


| Basic Information | |
|---|---|
| Family ID | F078131 |
| Family Type | Metagenome |
| Number of Sequences | 116 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MKIYVLLMLIGVIVAFSYLPSFGRAKPVPPAPPDSVPA |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 81.90 % |
| % of genes near scaffold ends (potentially truncated) | 13.79 % |
| % of genes from short scaffolds (< 2000 bps) | 79.31 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.966 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland (17.241 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.138 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.207 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF01972 | SDH_sah | 17.24 |
| PF01343 | Peptidase_S49 | 12.07 |
| PF05175 | MTS | 9.48 |
| PF09413 | DUF2007 | 7.76 |
| PF02091 | tRNA-synt_2e | 6.03 |
| PF11295 | DUF3096 | 1.72 |
| PF00348 | polyprenyl_synt | 1.72 |
| PF04011 | LemA | 0.86 |
| PF00535 | Glycos_transf_2 | 0.86 |
| PF09360 | zf-CDGSH | 0.86 |
| PF08544 | GHMP_kinases_C | 0.86 |
| PF14076 | DUF4258 | 0.86 |
| PF13659 | Obsolete Pfam Family | 0.86 |
| PF01872 | RibD_C | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 58.62 |
| COG0752 | Glycyl-tRNA synthetase, alpha subunit | Translation, ribosomal structure and biogenesis [J] | 6.03 |
| COG0142 | Geranylgeranyl pyrophosphate synthase | Coenzyme transport and metabolism [H] | 1.72 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.86 |
| COG1704 | Magnetosome formation protein MamQ, lipoprotein antigen LemA family | Cell wall/membrane/envelope biogenesis [M] | 0.86 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.97 % |
| Unclassified | root | N/A | 31.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10006283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 8275 | Open in IMG/M |
| 3300004082|Ga0062384_101051922 | Not Available | 585 | Open in IMG/M |
| 3300004091|Ga0062387_100072435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1750 | Open in IMG/M |
| 3300004152|Ga0062386_100678655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris | 845 | Open in IMG/M |
| 3300005531|Ga0070738_10020697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 5016 | Open in IMG/M |
| 3300005531|Ga0070738_10254043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 764 | Open in IMG/M |
| 3300005532|Ga0070739_10013237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 7526 | Open in IMG/M |
| 3300005534|Ga0070735_10268973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1031 | Open in IMG/M |
| 3300005541|Ga0070733_10158059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1473 | Open in IMG/M |
| 3300005541|Ga0070733_10165259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1440 | Open in IMG/M |
| 3300005921|Ga0070766_11042042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis | 563 | Open in IMG/M |
| 3300006059|Ga0075017_100967986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 662 | Open in IMG/M |
| 3300006059|Ga0075017_101276470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 576 | Open in IMG/M |
