |
| Ga0182033_100733011 | 3300016319 | Soil | MLAPEEKLKLVPKPYLDATARFANGADTPRDFLERCLADL |
| Ga0182033_101458181 | 3300016319 | Soil | MLAPEEKLKLSPKPYLAATHRFADGSGSTREFLERCLAV |
| Ga0182033_101780874 | 3300016319 | Soil | MLAPEEKLKLARKPYLAATGQFGDGSDSPRQLLERCLAD |
| Ga0182033_108976812 | 3300016319 | Soil | MLAPDEKLKLSSKPYLSATARFASGADTPRDFLERCLADVAALEP |
| Ga0182032_101932701 | 3300016357 | Soil | MLAPDEKLKLSPKPYLSATARFASSADTPRDFLERCLADIAALEPKIGAFV |
| Ga0182032_120141101 | 3300016357 | Soil | MLAPEEKRKLATKPYLSATRRFADGSDSPRQFLERCL |
| Ga0182034_103309532 | 3300016371 | Soil | MLAPEEKLKLVQKPYLDATARFANGADTPRDFLERCLADL |
| Ga0182038_101489691 | 3300016445 | Soil | VLAPEDKLKFSMKPYLAATARFASGADTPRDFLERC |
| Ga0184620_100058324 | 3300018051 | Groundwater Sediment | MLAPDEKLKLSPKPYLSATPGFAGGADTPRDFLERCLADLA |
| Ga0210407_113327202 | 3300020579 | Soil | MLAPDEKLKLSPKPYFSATARFTSGADTPRDFLERC |
| Ga0213876_104494121 | 3300021384 | Plant Roots | MLAPDEKLKFAEKPYLASTARFASGADTPRDFLERCVADIDRLEPGIGAF |
| Ga0222622_112460081 | 3300022756 | Groundwater Sediment | MLAPDEKLKLSPKPYLSTTPGFAGGADTPRDFLERCLADLAALEPKI |
| Ga0207647_100543344 | 3300025904 | Corn Rhizosphere | MLAQDDKLKLSPKPYLSATPGFAKGADTPRDFLERCLVDLA |
| Ga0207699_101790482 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MTATDTKMKPVMRPYLSETARFASGKDSPRDFLERCLT |
| Ga0207693_110519043 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAPEEKLKLATKPYLATTARFANGADTPRDFLERCLADLAALEPK |
| Ga0207676_112343513 | 3300026095 | Switchgrass Rhizosphere | MLAPDDKLKLSPKPYLPATPAFANGADTPRAFLERCLADL |
| Ga0207675_1001712391 | 3300026118 | Switchgrass Rhizosphere | MLAPDEKLKLSPKPYLSATAHFASGTDTPRDFLELCLADLA |
| Ga0209647_12061183 | 3300026319 | Grasslands Soil | MLAPEEKLKLATKPYLATTARFANGADTPRDFLERCLAD |
| Ga0209058_10212151 | 3300026536 | Soil | MLAPDEKLKLSPKPYLSATARFKTGSETPRDFLERCLAEIAALDPKIGA |
| Ga0209577_100429051 | 3300026552 | Soil | MLAPDEKLKLSPKPYLSATARFKTGSETPRDFLERCLAEIAALDPKIGAFVNL |
| Ga0209325_10089353 | 3300027050 | Forest Soil | MLAPDEKLKLSPKPYLSATAGFASGADTPRKFLERCLADIAALEP |
| Ga0208890_10617762 | 3300027523 | Soil | MLAQDDKLKLSPKPYLSATPGFAKGADTPRDFLER |
| Ga0207428_106124253 | 3300027907 | Populus Rhizosphere | MLAPDEKLKLSPKPYLSATARFASGADTPRDFLERC |
| Ga0268264_124839672 | 3300028381 | Switchgrass Rhizosphere | MLAPDEKLKLSPKPYLSATPRFASGADTPRDFLERCLAD |
| Ga0307286_100939171 | 3300028876 | Soil | MLAPDEKLKLSPKPYLSTTPGFAGGADTPRDFLERCL |
| Ga0308200_11203452 | 3300030905 | Soil | MLAPDEKLKLSPKPYLSATSNFAGGADTPRDFLERC |
| Ga0307498_103590681 | 3300031170 | Soil | MLAQDDKLKLSPKPYLSAAPGFAKGADTPRDFLERCLAD |
| Ga0318516_100511721 | 3300031543 | Soil | MLAPDEKLKLSPKPYLSGTARFANGADTPRDFLERCLADIVA |
| Ga0318516_105757071 | 3300031543 | Soil | MLAPEEKLKLSHKPYLSACPRFADGSDTPRQFLERCLADIAALEP |
| Ga0318534_103782002 | 3300031544 | Soil | MLAPDEKLKLSPKPYLSATARFASGADTPRDFLERCL |
| Ga0318538_102575603 | 3300031546 | Soil | MLAPDEKLKLSPKPYLSATARFASGVDTPRDFLERCLADIAA |
