


| Basic Information | |
|---|---|
| Family ID | F078394 |
| Family Type | Metagenome |
| Number of Sequences | 116 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MARARKKTPLTVSRPALLAQGSDAEFRGLIHDLIAYGHKLD |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 81.03 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 96.55 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.379 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (14.655 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.034 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.966 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.88% β-sheet: 0.00% Coil/Unstructured: 68.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF00563 | EAL | 31.90 |
| PF01494 | FAD_binding_3 | 22.41 |
| PF00990 | GGDEF | 6.03 |
| PF13417 | GST_N_3 | 3.45 |
| PF03401 | TctC | 1.72 |
| PF01522 | Polysacc_deac_1 | 1.72 |
| PF02798 | GST_N | 1.72 |
| PF02656 | DUF202 | 0.86 |
| PF00043 | GST_C | 0.86 |
| PF01042 | Ribonuc_L-PSP | 0.86 |
| PF05345 | He_PIG | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 44.83 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 31.90 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 31.90 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 31.90 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 31.90 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 22.41 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 22.41 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 22.41 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 1.72 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.72 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.86 |
| COG0435 | Glutathionyl-hydroquinone reductase | Energy production and conversion [C] | 0.86 |
| COG0625 | Glutathione S-transferase | Posttranslational modification, protein turnover, chaperones [O] | 0.86 |
| COG2149 | Uncharacterized membrane protein YidH, DUF202 family | Function unknown [S] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.38 % |
| Unclassified | root | N/A | 8.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000953|JGI11615J12901_11198485 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300001086|JGI12709J13192_1004424 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1540 | Open in IMG/M |
| 3300001305|C688J14111_10191376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 634 | Open in IMG/M |
| 3300001593|JGI12635J15846_10387248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 847 | Open in IMG/M |
| 3300002128|JGI24036J26619_10080072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 655 | Open in IMG/M |
| 3300002568|C688J35102_119400146 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 688 | Open in IMG/M |
| 3300004156|Ga0062589_101660020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 636 | Open in IMG/M |
| 3300004156|Ga0062589_102442395 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
| 3300004157|Ga0062590_101744539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 636 | Open in IMG/M |
| 3300004463|Ga0063356_100225145 | All Organisms → cellular organisms → Bacteria | 2242 | Open in IMG/M |
| 3300004463|Ga0063356_104449269 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 603 | Open in IMG/M |
| 3300004479|Ga0062595_102609817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 507 | Open in IMG/M |
| 3300005169|Ga0066810_10094606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 653 | Open in IMG/M |