| 3300006086|Ga0075019_10141707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1401 | Open in IMG/M |
| 3300009518|Ga0116128_1055972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1232 | Open in IMG/M |
| 3300009519|Ga0116108_1043106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1450 | Open in IMG/M |
| 3300009519|Ga0116108_1070408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1083 | Open in IMG/M |
| 3300009521|Ga0116222_1257520 | Not Available | 753 | Open in IMG/M |
| 3300009522|Ga0116218_1356538 | Not Available | 653 | Open in IMG/M |
| 3300009523|Ga0116221_1172365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae | 940 | Open in IMG/M |
| 3300009524|Ga0116225_1092590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1407 | Open in IMG/M |
| 3300009643|Ga0116110_1099546 | Not Available | 990 | Open in IMG/M |
| 3300009645|Ga0116106_1116938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 859 | Open in IMG/M |
| 3300009683|Ga0116224_10285931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 785 | Open in IMG/M |
| 3300009764|Ga0116134_1130756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 894 | Open in IMG/M |
| 3300009764|Ga0116134_1246041 | Not Available | 617 | Open in IMG/M |
| 3300009839|Ga0116223_10867848 | Not Available | 515 | Open in IMG/M |
| 3300010343|Ga0074044_10025840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4186 | Open in IMG/M |
| 3300010343|Ga0074044_10214353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1277 | Open in IMG/M |
| 3300010343|Ga0074044_10243661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1188 | Open in IMG/M |
| 3300010343|Ga0074044_10690706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 666 | Open in IMG/M |
| 3300010379|Ga0136449_101716480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 945 | Open in IMG/M |
| 3300010379|Ga0136449_103222287 | Not Available | 630 | Open in IMG/M |
| 3300010379|Ga0136449_103426388 | Not Available | 606 | Open in IMG/M |
| 3300010379|Ga0136449_103655120 | Not Available | 582 | Open in IMG/M |
| 3300014152|Ga0181533_1034064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2892 | Open in IMG/M |
| 3300014164|Ga0181532_10630524 | Not Available | 581 | Open in IMG/M |
| 3300014165|Ga0181523_10124495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1533 | Open in IMG/M |
| 3300014200|Ga0181526_10832080 | Not Available | 581 | Open in IMG/M |
| 3300014200|Ga0181526_10893295 | Not Available | 559 | Open in IMG/M |
| 3300014489|Ga0182018_10022611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 4115 | Open in IMG/M |
| 3300014495|Ga0182015_10018653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 5764 | Open in IMG/M |
| 3300014501|Ga0182024_10055541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 6200 | Open in IMG/M |
| 3300014501|Ga0182024_10131161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3562 | Open in IMG/M |
| 3300017822|Ga0187802_10030181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1919 | Open in IMG/M |