| Ga0318538_102597034 | 3300031546 | Soil | MLAPDEKLKLSPKPYLSATARFASGADTPRDFLERCLADIAALE |
| Ga0318573_100577051 | 3300031564 | Soil | MLAPEEKLKLSPKPYLSACPRFADGSDTPRQFLERCLADI |
| Ga0310915_104196173 | 3300031573 | Soil | VLAPDEKLKLSPKPYLSATARFASGVDTPRDFLERCLADIAA |
| Ga0318555_100662323 | 3300031640 | Soil | MLAPDEKLKLSPKPYLSATARFANGADTPRDFLERCLADI |
| Ga0318492_101712941 | 3300031748 | Soil | MLAPDEKLKLSPKPYLSATARFTSGADTPRDFLERCL |
| Ga0307475_108831211 | 3300031754 | Hardwood Forest Soil | MLAPDEKLKLSPKPYFSATARFTSGADTPRDFLERCL |
| Ga0318554_103009843 | 3300031765 | Soil | MLAPEEKLKLSPKPYLAATHRFADGSGSPREFLERCLAVISELEP |
| Ga0318521_101027901 | 3300031770 | Soil | MLAPEDKLKLVPKPYLEATARFANGADRPRDLLERCLADLAALEPKIGAFVH |
| Ga0318521_104245811 | 3300031770 | Soil | MLAPEEKLKLSPKPYLAATHRFADGSGSPREFLERCLAVISE |
| Ga0318543_100936461 | 3300031777 | Soil | MLAPDEKLKLSPKPYLSATARFASGADTPRDFLERCLADIAALEPK |
| Ga0318508_11442561 | 3300031780 | Soil | MLAPEEKLKLSPKPYLPACPRFADGSDTPRQFLERCLADISALEPK |
| Ga0318547_107720182 | 3300031781 | Soil | MLAPEDKPKLATKPYLAATARFANSADTPRDFLERCLAD |
| Ga0318552_101991331 | 3300031782 | Soil | MLAPDEKLKLSPKPYLSATARFTSGADTPRDFLERCLAD |
| Ga0318548_100292734 | 3300031793 | Soil | MLAPEEKLRLSPKPYLSATARFASGADTPRDFLERCLA |
| Ga0318548_105130451 | 3300031793 | Soil | MLAPDEKLKLSPKPYFSATARFTSGADTPRDFLERCLADIAALEPK |
| Ga0318550_104445311 | 3300031797 | Soil | MLAPEEKLKLSPKPYLAATHRFADGSGSPREFLERT |
| Ga0318565_101407541 | 3300031799 | Soil | MLAPEEKLRLSPKPYLSATARFASGADTPRDFLERCLADVAAL |
| Ga0318567_105964571 | 3300031821 | Soil | MLAPEEKLKLVSRPYLAITPRFKDGSASPREFLEGCLANVK |
| Ga0318517_100304271 | 3300031835 | Soil | MLAPEDKLKLVPKPYLEATARFANGADRPRDLLERCLADLAALEPKIG |
| Ga0318536_104732641 | 3300031893 | Soil | MLAPEEKLKLAGKPYLTMTPRFKDGSASPREFLEGCL |
| Ga0306921_112609701 | 3300031912 | Soil | MLAPEEKLKLSPKPYLSACPRFADGSDTPRQFLERCLADIA |
| Ga0310912_100072658 | 3300031941 | Soil | MLAPEEKLKLATKPYLGATAHFANGADSPRDFLERCLADLAALEPKIG |
| Ga0307479_119878241 | 3300031962 | Hardwood Forest Soil | MLAPDEKLKLSPKPYFSATARFASAADTPRDFLERCLAD |
| Ga0318575_101533921 | 3300032055 | Soil | MLAPEDKLKLVPKPYLEATARFANGADRPRDLLERCLADLAALEPKIGAFVHLN |
| Ga0318524_106143922 | 3300032067 | Soil | MLAPDEKLKLSPKPYLSATARFASGADTPRDFLERCLAD |
| Ga0306924_102737851 | 3300032076 | Soil | MLAPEEKLKLVSRPYLAITPRFKDGSASPREFLEGCLANV |
| Ga0318518_100706234 | 3300032090 | Soil | MLAPEEKLKLSPKPYLSACPRFADGSDTPRQFLERCLADISALEPKI |
| Ga0318518_106009562 | 3300032090 | Soil | MLAPEDKPKLATKPYLAATARFANSADTPRDFLERCLADLA |
| Ga0318577_102017312 | 3300032091 | Soil | MLAPEEKLKLVPKPYLDATARFANGADTPRDFLERCLA |
| Ga0318540_103116203 | 3300032094 | Soil | MLAPDEKLKLSPKPYLSATARFTSGADTPRDFLERCLADVVALEPK |
| Ga0306920_1020116581 | 3300032261 | Soil | MLAPEEKLKLAPKPYLAAVERFGNGSDSPREFLEHC |
| Ga0318519_105009542 | 3300033290 | Soil | MTMLAPEEKLKLVSRPYLAITPRFKDGSASPREFLEGCLA |
| Ga0364923_0003027_2_127 | 3300034690 | Sediment | MTMLAPEEKLKLASKPYLAMTPRFADGSDSPRKFLERCLADL |
| ⦗Top⦘ |