| 3300005177|Ga0066690_10234817 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300005179|Ga0066684_10698776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 679 | Open in IMG/M |
| 3300005330|Ga0070690_100903232 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 691 | Open in IMG/M |
| 3300005332|Ga0066388_106138573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 607 | Open in IMG/M |
| 3300005340|Ga0070689_100205303 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1611 | Open in IMG/M |
| 3300005343|Ga0070687_100503640 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 816 | Open in IMG/M |
| 3300005343|Ga0070687_100886728 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 638 | Open in IMG/M |
| 3300005438|Ga0070701_10555683 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300005438|Ga0070701_10699892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 681 | Open in IMG/M |
| 3300005440|Ga0070705_100641704 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 827 | Open in IMG/M |
| 3300005446|Ga0066686_10643786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 720 | Open in IMG/M |
| 3300005450|Ga0066682_10745906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 596 | Open in IMG/M |
| 3300005451|Ga0066681_10771518 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300005454|Ga0066687_10502569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 717 | Open in IMG/M |
| 3300005454|Ga0066687_10898266 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300005529|Ga0070741_10748504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 858 | Open in IMG/M |
| 3300005536|Ga0070697_101041749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 728 | Open in IMG/M |
| 3300005539|Ga0068853_102204090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 534 | Open in IMG/M |
| 3300005544|Ga0070686_101543185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 561 | Open in IMG/M |
| 3300005549|Ga0070704_101176466 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 699 | Open in IMG/M |
| 3300005552|Ga0066701_10034613 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2661 | Open in IMG/M |
| 3300005556|Ga0066707_10882846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 549 | Open in IMG/M |
| 3300005557|Ga0066704_10863370 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 560 | Open in IMG/M |
| 3300005576|Ga0066708_10442725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 834 | Open in IMG/M |
| 3300005586|Ga0066691_10122991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1474 | Open in IMG/M |
| 3300005841|Ga0068863_101607906 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 659 | Open in IMG/M |
| 3300006032|Ga0066696_10490960 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 806 | Open in IMG/M |
| 3300006046|Ga0066652_101341540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 673 | Open in IMG/M |
| 3300006804|Ga0079221_10564580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 757 | Open in IMG/M |
| 3300006844|Ga0075428_101774500 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 643 | Open in IMG/M |
| 3300006844|Ga0075428_102229278 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 565 | Open in IMG/M |
| 3300006854|Ga0075425_100707438 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1157 | Open in IMG/M |
| 3300006854|Ga0075425_102855284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 531 | Open in IMG/M |
