


| Basic Information | |
|---|---|
| Family ID | F077993 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 40 residues |
| Representative Sequence | TFLMENRNASADDVENNIEGLCLEFERLKPYLLQMWKSRE |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.71 % |
| % of genes near scaffold ends (potentially truncated) | 97.44 % |
| % of genes from short scaffolds (< 2000 bps) | 88.03 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (11.111 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.641 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.299 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.53% β-sheet: 0.00% Coil/Unstructured: 51.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF05552 | TM_helix | 62.39 |
| PF02446 | Glyco_hydro_77 | 7.69 |
| PF00939 | Na_sulph_symp | 0.85 |
| PF00912 | Transgly | 0.85 |
| PF07690 | MFS_1 | 0.85 |
| PF13519 | VWA_2 | 0.85 |
| PF01609 | DDE_Tnp_1 | 0.85 |
| PF13229 | Beta_helix | 0.85 |
| PF00365 | PFK | 0.85 |
| PF04203 | Sortase | 0.85 |
| PF03547 | Mem_trans | 0.85 |
| PF02518 | HATPase_c | 0.85 |
| PF01590 | GAF | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 62.39 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 62.39 |
| COG1640 | 4-alpha-glucanotransferase | Carbohydrate transport and metabolism [G] | 7.69 |
| COG0205 | 6-phosphofructokinase | Carbohydrate transport and metabolism [G] | 0.85 |
| COG0471 | Di- and tricarboxylate antiporter | Carbohydrate transport and metabolism [G] | 0.85 |
| COG0679 | Predicted permease, AEC (auxin efflux carrier) family | General function prediction only [R] | 0.85 |
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.85 |
| COG1055 | Na+/H+ antiporter NhaD or related arsenite permease | Inorganic ion transport and metabolism [P] | 0.85 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.85 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.85 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.85 |
| COG3764 | Sortase (surface protein transpeptidase) | Cell wall/membrane/envelope biogenesis [M] | 0.85 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 0.85 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 0.85 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.85 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.85 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10361882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 509 | Open in IMG/M |
| 3300001661|JGI12053J15887_10630273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 510 | Open in IMG/M |
| 3300005353|Ga0070669_100719316 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300005534|Ga0070735_10111420 | All Organisms → cellular organisms → Bacteria | 1716 | Open in IMG/M |
| 3300005542|Ga0070732_10921042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 534 | Open in IMG/M |
| 3300005564|Ga0070664_100188163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1838 | Open in IMG/M |
| 3300005564|Ga0070664_100615217 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300005618|Ga0068864_101982232 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300005921|Ga0070766_10195335 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300006059|Ga0075017_100325586 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300006173|Ga0070716_101683540 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300006176|Ga0070765_100054345 | All Organisms → cellular organisms → Bacteria | 3284 | Open in IMG/M |
| 3300006176|Ga0070765_102277776 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300006354|Ga0075021_10007912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5686 | Open in IMG/M |