| 3300017925|Ga0187856_1000460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 37287 | Open in IMG/M |
| 3300017928|Ga0187806_1387888 | Not Available | 502 | Open in IMG/M |
| 3300017929|Ga0187849_1020187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3774 | Open in IMG/M |
| 3300017931|Ga0187877_1056928 | Not Available | 1757 | Open in IMG/M |
| 3300017933|Ga0187801_10027056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1990 | Open in IMG/M |
| 3300017934|Ga0187803_10044157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1764 | Open in IMG/M |
| 3300017936|Ga0187821_10362190 | Not Available | 587 | Open in IMG/M |
| 3300017946|Ga0187879_10037576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2900 | Open in IMG/M |
| 3300017946|Ga0187879_10149671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1321 | Open in IMG/M |
| 3300017946|Ga0187879_10227320 | Not Available | 1043 | Open in IMG/M |
| 3300017955|Ga0187817_10828515 | Not Available | 591 | Open in IMG/M |
| 3300017959|Ga0187779_11030524 | Not Available | 572 | Open in IMG/M |
| 3300017961|Ga0187778_10398240 | Not Available | 903 | Open in IMG/M |
| 3300017970|Ga0187783_10223139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1381 | Open in IMG/M |
| 3300017970|Ga0187783_10758770 | Not Available | 700 | Open in IMG/M |
| 3300017972|Ga0187781_10102077 | Not Available | 1993 | Open in IMG/M |
| 3300017972|Ga0187781_10239205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1284 | Open in IMG/M |
| 3300017972|Ga0187781_11225165 | Not Available | 552 | Open in IMG/M |
| 3300017974|Ga0187777_10550275 | Not Available | 810 | Open in IMG/M |
| 3300017974|Ga0187777_11471246 | Not Available | 504 | Open in IMG/M |
| 3300017975|Ga0187782_10073029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2506 | Open in IMG/M |
| 3300017975|Ga0187782_11542914 | Not Available | 524 | Open in IMG/M |
| 3300018004|Ga0187865_1306942 | Not Available | 523 | Open in IMG/M |
| 3300018017|Ga0187872_10096142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1489 | Open in IMG/M |
| 3300018022|Ga0187864_10275013 | Not Available | 762 | Open in IMG/M |
| 3300018033|Ga0187867_10419995 | Not Available | 740 | Open in IMG/M |
| 3300018037|Ga0187883_10175930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1099 | Open in IMG/M |
| 3300018038|Ga0187855_10020712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 4302 | Open in IMG/M |
| 3300018038|Ga0187855_10191075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1211 | Open in IMG/M |
| 3300018047|Ga0187859_10133936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1309 | Open in IMG/M |
| 3300018057|Ga0187858_10413446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 836 | Open in IMG/M |
| 3300018058|Ga0187766_10509605 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300018062|Ga0187784_10011610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7113 | Open in IMG/M |
| 3300018062|Ga0187784_10341454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1214 | Open in IMG/M |
| 3300018062|Ga0187784_10412338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1092 | Open in IMG/M |