| 3300006894|Ga0079215_10094907 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1297 | Open in IMG/M |
| 3300006894|Ga0079215_10420465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 798 | Open in IMG/M |
| 3300007004|Ga0079218_11280336 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 770 | Open in IMG/M |
| 3300009078|Ga0105106_10787049 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300009094|Ga0111539_13010519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23 | 544 | Open in IMG/M |
| 3300009147|Ga0114129_12011906 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 698 | Open in IMG/M |
| 3300009176|Ga0105242_12763177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23 | 541 | Open in IMG/M |
| 3300010360|Ga0126372_12590807 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 558 | Open in IMG/M |
| 3300010400|Ga0134122_11942172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 625 | Open in IMG/M |
| 3300010401|Ga0134121_11266357 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 741 | Open in IMG/M |
| 3300011432|Ga0137428_1168850 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 649 | Open in IMG/M |
| 3300012041|Ga0137430_1168952 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 631 | Open in IMG/M |
| 3300012041|Ga0137430_1168953 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 631 | Open in IMG/M |
| 3300012096|Ga0137389_10504618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1038 | Open in IMG/M |
| 3300012198|Ga0137364_11234800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 559 | Open in IMG/M |
| 3300012205|Ga0137362_10376339 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1230 | Open in IMG/M |
| 3300012225|Ga0137434_1047594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 649 | Open in IMG/M |
| 3300012685|Ga0137397_11347053 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
| 3300012923|Ga0137359_11552554 | Not Available | 550 | Open in IMG/M |
| 3300012925|Ga0137419_10537548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 932 | Open in IMG/M |
| 3300012943|Ga0164241_11428886 | Not Available | 509 | Open in IMG/M |
| 3300012944|Ga0137410_10651932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 874 | Open in IMG/M |
| 3300012961|Ga0164302_11916735 | Not Available | 504 | Open in IMG/M |
| 3300012984|Ga0164309_10802803 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 758 | Open in IMG/M |
| 3300014885|Ga0180063_1244052 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300014968|Ga0157379_12223429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 545 | Open in IMG/M |
| 3300015054|Ga0137420_1145438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1065 | Open in IMG/M |
| 3300015054|Ga0137420_1234060 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1316 | Open in IMG/M |
| 3300015259|Ga0180085_1065375 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1050 | Open in IMG/M |
| 3300015359|Ga0134085_10454721 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 581 | Open in IMG/M |
| 3300015371|Ga0132258_13836628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1023 | Open in IMG/M |
| 3300018422|Ga0190265_10502899 | Not Available | 1324 | Open in IMG/M |
| 3300018466|Ga0190268_11049989 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 656 | Open in IMG/M |
| 3300018468|Ga0066662_11802996 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 640 | Open in IMG/M |