| 3300006893|Ga0073928_10893402 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300007265|Ga0099794_10808816 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300007982|Ga0102924_1347239 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300009038|Ga0099829_11475618 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300009524|Ga0116225_1025998 | All Organisms → cellular organisms → Bacteria | 2952 | Open in IMG/M |
| 3300009524|Ga0116225_1226300 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300009545|Ga0105237_10011232 | All Organisms → cellular organisms → Bacteria | 9484 | Open in IMG/M |
| 3300009547|Ga0116136_1040833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1352 | Open in IMG/M |
| 3300009617|Ga0116123_1163180 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300009639|Ga0116122_1018794 | All Organisms → cellular organisms → Bacteria | 2502 | Open in IMG/M |
| 3300009672|Ga0116215_1501925 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300011120|Ga0150983_13064057 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
| 3300011269|Ga0137392_10973744 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300012199|Ga0137383_10838969 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300012202|Ga0137363_10748243 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300012210|Ga0137378_10270313 | All Organisms → cellular organisms → Bacteria | 1582 | Open in IMG/M |
| 3300012918|Ga0137396_10426162 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300012989|Ga0164305_10673977 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300014160|Ga0181517_10148027 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300014200|Ga0181526_10023325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4041 | Open in IMG/M |
| 3300014493|Ga0182016_10357377 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300015052|Ga0137411_1123992 | All Organisms → cellular organisms → Bacteria | 1433 | Open in IMG/M |
| 3300017823|Ga0187818_10074612 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
| 3300017924|Ga0187820_1245763 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300017930|Ga0187825_10197759 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300017935|Ga0187848_10313894 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300017938|Ga0187854_10174772 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300017988|Ga0181520_10104669 | All Organisms → cellular organisms → Bacteria | 2413 | Open in IMG/M |
| 3300018008|Ga0187888_1272233 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300018016|Ga0187880_1063922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1913 | Open in IMG/M |
| 3300018020|Ga0187861_10422684 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300018021|Ga0187882_1357354 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300018026|Ga0187857_10526871 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300018034|Ga0187863_10112160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1525 | Open in IMG/M |
| 3300018034|Ga0187863_10183659 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300018034|Ga0187863_10225971 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300018037|Ga0187883_10239097 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300018042|Ga0187871_10275853 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300018057|Ga0187858_10712415 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300019786|Ga0182025_1018926 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300019786|Ga0182025_1050259 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