| 3300018062|Ga0187784_10520546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 958 | Open in IMG/M |
| 3300018062|Ga0187784_11494191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 535 | Open in IMG/M |
| 3300018085|Ga0187772_10023807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3565 | Open in IMG/M |
| 3300018085|Ga0187772_10413548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 940 | Open in IMG/M |
| 3300018090|Ga0187770_10316071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1217 | Open in IMG/M |
| 3300020582|Ga0210395_10007546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8238 | Open in IMG/M |
| 3300021402|Ga0210385_10138238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1734 | Open in IMG/M |
| 3300025500|Ga0208686_1048160 | Not Available | 1003 | Open in IMG/M |
| 3300027652|Ga0209007_1023726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1579 | Open in IMG/M |
| 3300027701|Ga0209447_10126102 | Not Available | 703 | Open in IMG/M |
| 3300027767|Ga0209655_10011348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3011 | Open in IMG/M |
| 3300027768|Ga0209772_10124940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 800 | Open in IMG/M |
| 3300027773|Ga0209810_1026941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3521 | Open in IMG/M |
| 3300027854|Ga0209517_10499839 | Not Available | 663 | Open in IMG/M |
| 3300027867|Ga0209167_10123291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1342 | Open in IMG/M |
| 3300027867|Ga0209167_10781602 | Not Available | 520 | Open in IMG/M |
| 3300027895|Ga0209624_10121749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis | 1714 | Open in IMG/M |
| 3300027965|Ga0209062_1308219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis | 530 | Open in IMG/M |
| 3300027986|Ga0209168_10166025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1115 | Open in IMG/M |
| 3300030659|Ga0316363_10431512 | Not Available | 508 | Open in IMG/M |
| 3300031670|Ga0307374_10034703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia | 5719 | Open in IMG/M |
| 3300031708|Ga0310686_100634697 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7251 | Open in IMG/M |
| 3300031708|Ga0310686_107046630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis | 699 | Open in IMG/M |
| 3300031708|Ga0310686_111840578 | Not Available | 601 | Open in IMG/M |
| 3300031708|Ga0310686_115817287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 950 | Open in IMG/M |
| 3300031708|Ga0310686_118772643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis | 1067 | Open in IMG/M |
| 3300032160|Ga0311301_10247112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2950 | Open in IMG/M |
| 3300032160|Ga0311301_10357067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2279 | Open in IMG/M |
| 3300032160|Ga0311301_10446156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas | 1951 | Open in IMG/M |
| 3300032770|Ga0335085_10247378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2146 | Open in IMG/M |