| 3300018469|Ga0190270_12766073 | Not Available | 553 | Open in IMG/M |
| 3300020202|Ga0196964_10336843 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 720 | Open in IMG/M |
| 3300021066|Ga0196980_1005479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1986 | Open in IMG/M |
| 3300021080|Ga0210382_10446972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 572 | Open in IMG/M |
| 3300022756|Ga0222622_11251079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23 | 546 | Open in IMG/M |
| 3300025907|Ga0207645_10098736 | Not Available | 1883 | Open in IMG/M |
| 3300025917|Ga0207660_11581309 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
| 3300026116|Ga0207674_10229063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1806 | Open in IMG/M |
| 3300026118|Ga0207675_102154822 | Not Available | 573 | Open in IMG/M |
| 3300026118|Ga0207675_102185462 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 569 | Open in IMG/M |
| 3300026121|Ga0207683_10072035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3056 | Open in IMG/M |
| 3300026296|Ga0209235_1098384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1266 | Open in IMG/M |
| 3300026313|Ga0209761_1118033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1294 | Open in IMG/M |
| 3300026319|Ga0209647_1097369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1410 | Open in IMG/M |
| 3300026320|Ga0209131_1246871 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 727 | Open in IMG/M |
| 3300026333|Ga0209158_1011182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4389 | Open in IMG/M |
| 3300026532|Ga0209160_1263499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 585 | Open in IMG/M |
| 3300027381|Ga0208983_1028628 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1090 | Open in IMG/M |
| 3300027462|Ga0210000_1028182 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 874 | Open in IMG/M |
| 3300027886|Ga0209486_10077870 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1718 | Open in IMG/M |
| 3300027886|Ga0209486_10478607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 770 | Open in IMG/M |
| 3300028536|Ga0137415_10661569 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 856 | Open in IMG/M |
| 3300028803|Ga0307281_10101663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 967 | Open in IMG/M |
| 3300030620|Ga0302046_11016018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 659 | Open in IMG/M |
| 3300031548|Ga0307408_100149706 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1841 | Open in IMG/M |
| 3300031716|Ga0310813_10679208 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 918 | Open in IMG/M |
| 3300031716|Ga0310813_11911286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 559 | Open in IMG/M |
| 3300031720|Ga0307469_11430222 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 660 | Open in IMG/M |
| 3300031731|Ga0307405_10542974 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 939 | Open in IMG/M |
| 3300031731|Ga0307405_10797427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23 | 791 | Open in IMG/M |
| 3300031740|Ga0307468_100124640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1594 | Open in IMG/M |
| 3300032126|Ga0307415_102521903 | Not Available | 507 | Open in IMG/M |
| 3300032205|Ga0307472_101953951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 586 | Open in IMG/M |
| 3300032770|Ga0335085_12162638 | Not Available | 560 | Open in IMG/M |