| 3300020579|Ga0210407_10036787 | All Organisms → cellular organisms → Bacteria | 3641 | Open in IMG/M |
| 3300020579|Ga0210407_10341890 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300020582|Ga0210395_10663237 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300020583|Ga0210401_10741819 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300021088|Ga0210404_10688620 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300021088|Ga0210404_10914093 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300021168|Ga0210406_10716243 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300021406|Ga0210386_10984905 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300021475|Ga0210392_10103850 | All Organisms → cellular organisms → Bacteria | 1875 | Open in IMG/M |
| 3300021479|Ga0210410_10127560 | All Organisms → cellular organisms → Bacteria | 2258 | Open in IMG/M |
| 3300022726|Ga0242654_10338587 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300023090|Ga0224558_1246265 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300025482|Ga0208715_1031376 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300025581|Ga0208355_1056124 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300025924|Ga0207694_11246805 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300026515|Ga0257158_1099391 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300026551|Ga0209648_10707050 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300026552|Ga0209577_10348564 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300026880|Ga0209623_1017990 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300027164|Ga0208994_1057713 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300027432|Ga0209421_1049803 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300027570|Ga0208043_1138426 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300027660|Ga0209736_1148882 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300027667|Ga0209009_1054936 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300027667|Ga0209009_1090968 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300027698|Ga0209446_1076302 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300027737|Ga0209038_10237202 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300027846|Ga0209180_10655347 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300027855|Ga0209693_10234683 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300027855|Ga0209693_10332812 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300027855|Ga0209693_10388750 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300027889|Ga0209380_10282969 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 974 | Open in IMG/M |
| 3300027889|Ga0209380_10492912 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300027894|Ga0209068_10006675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5434 | Open in IMG/M |
| 3300027986|Ga0209168_10014880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4505 | Open in IMG/M |
| 3300028759|Ga0302224_10396786 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300028788|Ga0302189_10412719 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300028798|Ga0302222_10258036 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300028863|Ga0302218_10326186 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300029943|Ga0311340_10856831 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300029953|Ga0311343_10143629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2612 | Open in IMG/M |