| 3300032783|Ga0335079_11032809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 836 | Open in IMG/M |
| 3300032805|Ga0335078_11085624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 938 | Open in IMG/M |
| 3300032892|Ga0335081_11486571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae | 751 | Open in IMG/M |
| 3300032895|Ga0335074_11142370 | Not Available | 665 | Open in IMG/M |
| 3300032896|Ga0335075_10388553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1492 | Open in IMG/M |
| 3300032955|Ga0335076_10652769 | Not Available | 934 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 17.24% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 13.79% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 12.93% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 9.48% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 6.90% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.03% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.17% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.17% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 4.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.31% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 3.45% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.72% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.72% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027965 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100062834 | 3300000567 | Peatlands Soil | MKIYVLLMLIGVIVAFSYLPSFGRAKPVPPAPPDSLPA* |
| Ga0062384_1010519221 | 3300004082 | Bog Forest Soil | MKIYVLLMLIGIIVGFSYLPLRRQTKVAAPLPSEPAAVSIRG* |
| Ga0062387_1000724354 | 3300004091 | Bog Forest Soil | MKIYVLGMLISVIVGFSYIPRKNHAKQAEAATPDSLPANA* |
| Ga0062386_1006786552 | 3300004152 | Bog Forest Soil | MKIYALFMLIGVIVGFSYLPIRRQTKVATSTASDPVIVSIRG* |
| Ga0070738_100206977 | 3300005531 | Surface Soil | MKIYMLMLLIGVIVGLSYLPLRGRAKPAGTAPPDSVPA* |
| Ga0070738_102540432 | 3300005531 | Surface Soil | MKIYMLLMLISVIVGFSYLPSRRRSKEPTPVPPEPVPAL* |
| Ga0070739_100132377 | 3300005532 | Surface Soil | MKIYMLMLLIGVIVGLSYLPLRGRTKPAGTAPPDSVPA* |
| Ga0070735_102689732 | 3300005534 | Surface Soil | MKIYVLWMLISVIVGFSYIPRKNHAKRAEAAAPDSLPANA* |
| Ga0070733_101580593 | 3300005541 | Surface Soil | MKIYALLMLIGVIVSMSYIPVRRAKPAATPAPDSLPANS* |
| Ga0070733_101652592 | 3300005541 | Surface Soil | MKIYVLLMLIGVIVSMSYIPVRRAKPTATPEPDSVPANG* |
| Ga0070766_110420421 | 3300005921 | Soil | MKIYVLLMLIGVIVGFSQLPIRRAAKAPPPVAPDSIAARV* |
| Ga0075017_1009679862 | 3300006059 | Watersheds | MKIYVLLMLIGVIVGFSQLPIRRQPKVAAAAPSDSVAASIRG* |
| Ga0075017_1012764702 | 3300006059 | Watersheds | MLIGVIVGFSYLPIRRQTKVATSTGSDPVIVSIRG* |
| Ga0075019_101417072 | 3300006086 | Watersheds | MKIYVLLMLIGVIVGFSQLPIRRQPKVAAPAPSDSVAASIRG* |
| Ga0116128_10559721 | 3300009518 | Peatland | MKIYVLLTLIGVIVAFSYLPRFGRAKPVPPAPPDSVPA* |
| Ga0116108_10431061 | 3300009519 | Peatland | AEWNGGSAQAMKIYVLLTLIGVIVAFSYLPRFGRAKPVPPAPPDSVPA* |
| Ga0116108_10704082 | 3300009519 | Peatland | MKIYVLLMLIGVIVAFSYLPSFGRAKPVPPAPPDSVPA* |