| 3300033550|Ga0247829_10300935 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300034148|Ga0364927_0251268 | Not Available | 530 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 14.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.62% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.62% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 5.17% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 5.17% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.17% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.31% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.31% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 4.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.45% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.45% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.59% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.59% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.59% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 1.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.72% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.86% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.86% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.86% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.86% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.86% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.86% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300001086 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002128 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011432 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2 | Environmental | Open in IMG/M |
| 3300012041 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012225 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2 | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300020202 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10 | Environmental | Open in IMG/M |
| 3300021066 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3_10-13C | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11615J12901_111984853 | 3300000953 | Soil | MARARRVPAPPATVSRAALLVGGSDAEFRGLIHDLIAYGHRLDACRDAFAR |
| JGI12709J13192_10044245 | 3300001086 | Forest Soil | MPRSMAKARKRGTPPPTISRRALLVDGSDGEFRGLIHDLIAYGHR |
| C688J14111_101913761 | 3300001305 | Soil | MARTRRKAAPPPTVSRPALLVEGSDAEFRGLIHDLIAYGHRL |
| JGI12635J15846_103872481 | 3300001593 | Forest Soil | MPRSMAKARKRGTPPPTISRRALLVDGSDGEFRGLIHDLIAY |
| JGI24036J26619_100800721 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | MARARRRIPPLPPPTVSRAALLSRGSDAEFRGLIHDLIAYGHKLDACRDAFATIAG |
| C688J35102_1194001462 | 3300002568 | Soil | MARTRRKAAPPPTVSRPALLVEGSDAEFRGLIHDLIAYGHRLDACRDA |
| Ga0062589_1016600201 | 3300004156 | Soil | MARTRKKAPLTVSRPALLAQGSDAEFRGLIHDLIAYGHKL |
| Ga0062589_1024423951 | 3300004156 | Soil | MARPRKRPPTVSRKALLSEGSDAEFRLLIHDLIAYGHKLDACRDAFAAIAGI |
| Ga0062590_1017445393 | 3300004157 | Soil | MARTRKKPPLTVSRPALLTQGSDAEFRGLIHDLIAYGHKL |
| Ga0063356_1002251452 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MARARKKTPLTVSRPALLAQGSDAEFRGLIHDLIAYGHKLD |
| Ga0063356_1044492693 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MARVRKKAPPTVSRPALLSGGSDTEFRGLIHDLIAYGHKL |
| Ga0062595_1026098171 | 3300004479 | Soil | MARPRRRKPAPVFNASAPVTVSRAALLVEGSDAEFRGLIHDLI |
| Ga0066810_100946061 | 3300005169 | Soil | MARVRKRSTAPLTVSRPALLVEGSDTEFREFIHDLIACGHRLDACR |
| Ga0066690_102348171 | 3300005177 | Soil | MGKTRRRSTPPHTISRPALLVDGSDGEFRGLIHDLIAYGHRL |