| 3300029999|Ga0311339_10989650 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300030007|Ga0311338_10339145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1641 | Open in IMG/M |
| 3300030013|Ga0302178_10531589 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300030051|Ga0302195_10498574 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300030054|Ga0302182_10245582 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300030659|Ga0316363_10191909 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300031057|Ga0170834_105073593 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5171 | Open in IMG/M |
| 3300031231|Ga0170824_111788610 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300031236|Ga0302324_100081218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5594 | Open in IMG/M |
| 3300031715|Ga0307476_10967774 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300031823|Ga0307478_10710646 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300031823|Ga0307478_11648989 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300031837|Ga0302315_10765882 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300031962|Ga0307479_10312542 | All Organisms → cellular organisms → Bacteria | 1553 | Open in IMG/M |
| 3300031962|Ga0307479_12010045 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300032160|Ga0311301_11046582 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300032174|Ga0307470_11286466 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300032205|Ga0307472_101200916 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300032955|Ga0335076_10916680 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300034125|Ga0370484_0096475 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300034163|Ga0370515_0415827 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 11.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.26% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 8.55% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.84% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.84% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.98% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.98% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.56% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.56% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.56% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.56% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.56% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.56% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.71% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.71% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.71% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.71% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.71% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.85% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.85% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
| 3300009617 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 | Environmental | Open in IMG/M |
| 3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
| 3300025482 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025581 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026880 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027164 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030051 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_103618821 | 3300001356 | Peatlands Soil | ENRNASADGVEKNIEALCLEFERLKPYLLELWKSRE* |
| JGI12053J15887_106302731 | 3300001661 | Forest Soil | TFLVENRDTSSKDVENEIENLCLEFERLKAYLLEMWNGRK* |