| Ga0116222_12575202 | 3300009521 | Peatlands Soil | MKIYVLLMLISVIVGFSYLPGRRQSKAAAPVSPDSVPANA* |
| Ga0116218_13565381 | 3300009522 | Peatlands Soil | MKIYVLLMLIGVIVAFSYLPSFRRAKPVPPAPPDS |
| Ga0116221_11723652 | 3300009523 | Peatlands Soil | MKIYVLLMLIGVIVAFSYLPSFRRAKPVPPAPPDSVPA* |
| Ga0116225_10925901 | 3300009524 | Peatlands Soil | IYVLLMLISVIVGFSYLPGRRQSKAAAPVSPDSVPANA* |
| Ga0116110_10995462 | 3300009643 | Peatland | MKIYVLLMLIGVIVGFSYLPSFGRAKPVPPTPPDSVPA* |
| Ga0116106_11169382 | 3300009645 | Peatland | MKIYVLMMLIGVIVGFSHVPSRGRAKAAAPVPPDSVPA* |
| Ga0116224_102859312 | 3300009683 | Peatlands Soil | MKIYVLLMLIGIIVAFSYLPRFGRAKPVPPAPPDSLPA* |
| Ga0116134_11307562 | 3300009764 | Peatland | MKIYVLLMLISVIVGFSYLPSRRQAKPSAPVSPGSVAAEA* |
| Ga0116134_12460411 | 3300009764 | Peatland | GWRAHAMKIYVLMMLIGVIVGFSHVPSRGRAKAAAPVPPDSVPA* |
| Ga0116223_108678482 | 3300009839 | Peatlands Soil | MKIYVLLTLIGVIVAFSYLPRFGRAKPVPPAPPDSVPE* |
| Ga0074044_100258402 | 3300010343 | Bog Forest Soil | MKIYVLLMLIGVIVGFSYLPSRDQAKAATPVAPDSVPA* |
| Ga0074044_102143532 | 3300010343 | Bog Forest Soil | MKIYALFMLIGVIVGFSYLPIRRQTKVATPTASDPVIVSIRG* |
| Ga0074044_102436612 | 3300010343 | Bog Forest Soil | MKIYVLFMLISAIVGFSYLPGRGQAKPATPARPDSAPI* |
| Ga0074044_106907062 | 3300010343 | Bog Forest Soil | MKIYVLMMLIGVIVGFSYVPSRGRAKAAAPVPPDSVPA* |
| Ga0136449_1017164802 | 3300010379 | Peatlands Soil | AQAMKIYVLLMLIGVIVAFSYLPSFRRAKPVPPAPPDSVPA* |
| Ga0136449_1032222872 | 3300010379 | Peatlands Soil | MKIYVLGMLISVIVGFSYIPRKNQAKQAEAAAPDSLPANA* |
| Ga0136449_1034263881 | 3300010379 | Peatlands Soil | AMKIYVLLMLIGVIVAFSYLPSFRRAKPVPPAPPDSLPA* |
| Ga0136449_1036551202 | 3300010379 | Peatlands Soil | MKIYVLLMLIGVIVAFSYLPSFRRAKPVPPAPPDSV |
| Ga0181533_10340641 | 3300014152 | Bog | AMKIYVLLTLIGVIVAFSYLPRFGRAKPVPPAPPDSVPA* |
| Ga0181532_106305241 | 3300014164 | Bog | MKIYVLLMLIGVVVAFSYLPSFGRAKAVPPAPPDSVPG* |
| Ga0181523_101244954 | 3300014165 | Bog | VLLMLIGVIVGFSQLPIRRQTKAAAPMPSDPVAASIRG* |
| Ga0181526_108320802 | 3300014200 | Bog | MKIYVLLMLIGVIVGFSQLPIRRQTKAAAPMPSDPVAASIRG* |
| Ga0181526_108932951 | 3300014200 | Bog | STQAMKIYVLLMLIGVIVGFSYLPSFGRTKPVPPTPPDSVPA* |
| Ga0182018_100226114 | 3300014489 | Palsa | MKIYVLLMLIGVIVGFSYIPNRRPKPAAPASPDSVPANA* |
| Ga0182015_100186536 | 3300014495 | Palsa | MKIYVLLMLIGVIVSFSYIPNRQPKPAAPASPDSVPANA* |
| Ga0182024_100555417 | 3300014501 | Permafrost | MKIYVLLMLIGLIVGFSYIPNRQPKPAAPASPDSVPANA* |
| Ga0182024_101311614 | 3300014501 | Permafrost | MKIYVLLMLISVIVGISYLPSRIPSKQVEPVPPDSLPA* |
| Ga0187802_100301811 | 3300017822 | Freshwater Sediment | MKIYVLLMLIGVIVAFSYLPSFGRAKPVPPAPPDSVPA |
| Ga0187856_100046020 | 3300017925 | Peatland | MKIYVLMMLIGVIVGFSHVPSRGQAKAAAPVPPDSVPA |
| Ga0187806_13878881 | 3300017928 | Freshwater Sediment | MKIYVLLMLIGVIVASSYLPSFGRAKPVPPAPPDSVPA |
| Ga0187849_10201874 | 3300017929 | Peatland | MKIYVLLTLIGVIVAFSYLPRFGRAKPVPPAPPDSVPA |
| Ga0187877_10569282 | 3300017931 | Peatland | MKIYVLLMLISVIVGFSYLPGRRQSKAAAPVSPDSVPANA |
| Ga0187801_100270564 | 3300017933 | Freshwater Sediment | MKIYVLLMLIGVIVAFSYLPSFGRAKPVPLASPDSMPA |