| Ga0066684_106987761 | 3300005179 | Soil | MARPLRRKAAPVFNAALPVTVSRAALLVEGSDAEFRGLIHDLIAYGH |
| Ga0070690_1009032323 | 3300005330 | Switchgrass Rhizosphere | MARPRRRKAAPVFNATAPATVSRSALLVEGSDAEFRGLIHDLIAYGH |
| Ga0066388_1061385731 | 3300005332 | Tropical Forest Soil | MMARARRRHLTVSRPPLLVDGSDAEFRGLIHDLIAYGHKLDA |
| Ga0070689_1002053031 | 3300005340 | Switchgrass Rhizosphere | MPRARRRPVTVSRRALLAGGSDAEFRGLIHDLIAYGHKLDACRDAFAAIAG |
| Ga0070687_1005036401 | 3300005343 | Switchgrass Rhizosphere | MARVRKKGPPPTVSRAALLSRGSDAEFRGLIHDLIAYGHKLDACRDAF |
| Ga0070687_1008867281 | 3300005343 | Switchgrass Rhizosphere | MARRRPHPPTVSRKALLAGGSDAEFRGLIHDLIAYGHKLDACRDAF |
| Ga0070701_105556831 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MARARRVPAPPATVSRAALLVGGSDAEFRGLIHDLIAYGH |
| Ga0070701_106998921 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MARVRRKSPPPTVSRAALLSRGSDAEFRGLIHDLIAYGHKLDACRDAFAAIAG |
| Ga0070705_1006417043 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MARPRRRKAAPAFNAQPPATVSRPALLVAGSDAEFRGLIHDLIAYGHRL |
| Ga0066686_106437861 | 3300005446 | Soil | MARARKGTYPKGYPLTVSRPPLLTRGSDAQFRQLIHDLIAYGHRL |
| Ga0066682_107459061 | 3300005450 | Soil | MARTRRRGAPPRTISRPALLVDGSDGEFRGLIHDLIAYGHRLDACRDA |
| Ga0066681_107715182 | 3300005451 | Soil | MPRSMPRPRRKAAPPATVSRPALLVEGSDAEFRGLIHDLIAY |
| Ga0066687_105025691 | 3300005454 | Soil | MARSRRKSAPPPTVSRAALLVEGSDAAFRGLIHDLIAYGHR |
| Ga0066687_108982661 | 3300005454 | Soil | MARPRRRKAAPAFNATAPATVSRSALLVEGSDAEFRGLIHDLIAYGHRLD |
| Ga0070741_107485041 | 3300005529 | Surface Soil | MPRSMARARRKSGPPATVSRPALLVDGSDAEFRRLIHDLIAYGHRLDACRD |
| Ga0070697_1010417492 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MARPRRRKAAPAFNAAPPATVSRAALLVGGTDAEFRGLIHDLIAYGH |
| Ga0068853_1022040901 | 3300005539 | Corn Rhizosphere | MARVRRKSPPPTVSRAALLSRGSDAEFRGLIHDLIAYGHKLDACRDAFAAIAGIS |
| Ga0070686_1015431851 | 3300005544 | Switchgrass Rhizosphere | MARVRKKGPPPTVSRAALLSRGSDAEFRGLIHDLIAYGHKLDACRDAFAAIAG |
| Ga0070704_1011764661 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRARKRPATVSRPALLAGGSDAEFRGLIHDLIAYGHKLDACRDAFAAIAG |
| Ga0066701_100346135 | 3300005552 | Soil | MARPRRRKAAPVFNAALPATVSRAALLVEGSDAEFRGLIH |
| Ga0066707_108828462 | 3300005556 | Soil | MARPRRRKAAPVFNAALPATVSRAALLVEGSDAEFRGLIHDLIAYGHRLDTCRDAFA |
| Ga0066704_108633703 | 3300005557 | Soil | MARLRRNALAPPTVSRPALLVDGSDAEFRRLIHDLIA |
| Ga0066708_104427252 | 3300005576 | Soil | MPRSMARSRRKTTPPVTVSRTALLVDGSDAEFRGLI |
| Ga0066691_101229911 | 3300005586 | Soil | MAKARKRGAPPRTISRPALLVDGSDGEFRGLIHDLIAYGHRLDACRDA |
| Ga0068863_1016079062 | 3300005841 | Switchgrass Rhizosphere | MSRPRKRPRTVSRKALLVEGSDAEFRGLIHDLIAYGH |
| Ga0066696_104909601 | 3300006032 | Soil | MAASMARPRRRKAAPAFNAAPPVTVSRAALLVEGSDAEFRGLIHDLIAYGHRLD |
| Ga0066652_1013415401 | 3300006046 | Soil | MRRSMARVRRKTPPATVSRAALLVGGSDAEFRGLIHDLIAYGH |
| Ga0079221_105645802 | 3300006804 | Agricultural Soil | MRRSMARTRRKAATPPTVSRPALLVGGSDAEFRSLNHDLIAYGHRLDACRDVFA |
| Ga0075428_1017745001 | 3300006844 | Populus Rhizosphere | MPRARKKALPLTVSRAALLPSGSDAEFRGLIHDLIAYGHKLDACRDAFAAI |
| Ga0075428_1022292781 | 3300006844 | Populus Rhizosphere | MPRKRGRPPTVSRKALLSEGSDAEFRGLIHDLIAYGHKLDACR |
| Ga0075425_1007074382 | 3300006854 | Populus Rhizosphere | MPRPRKRPVTVSRAALLSGGSDGEFRGLIHDLIAYGHKLD |
| Ga0075425_1028552841 | 3300006854 | Populus Rhizosphere | MRRSMARARRKAVPPSTVSRPALLVGGSDAEFRRLIHDLIAYG |
| Ga0079215_100949073 | 3300006894 | Agricultural Soil | MPRARKKTPLTVSRAALLSQGSDAEFRGLFHDLIAYTHKLDACCAPSAVIAPI |