| Ga0070669_1007193162 | 3300005353 | Switchgrass Rhizosphere | LFRGRVLTFLIENRNGSAEDVESSVENLCLEFERLKPHLLELWK* |
| Ga0070735_101114201 | 3300005534 | Surface Soil | TENRTASAANVEDDIEALCLEFERMKPYLREIWNGRE* |
| Ga0070732_109210422 | 3300005542 | Surface Soil | GRVFTFVVENRNGSANDVANHIEGLCLEFERLKPYLLEMWESKE* |
| Ga0070664_1001881631 | 3300005564 | Corn Rhizosphere | SSESEIEQHIESLCQTFERLKPYLLELWATGQGGS* |
| Ga0070664_1006152173 | 3300005564 | Corn Rhizosphere | LVENRTASAAEVGNNIESLCLEFERLKPYLLELWNGRK* |
| Ga0068864_1019822322 | 3300005618 | Switchgrass Rhizosphere | RIFTFLVENRIGSAQDVENSVELLCCEFERQKPYLLELWEGERVRT* |
| Ga0070766_101953353 | 3300005921 | Soil | GRMFTFLMENRNASAGDVENNIEALCLEFERLKPYLLQLWKS* |
| Ga0075017_1003255863 | 3300006059 | Watersheds | NRNGSAADVEDNIEGLSLEFERMKPYLLEIWNGRE* |
| Ga0070716_1016835401 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | FLIENRNSSADEVEQHIEELCLEFERLKPDLLQVWKSRE* |
| Ga0070765_1000543451 | 3300006176 | Soil | VENRNSSADLVENNIENLCLEFERLKPYLLQMWNGGK* |
| Ga0070765_1022777762 | 3300006176 | Soil | NRNGSADDVENNIEGLCLEFERMKPYLLQIWNGRE* |
| Ga0075021_100079121 | 3300006354 | Watersheds | RALTFLLQNNQGSSDDVVNNIETLCLEFERLKPYLLEKMEL* |
| Ga0073928_108934021 | 3300006893 | Iron-Sulfur Acid Spring | GRAFTFLTENRNASAGDVENNIEALCLEFERLKPYLLQMWKSRE* |
| Ga0099794_108088162 | 3300007265 | Vadose Zone Soil | MENRNASADDVENNIEGLCLEFERLKPYLLQMWKSRE* |
| Ga0102924_13472391 | 3300007982 | Iron-Sulfur Acid Spring | LSENRTGSANDVENNIEGLCLEFERLKPYLLEMWKSRE* |
| Ga0099829_114756181 | 3300009038 | Vadose Zone Soil | ENRSSSAEEVEKNIESLCIEFERLKPYLLEVWNTKK* |
| Ga0116225_10259981 | 3300009524 | Peatlands Soil | AFTFLVENRNGSAANVEDDIEALCLEFERLKPYLLKIWNGRE* |
| Ga0116225_12263001 | 3300009524 | Peatlands Soil | NRNSSAAEVGAHIESLCLEFERLKPYLLEMWTGRE* |
| Ga0105237_100112328 | 3300009545 | Corn Rhizosphere | GRVLTFLIENRNGSAEDVESSVENLCLEFERLKPHLLELWK* |
| Ga0116136_10408333 | 3300009547 | Peatland | ENRNASADDVENNIEGLCLEFERLKPYLLQLWKSRE* |
| Ga0116123_11631801 | 3300009617 | Peatland | FLVENRNASADDVENNIEGLCLEFERLKPYLLQLWKSRE* |
| Ga0116122_10187943 | 3300009639 | Peatland | GRVLAFLMEHRNGSAEDVENGIESLCLEFERLKPYLLQMWKSRE* |
| Ga0116215_15019252 | 3300009672 | Peatlands Soil | GRAFTFLLENRNSSAAEVEAHIESLCLEFERLKPYLLEMWTGRE* |
| Ga0150983_130640573 | 3300011120 | Forest Soil | GRVFTFVLENRNGSASDVANHIEDLCLEFERLKPYLLEIWKSKQ* |
| Ga0137392_109737442 | 3300011269 | Vadose Zone Soil | VENRSGSANDVANNIEGVCLEFERLKPYLIEMWKSKE* |
| Ga0137383_108389692 | 3300012199 | Vadose Zone Soil | FVVENRNGSANDVANNIESLCLEFERLKPYLLEIWKSKQ* |
| Ga0137363_107482431 | 3300012202 | Vadose Zone Soil | GRAFTFLMDNRNASADEVENNIELLCLEFERLKPYLLQLWKSRE* |
| Ga0137378_102703133 | 3300012210 | Vadose Zone Soil | VCTFLIENRNATANDVENNIGALCLEFERLKPDLLQMWKSRE* |
| Ga0137396_104261621 | 3300012918 | Vadose Zone Soil | RDASANDVENNIGSLCLEFERLKPYLLEMWNGRK* |
| Ga0164305_106739772 | 3300012989 | Soil | RQGSAEDIERHVENLCLEFERLKPYLLAMWTTGK* |
| Ga0181517_101480272 | 3300014160 | Bog | RVFTFLTENRNVSADDVENNIEGLCLEFERLKPYLLQLWETR* |
| Ga0181526_100233255 | 3300014200 | Bog | VFTFLTENRNVSADDVENNIEGLCLEFERLKPYLLQLWETR* |
| Ga0182016_103573772 | 3300014493 | Bog | FRGRAFTFLMENRNSSAQDVENNIEGLCLEFERLKPYLLQLWKSGE* |
| Ga0137411_11239924 | 3300015052 | Vadose Zone Soil | RNGSANDVENNLEGLCLEFERLKPYLLEMWKSRE* |
| Ga0187818_100746121 | 3300017823 | Freshwater Sediment | LFRGRVFTFVVENRNGSAAAVENNIEGLCLEFERMKPYLLEIWNGRE |
| Ga0187820_12457631 | 3300017924 | Freshwater Sediment | LFRGRVFTFVVENRNGSANDIANNIEGLCLEFERLKPYLLEMWKSKE |
| Ga0187825_101977592 | 3300017930 | Freshwater Sediment | AYSFLVENRNAGELAVENHIESLCLDFERLKPYLLQRWSSRE |