| Ga0187803_100441571 | 3300017934 | Freshwater Sediment | MKIYVLLMLIGVIVAFSHVPSFGRAKPVPPAPPDSVPA |
| Ga0187821_103621901 | 3300017936 | Freshwater Sediment | MKIYVLFLLISVIVGFSYIPRRNYSKPAEPAAPDSLPANA |
| Ga0187879_100375764 | 3300017946 | Peatland | MKIYFLLMLISVIVGFSHAAGRSAKRPAPVPGDSLPV |
| Ga0187879_101496712 | 3300017946 | Peatland | MKIYVLLMLIGVIVGFSYIPHRQPKPAAPASPDSVPANA |
| Ga0187879_102273202 | 3300017946 | Peatland | MKIYVLMMLIGVIVGFSHVPSRGRAKAAAPVPPDSVPA |
| Ga0187817_108285152 | 3300017955 | Freshwater Sediment | MKIYVLLMLIGVIVAFSYLPSFGRAKPVPPASPDSMPA |
| Ga0187779_110305242 | 3300017959 | Tropical Peatland | MKIYVLLMLIGVIVGFSYIPNRGQRKETAPVPPDSVPA |
| Ga0187778_103982402 | 3300017961 | Tropical Peatland | MKIYVLLMLISVIVGFAHAPRHGGAKKAVPARPDSLPA |
| Ga0187783_102231393 | 3300017970 | Tropical Peatland | MKIYVLLMLISVIVGFSYLPRASRAKQPETPAPDSVPANV |
| Ga0187783_107587701 | 3300017970 | Tropical Peatland | MKIYVLLMLIGIIVAFSQLPIRRQAKAPASVSPDSIAASV |
| Ga0187781_101020771 | 3300017972 | Tropical Peatland | MKIYVLFMLISVILGFSYLPSLGRAKAAAPAPADSM |
| Ga0187781_102392052 | 3300017972 | Tropical Peatland | MKICLLLMLIGVIVGISYLPGRRQADAAAPIPPDSVPVNV |
| Ga0187781_112251651 | 3300017972 | Tropical Peatland | MKIYVLLMLIGIIVAFSQLPIRRQAKVAAPGSPDSIAASV |
| Ga0187777_105502752 | 3300017974 | Tropical Peatland | MKIYVLLMLIGVIVSFSYVPLRRAKPLSGPSPDSIPS |
| Ga0187777_114712462 | 3300017974 | Tropical Peatland | MKIYVLFLLISVIVGFSYIPSRNRAKPAEPAGPDSLPANA |
| Ga0187782_100730292 | 3300017975 | Tropical Peatland | MKIYLLMVLIGAIVGFSQLAVRRQSKAAAAIASDSVTARA |
| Ga0187782_115429142 | 3300017975 | Tropical Peatland | MKIYVLFMLISVILGFSYLPGLGRAKAAAPAPADSMPV |
| Ga0187865_13069422 | 3300018004 | Peatland | AMKIYMLLTLIGVIVAFSYLPRFGRAKPVPPAPPDSVPA |
| Ga0187872_100961423 | 3300018017 | Peatland | MKIYVLLMLIGVIVGFSYLPSFGRAKPVPPTPPDSVPA |
| Ga0187864_102750131 | 3300018022 | Peatland | AEWNGGSAQAMKIYVLLTLIGVIVAFSYLPRFGRAKPVPPAPPDSVPA |
| Ga0187867_104199952 | 3300018033 | Peatland | MKIYMLFMLISVIVGFSYLPSFHRAKPVPPAPPDSVPA |
| Ga0187883_101759302 | 3300018037 | Peatland | MKIYVLLMLISVIVGFSYLPGRRQSKAAAPVSPNSVPANA |
| Ga0187855_100207124 | 3300018038 | Peatland | MKIYVLGMLISVIVGFSYIPRKNHAKQAEAATPDSLPANA |
| Ga0187855_101910752 | 3300018038 | Peatland | MKIYVLLMLIGVIVGFSYIPNRRPKPAAPASPDSVPANA |
| Ga0187859_101339362 | 3300018047 | Peatland | MKIYFLLMLISVIVGFSYLPGRRQSKAAAPVSPNSVPANA |
| Ga0187858_104134462 | 3300018057 | Peatland | MKIYVLLMLIGVIVGFSYLPSFGRTKPVPPTPPDSVPA |
| Ga0187766_105096052 | 3300018058 | Tropical Peatland | MKIYVLFLLISVIVGFSYIPGRKRAKPAEPAAPDSLPANA |
| Ga0187784_100116101 | 3300018062 | Tropical Peatland | MKICLLLMLIGVIVGISYLPGRRQADAASPIPPDSVPVNV |
| Ga0187784_103414542 | 3300018062 | Tropical Peatland | MKIYVLLMLIGIIVTFSQLPIRRQAKATAPVSSDSIAASV |
| Ga0187784_104123382 | 3300018062 | Tropical Peatland | MKIYVLLMLISVIVGFSHAPRQGRAKKAVPARPDSLPA |
| Ga0187784_105205462 | 3300018062 | Tropical Peatland | MKIYVLFMLISVILGFSYLPGFGRAKAAAPTPADSIPA |
| Ga0187784_114941912 | 3300018062 | Tropical Peatland | MKIYVLLMLIGVIVAFSYLPSFGREKPVPPAPPDSVPA |
| Ga0187772_100238074 | 3300018085 | Tropical Peatland | MKIYVLLILIGAIVSMSYIPTRQTKPAAAPSPDTVPANA |