| Ga0079215_104204653 | 3300006894 | Agricultural Soil | MARSRKKTPLTVSRAALLARGSDAEFRGLIHDLIAYGHKLD |
| Ga0079218_112803361 | 3300007004 | Agricultural Soil | MAKQRRRPATVSRPALLAGGSDAEFRGLIHDLIAYGHKLDACRDAFAAIAGI |
| Ga0105106_107870493 | 3300009078 | Freshwater Sediment | MARPRDRKTPPTVSRPALLVEGSDAQFRELIHDLIAYGHRLD |
| Ga0111539_130105192 | 3300009094 | Populus Rhizosphere | MPRPRKRPPTVSRKALLVESSDAEFRGLIHDLIAYGHRLDACRDGFAAVAG |
| Ga0114129_120119061 | 3300009147 | Populus Rhizosphere | MPRKKPRPLTASRPALLAQGSDAAFRGLIHDLIAY |
| Ga0105242_127631772 | 3300009176 | Miscanthus Rhizosphere | VTVSRRALLAGGSDAEFRGLIHDLIAYGHKLDACRDAFAAIAG |
| Ga0126372_125908073 | 3300010360 | Tropical Forest Soil | MALPRRRRAAPPFNATAPVTVSRAALLVEGSDAEFRSLIHDLIA |
| Ga0134122_119421721 | 3300010400 | Terrestrial Soil | MPRPRKRPRTVSRKALLVEGSDTEFRGLIHDLIAYGHRLDACRD |
| Ga0134121_112663572 | 3300010401 | Terrestrial Soil | MARPRRKSVVPATVSRPALLVDGSDAEFRGLIHDLIAYGHRLDAC |
| Ga0137428_11688501 | 3300011432 | Soil | MARTRKRTPPLTVSRQALLARGGDAEFRGLIHDLIAYGHKLDACRDAF |
| Ga0137430_11689523 | 3300012041 | Soil | MARARRKHLPLTVSRPGLLARGSDAEFRGLIHDLIAYGHKLDACRDAFAAIAGV |
| Ga0137430_11689533 | 3300012041 | Soil | MPRARRKHLPLTVSRPGLLARGSDAEFRGLIHDLIAYGHKLDACRDAFAAIAGV |
| Ga0137389_105046183 | 3300012096 | Vadose Zone Soil | MAKARKGSTPPSTVSRPALLVGGSDGEFRKLIHDLIAYGHRL |
| Ga0137364_112348001 | 3300012198 | Vadose Zone Soil | MARTRKLSTPPHTISRPALLVDGSDGEFRGLIHDLIAYGHRLDACR |
| Ga0137362_103763391 | 3300012205 | Vadose Zone Soil | MAKARKGSTPPSTVSRPALLVGGSDGAFRGLIHDLIAYGHRLDACRDAFAAI |
| Ga0137434_10475941 | 3300012225 | Soil | MAKSRRKGAPPATVSRPALLAKGTDEAFRGLIHDL |
| Ga0137397_113470532 | 3300012685 | Vadose Zone Soil | MARARRKTDPLTVSRPPLLTRGSDAQFRQLIHDLIAYG |
| Ga0137359_115525541 | 3300012923 | Vadose Zone Soil | MAKARKGSTPPSTVSRPALLVGGSDGAFRGLIHDLIAYGHRLDACRDAFAAIVGIS |
| Ga0137419_105375482 | 3300012925 | Vadose Zone Soil | MAKTRRRSTPPRTISRPALLVDGSDGEFRGLIHDLIAYGH |
| Ga0164241_114288863 | 3300012943 | Soil | MARARKKAAPLTVSRPALLAQGSDAEFRGLVHDLIAYGHKLD |
| Ga0137410_106519321 | 3300012944 | Vadose Zone Soil | MKMQRSMAKARKGSTPPSTVSRPALLVDGSDGEFRKLIHDLIAYGHRLDACRDA |
| Ga0164302_119167352 | 3300012961 | Soil | MSRARRRNSVPLTVSRPALLAEGSDAQFRGFIHDLIGYG |
| Ga0164309_108028032 | 3300012984 | Soil | MARARRKSVPPATVSRPALLVDGSDDEFRDLIHDLIA |
| Ga0180063_12440522 | 3300014885 | Soil | MPRPRKKNPPLTVSRPALLARGSDDEFRGLIHDLIAYGHKLDACRDAFAAIAG |
| Ga0157379_122234292 | 3300014968 | Switchgrass Rhizosphere | MSRARRRNSVPLTVSRPALLAEGSDAQFRGFIHDLIGYGRRLDECR |
| Ga0137420_11454381 | 3300015054 | Vadose Zone Soil | MKMQRSMAKARKGSTPPSTVSRPALLVGGSDGEFRKLIHDLIAYG |
| Ga0137420_12340601 | 3300015054 | Vadose Zone Soil | MKMQRSMAKARKGSTPPSTVSRPPSTVSRPALLVGGSDGEFRGLIHDLIAYGHRL |
| Ga0180085_10653754 | 3300015259 | Soil | MPRPRKKNPPLTVSRPALLGRGSDAEFRGLIHDLIAYGHKLDACRDAFA |
| Ga0134085_104547211 | 3300015359 | Grasslands Soil | MARPRRRKAAPVFNAALPATVSRSALLVEGSDAEFRGLIHDLIAYGH |
| Ga0132258_138366281 | 3300015371 | Arabidopsis Rhizosphere | MARPRRRPATVSRKALLAGGSDAEFRGLIHDLIAYG |
| Ga0190265_105028992 | 3300018422 | Soil | MARARRKSTPRTPPPTVGRAALLCGGSDAEFRGLIHDLIAYGHKLD |
| Ga0190268_110499893 | 3300018466 | Soil | MARARKRAAPPPTVSRAALLAGGSDAEFRGLIHDLIAYGHK |
| Ga0066662_118029962 | 3300018468 | Grasslands Soil | MARLRRRKPAPVFNAAPPVTVSRAALLVEGSDAAFRGLIHDLI |
| Ga0190270_127660731 | 3300018469 | Soil | MARARRKSPPPTVSRAALLSRGSDAEFRGLIHDLIAYGHKLDACRDA |
| Ga0196964_103368432 | 3300020202 | Soil | MARKKAVPLTVSRPALLVKGADTEFRSLIHDLIAYGHKLDACRDAFAAI |