| Ga0187848_103138941 | 3300017935 | Peatland | VIENRNASADEVEKNIEALCLEFERLKPYLLQLWKSRE |
| Ga0187854_101747723 | 3300017938 | Peatland | FLMENRNASADDVENNIEGLCLEFERLKPYLLQLWKSRE |
| Ga0181520_101046691 | 3300017988 | Bog | GRVFTLVIENRNASADDVENNIEGLCLEFERLKPYLLQLWESRE |
| Ga0187888_12722331 | 3300018008 | Peatland | FLVENRNASADDVENNIEGLCLEFERLKPYLLQLWKSRE |
| Ga0187880_10639224 | 3300018016 | Peatland | FVIENRNASADDVENNIEALCLEFERLKPYLLQLWKSRE |
| Ga0187861_104226841 | 3300018020 | Peatland | NRNASADDVENNIEGLCLEFERLKPYLLQMWDSRE |
| Ga0187882_13573542 | 3300018021 | Peatland | RVFTFLVENRNASADDVENNIEGLCLEFERLKPYLLQLWKSRE |
| Ga0187857_105268711 | 3300018026 | Peatland | LMENRNASADDVENNIEGLCLEFERLKPYLLQLWKSRE |
| Ga0187863_101121603 | 3300018034 | Peatland | FLVENRNASEDEVENNIEGLCLEFERLKPYLLQLWESRE |
| Ga0187863_101836591 | 3300018034 | Peatland | VFTFLMENRNASADEVENNIEGLCLEFERLKPYLLQMWESRE |
| Ga0187863_102259711 | 3300018034 | Peatland | RGRVFTFLMENRNASADKVENNIEGLCLEFERLKPYLLEMWKSRE |
| Ga0187883_102390972 | 3300018037 | Peatland | LAENINGSAADVENNIESLCLEFERTKPYLLEIWKQ |
| Ga0187871_102758531 | 3300018042 | Peatland | RENRNASEEAIEQNIEGLCLEFERLKPYLLQLWKTRE |
| Ga0187858_107124152 | 3300018057 | Peatland | FTFLVENRNASADDVENNIEGLCLEFERLKPYLLQLWKSRE |
| Ga0182025_10189263 | 3300019786 | Permafrost | FLMENRNGSAADVETNIEGLCLEFERLKPYLLQKWKSRE |
| Ga0182025_10502591 | 3300019786 | Permafrost | NRNGSAADVENNIEGLCLEFERLKPYLLQKWKSRE |
| Ga0210407_100367871 | 3300020579 | Soil | ENRNASADDVENNIEGLCLEFERLKPYLLQMWKSRE |
| Ga0210407_103418902 | 3300020579 | Soil | NRNGSAEDLENNIEGLCLEFERWKPYLLQMWKSRE |
| Ga0210395_106632372 | 3300020582 | Soil | NRTGSANDVENNIEGLCLEFERLKPYLLDLWKSRE |
| Ga0210401_107418192 | 3300020583 | Soil | NRNSSADRVEANIESLCLEFERLKPYLLEMWSGKK |
| Ga0210404_106886202 | 3300021088 | Soil | TFLMENRNASADDVENNIEGLCLEFERLKPYLLQMWKSRE |
| Ga0210404_109140931 | 3300021088 | Soil | FRGRALTFLIENRNGSADDVENNIEGLCLEFERLKPYLLQLWKSRE |
| Ga0210406_107162432 | 3300021168 | Soil | MFTFLMENRDASANDVENNIEGLCLEFERLKPYLLQMWKPRE |
| Ga0210386_109849052 | 3300021406 | Soil | GRVFTFIVENRNGSANDVAKNIEGLCLEFERLKPYLLDIWKSKE |
| Ga0210392_101038501 | 3300021475 | Soil | NRNVSAGDVEKNVEDLCLEFERLKPYLLQLWKTRE |
| Ga0210410_101275605 | 3300021479 | Soil | NHNGSTDDIEDNIEGLCLEFERMKPYLLEIWNARE |
| Ga0242654_103385872 | 3300022726 | Soil | GRVFTFVVENRSGSANDVANNIEGLCLEFERLKPYLLEMWKSKE |
| Ga0224558_12462652 | 3300023090 | Soil | LTENREASAEDVENNIEGLCLEFERLKPYLLQLWKSRE |
| Ga0208715_10313763 | 3300025482 | Arctic Peat Soil | TFVVENRNSSANDVANNIEGLCLEFERLKPYLLEMWKSKE |
| Ga0208355_10561241 | 3300025581 | Arctic Peat Soil | LTFVIENRNASADDVESNIEGLCLEFERLKPYLLQMWKSRK |
| Ga0207694_112468051 | 3300025924 | Corn Rhizosphere | NRTASAAEVGNNIESLCLEFERLKPYLLELWNGRK |
| Ga0257158_10993911 | 3300026515 | Soil | YTFVVENRNGSANDVANNIESLCLEFERLKPYLLEIWKSKQ |
| Ga0209648_107070501 | 3300026551 | Grasslands Soil | NRDTSANEVENNIESLCLEFERLKPYLLEMWNGRK |
| Ga0209577_103485643 | 3300026552 | Soil | MVTFVTENRSGSMTDVENNIENLCLEFERLKPYFIELWNGRK |
| Ga0209623_10179902 | 3300026880 | Forest Soil | APLFRGRVFTFLVENRNGSAEDLENNIEGLCLEFERWKPYLLQMWKSRE |
| Ga0208994_10577132 | 3300027164 | Forest Soil | FRGRVFTFLMENRNASADDVENNIEGLCLEFERLKPYLLQMWKS |
| Ga0209421_10498031 | 3300027432 | Forest Soil | ENRNASADQVENNVESLCLEFERLKPYLLQMWNERK |
| Ga0208043_11384261 | 3300027570 | Peatlands Soil | FTFVIENRNASADGVENNIEALCLEFERLKPYLLELWKSRE |
| Ga0209736_11488821 | 3300027660 | Forest Soil | LAPLFRGRVFTFLVENRNGSTEDLENNIEGLCLEFERWKPYLLQMWKSRE |