| Ga0187772_104135482 | 3300018085 | Tropical Peatland | MKIYVLLMLIGIIVTFSQLPIRRQAKAPAPVSSDSIAASV |
| Ga0187770_103160712 | 3300018090 | Tropical Peatland | MKIYVLLMLIGVIVGFSYIPNRGQRKETAPVPPNSVPA |
| Ga0210395_100075467 | 3300020582 | Soil | MKIYVLLMLIGIIVAFSQLPIRYRAKAPAPVSSDSIAASV |
| Ga0210385_101382382 | 3300021402 | Soil | MKIYVLGMLISVIVGFSYIPRKNHTKQAEAATPDSLPANA |
| Ga0208686_10481602 | 3300025500 | Peatland | MKIYMLLTLIGVIVAFSYLPRFGRAKPVPPAPPDSVPA |
| Ga0209007_10237262 | 3300027652 | Forest Soil | MKIYVLLMLISVIVGFSYFPGRKQSTPPTPLPSDSVPA |
| Ga0209447_101261022 | 3300027701 | Bog Forest Soil | MKIYALFMLIGVIVGFSYLPIRRQTKVATSTASDPVIVSIRG |
| Ga0209655_100113482 | 3300027767 | Bog Forest Soil | MKIYALFMLIGVIVGFSYLPIRRQTKVVTSTASDPVIVSIRG |
| Ga0209772_101249402 | 3300027768 | Bog Forest Soil | MKIYVLLMLIGIIVGFSYLPLRRQTKVAAPLPSEPAAVSIRG |
| Ga0209810_10269415 | 3300027773 | Surface Soil | MKIYMLMLLIGVIVGLSYLPLRGRTKPAGTAPPDSVPA |
| Ga0209517_104998391 | 3300027854 | Peatlands Soil | MKIYVLLMLIGVIVAFSYLPSFRRAKPVPPAPPDSLPA |
| Ga0209167_101232912 | 3300027867 | Surface Soil | MKIYVLLMLIGVIVSMSYIPVRRAKPTATPEPDSVPANG |
| Ga0209167_107816022 | 3300027867 | Surface Soil | MKIYALLMLIGVIVSMSYIPVRRAKPAATPAPDSLPANS |
| Ga0209624_101217492 | 3300027895 | Forest Soil | MKIYVLLMLIGVIVGFSQLPIRRPVKAPAPVAPDSIAARV |
| Ga0209062_13082191 | 3300027965 | Surface Soil | MKIYMLLMLISVIVGFSYLPSRRRSKEPTPVPPEPVPAL |
| Ga0209168_101660252 | 3300027986 | Surface Soil | MKIYVLWMLISVIVGFSYIPRKNHAKRAEAAAPDSLPANA |
| Ga0316363_104315122 | 3300030659 | Peatlands Soil | MKIYVLLTLIGVIVAFSYLPRFGRAKPVPPAPPDSVPE |
| Ga0307374_100347035 | 3300031670 | Soil | MKIYVLLMLIGVIVSMSYIPIRRAKPTATPAPDSVPANG |
| Ga0310686_1006346972 | 3300031708 | Soil | MKIYVLLMLIGVIVSMSYIPIRRAKPTATPEPDSLPANG |
| Ga0310686_1070466302 | 3300031708 | Soil | MKIYVLGMLISVIVGFSYIPRKNHAKRAEPAAPDSLPANA |
| Ga0310686_1118405781 | 3300031708 | Soil | MKIYVLLMLIGVIVSMSYIPIRRPKPTATPAPDSVPANG |
| Ga0310686_1158172872 | 3300031708 | Soil | KIYVLLMLIGVIVSMSYIPIRRAKPTATPEPDSVPANG |
| Ga0310686_1187726432 | 3300031708 | Soil | MKIYVLLMLIGVIVGFSQLPIRRAAKAPPPVAPDSIAARV |
| Ga0311301_102471122 | 3300032160 | Peatlands Soil | MKIYVLLMLIGIIVGFSQLPIRRQPKVAAPAPSDSVAASIRG |
| Ga0311301_103570675 | 3300032160 | Peatlands Soil | MKIYVLLMLIGIIVAFSYLPRFGRAKPVPPAPPDSLPA |
| Ga0311301_104461562 | 3300032160 | Peatlands Soil | MKIYVLLMLIGVIVAFSYLPSFRRAKPVPPAPPDSVPA |
| Ga0335085_102473782 | 3300032770 | Soil | MKIYVLFLLISVIVGFSYIPSRNRVKPAEPAAPGSLPANA |
| Ga0335079_110328092 | 3300032783 | Soil | MKIYVLFLLISVIVGFSYIPSRNRAKPAEPAAPDSLPANA |
| Ga0335078_110856241 | 3300032805 | Soil | MKIYVLFMLIGVIVGFSCLPSLGRAKPAPPDSVPA |
| Ga0335081_114865712 | 3300032892 | Soil | MKIYVLLMLIGVIVSMSYIPVRQAKPTATPSPDSVPANV |
| Ga0335074_111423702 | 3300032895 | Soil | MKIYLLLMLIGVIVGFSHLPLRRRTKTPAPVSPDSATALSEI |
| Ga0335075_103885531 | 3300032896 | Soil | MKIYLLLMLIGVIVGFSHLPLRRRAKTPAPVSPDSATALSEI |
| Ga0335076_106527692 | 3300032955 | Soil | MKIYVLLMLIGIIVGFSQLPIRRQAKAPAPVPPASVAASL |
| ⦗Top⦘ |