| Ga0196980_10054791 | 3300021066 | Soil | MAGPRKKSPPLTVSRPALLARGSDAEFRGLIHDLIAYGHKLDACRD |
| Ga0210382_104469722 | 3300021080 | Groundwater Sediment | MRRSMAKARKGSTPPSTVSRPALLVGGSDGEFRKLIHDLIAYGHRLDACR |
| Ga0222622_112510791 | 3300022756 | Groundwater Sediment | MPRRRSRPGARPATVSRKALLAGGSDAAFRGLIHDL |
| Ga0207645_100987361 | 3300025907 | Miscanthus Rhizosphere | MARARRRIPPLPPPTVSRAALLSRGSDAEFRGLIHDLIAYGHKLDA |
| Ga0207660_115813092 | 3300025917 | Corn Rhizosphere | MARARRVPAPPATVSRAALLVGGSDAEFRGLIHDLIAYGHRLDA |
| Ga0207674_102290632 | 3300026116 | Corn Rhizosphere | MARRRPHPPTVSRKALLAGGSDAEFRGLIHDLIAYGHKLDA |
| Ga0207675_1021548222 | 3300026118 | Switchgrass Rhizosphere | MSRPRKRNDLPVTVSARLLAGGSDAEFREFILDLIGYGHR |
| Ga0207675_1021854623 | 3300026118 | Switchgrass Rhizosphere | MARVRKKAPPTVSRPALLSGGSDTEFRGLIHDLIA |
| Ga0207683_100720356 | 3300026121 | Miscanthus Rhizosphere | MARARRKSPPPTVSRAALLSRGSDAEFRGLIHDLIAYG |
| Ga0209235_10983841 | 3300026296 | Grasslands Soil | MPRSMARTRRRGAPPRTISRPALLVDGSDGEFRGLIHDLIAYGHRLDACRDA |
| Ga0209761_11180332 | 3300026313 | Grasslands Soil | MPRSMARTRRRGAPPRTISRPALLVDGSDGEFRGLIHDLIAYGHRLDA |
| Ga0209647_10973691 | 3300026319 | Grasslands Soil | MARPRKRPHTVSRRALLSEGSDAEFRLLIHDLIAYGHKLDA |
| Ga0209131_12468711 | 3300026320 | Grasslands Soil | MPRSMARSRRKSTPPATVSRTALLVDGSDAEFRGLIHDLIAYG |
| Ga0209158_10111826 | 3300026333 | Soil | MAKARKRGAPPRTISRPALLVDGSDGEFRGLIHDLIAYGHRLDACRDAFA |
| Ga0209160_12634991 | 3300026532 | Soil | MARLRRNALAPPTVSRPALLVDGSDAEFRRLIHDLIAYGHRLD |
| Ga0208983_10286283 | 3300027381 | Forest Soil | MRRSMAKARKGSTPPSTVSRPALLVGGSDGEFRKLIHDLIAYGH |
| Ga0210000_10281821 | 3300027462 | Arabidopsis Thaliana Rhizosphere | MARPRKPKAPLTVSRSALLAGGSDAEFRNLIHDLIAYGHKLDACRDAFAAIAG |
| Ga0209486_100778702 | 3300027886 | Agricultural Soil | MARARKKVPLTVSRSALLAQGSDAEFRGLVHDLIAYGHKLDACRDAFAAIAG |
| Ga0209486_104786071 | 3300027886 | Agricultural Soil | MARARKKAASPSTVSRAALLVDGSDAEFRQLIHDLIAYGHRLDACRDAF |
| Ga0137415_106615691 | 3300028536 | Vadose Zone Soil | MHRSMAKARKGSTPPSTVSRPALLVGGSDGEFRGLIHDLIAYGHRLDACRDAFAAI |
| Ga0307281_101016631 | 3300028803 | Soil | MRRSRKRPHTVSRRALLSEGSDAEFRGLIHDLIAYGHKLDACRD |
| Ga0302046_110160181 | 3300030620 | Soil | MARARKRNAAPPATVSRPALLVKGSDAEFRRLIHD |
| Ga0307408_1001497063 | 3300031548 | Rhizosphere | MARARKKAPPTVSRPALLSGGSDAEFRGLIHDLIAYGHKLDACRDAF |
| Ga0310813_106792082 | 3300031716 | Soil | MPASMARKKSTPLTVSRPALLVKGADGEFRSLIHDLIAYGH |
| Ga0310813_119112862 | 3300031716 | Soil | MPRPRKRPPTVSRKALLREGSDAEFRLLIHDLIAYGHKLDAC |
| Ga0307469_114302223 | 3300031720 | Hardwood Forest Soil | MARPRRRRAAPASHAAPPATVSRAALLVEGSDAEFRGLIHD |
| Ga0307405_105429742 | 3300031731 | Rhizosphere | MARARKKVPLTVSRSALLAQGSDTEFRGLVHDLIACGHKLDACRDA |
| Ga0307405_107974272 | 3300031731 | Rhizosphere | MARSRKRPTTVSRKALLAGGSDAEFRGLIHDLIAYGHKLDACRDAFAAIAGVS |
| Ga0307468_1001246401 | 3300031740 | Hardwood Forest Soil | MPASMARLRRTALPPPTVSRPALLVGGSDAEFRRLI |
| Ga0307415_1025219033 | 3300032126 | Rhizosphere | MARARKKTAPLTVSRPALLAQGSDTEFRGLVHDLIAYGHKLDA |
| Ga0307472_1019539511 | 3300032205 | Hardwood Forest Soil | MPRSRKRPHTVSRRSLLAGGSDAEFRGLIHDLIAYGHRLDACRDAFAAI |
| Ga0335085_121626381 | 3300032770 | Soil | MPKARKRNAVPLTVSRPALLVEGSDAQFRGFIHDLIGYG |
| Ga0247829_103009353 | 3300033550 | Soil | MARSRKKTPLTVSRAALLTRGSDAEFRGLIHDLIAYGHKLDA |
| Ga0364927_0251268_2_106 | 3300034148 | Sediment | MPRPRRKPLPLTVSRPGLLARGSDAEFRGLIHDLI |
| ⦗Top⦘ |