| Ga0209009_10549361 | 3300027667 | Forest Soil | FRGRAFTFLTENRNASAGDVENNIEALCLEFERLKPYLLQMWKSRE |
| Ga0209009_10909681 | 3300027667 | Forest Soil | FTFLLENRNASADDVENNIEGLCLEFERLKPYLLQMWKSRE |
| Ga0209446_10763021 | 3300027698 | Bog Forest Soil | GRAFTFLMENRNASAADVENNIEALCVEFERVKPYLLQMWKSRE |
| Ga0209038_102372021 | 3300027737 | Bog Forest Soil | RAFTFLMENRNASADDVENNIEGLCLEFERLKPYLLQLWKSRE |
| Ga0209180_106553471 | 3300027846 | Vadose Zone Soil | ENRSSSAEEVEKNIESLCIEFERLKPYLLEVWNTKK |
| Ga0209693_102346831 | 3300027855 | Soil | EQRNGSEQDVENCIESLCLEFERLKPYLLQMWKSRE |
| Ga0209693_103328122 | 3300027855 | Soil | VFTFLVENRNGSAEDLENNIEGLCLEFERWKPYLLQMWKSRE |
| Ga0209693_103887501 | 3300027855 | Soil | NRNGSADDVENNIEGLCLEFERMKPYLLQIWNGRE |
| Ga0209380_102829692 | 3300027889 | Soil | MENRNSSADEVEANVESLCLEFERLKPYLLEMWSGKK |
| Ga0209380_104929121 | 3300027889 | Soil | RGRAFTFLTENRNGSADDVENNIEGLCLEFERMKPYLLQIWNGRE |
| Ga0209068_100066751 | 3300027894 | Watersheds | FRGRALTFLLQNNQGSSDDVVNNIETLCLEFERLKPYLLEKMEL |
| Ga0209168_100148801 | 3300027986 | Surface Soil | LTENRTASAANVEDDIEALCLEFERMKPYLREIWNGRE |
| Ga0302224_103967861 | 3300028759 | Palsa | TFLMENRDASAEDVENNIEGLCLEFERLKPYLLQMWKSRE |
| Ga0302189_104127192 | 3300028788 | Bog | LVENEQSTAAGVENNIEGLCLEFERWKPYLLELWQDGE |
| Ga0302222_102580362 | 3300028798 | Palsa | VVENRNGSAKDVANNIEGLCLEFERLKPYLLEMWKSKE |
| Ga0302218_103261862 | 3300028863 | Palsa | GRVFTFLIENRNSSANDVENNIEGLCLEFERLKPYLLQLWKSRE |
| Ga0311340_108568312 | 3300029943 | Palsa | GRAFTFLTENINGSDADVENNIESLCLEFERTKPYLLEIWKQ |
| Ga0311343_101436294 | 3300029953 | Bog | RGRAFTFITENRNASAGDVENNIENLCLEFERLKPYLQQMWSV |
| Ga0311339_109896502 | 3300029999 | Palsa | PLFRGRVLTVLRENRNASEETIEQNTEALCLEFEQLKPYLLQLWKTRE |
| Ga0311338_103391453 | 3300030007 | Palsa | FLIENRTGSAEDVEKNIEDLCMEFERLKPYLLQMWKSRE |
| Ga0302178_105315892 | 3300030013 | Palsa | RGRAFTFLMENRNGSANDVGNNIEGLCLEFERMKPYLLEMWSGRQ |
| Ga0302195_104985741 | 3300030051 | Bog | RGRAFTFITENRNASAGDVENNIENLCLEFERLKPYLQRMWSV |
| Ga0302182_102455822 | 3300030054 | Palsa | LMENRDASAEDVENNIEGLCLEFERLKPYLLQMWKSRE |
| Ga0316363_101919092 | 3300030659 | Peatlands Soil | FVIENRNASADGVEKNIEALCLEFERLKPYLLQLWKSRE |
| Ga0170834_1050735938 | 3300031057 | Forest Soil | ENRTSSAIEVENNIENLCLEFERSKPNLLAMWKSRE |
| Ga0170824_1117886101 | 3300031231 | Forest Soil | YTFLVENRNGSADEVENNIEALCLAFERGKPYLLELWNGRE |
| Ga0302324_1000812185 | 3300031236 | Palsa | RGRAFTFLTENINGSDADVENNIESLCLEFERTKPYLLEIWKQ |
| Ga0307476_109677742 | 3300031715 | Hardwood Forest Soil | LVENRNGSAEDLENNIEGLCLEFERWKPYLLQMWKSRE |
| Ga0307478_107106462 | 3300031823 | Hardwood Forest Soil | NRNASADDVENNIEGLCLEFERLKPYLLQMWKSRE |
| Ga0307478_116489892 | 3300031823 | Hardwood Forest Soil | GRVFTFLVENRNASAIEVENNIEGLCVEFERLKPYLLQMWKSRE |
| Ga0302315_107658822 | 3300031837 | Palsa | TFLMENRNGSANDVGNNIEGLCLEFERMKPYLLEMWSGRQ |
| Ga0307479_103125424 | 3300031962 | Hardwood Forest Soil | RGRVFTFLMENRNASADDVENNIEGLCLEFERLKPDLLQMWKSRE |
| Ga0307479_120100452 | 3300031962 | Hardwood Forest Soil | FRGRVFTFLAENRNASANDVENNIEGLCLEFERLKPYLLQMWKSRE |
| Ga0311301_110465821 | 3300032160 | Peatlands Soil | FLVENSSGSADNVEHNIEALCLEFERMKPYLLQIWNGGE |
| Ga0307470_112864661 | 3300032174 | Hardwood Forest Soil | RVFTFVVENRNGSADDVARNIEGLCLEFERLKPYLLEIWKSKE |
| Ga0307472_1012009161 | 3300032205 | Hardwood Forest Soil | TFVVENRNGSANDVANNIESLCLEFERLKPYLLEIWKSKQ |
| Ga0335076_109166802 | 3300032955 | Soil | NRSSSAEDVERNIENLCLEFERLKPYLVELWNSGK |
| Ga0370484_0096475_25_138 | 3300034125 | Untreated Peat Soil | MENRNATAADVENNIEGLCLEFERLKPYLLQLWKSRK |
| Ga0370515_0415827_2_121 | 3300034163 | Untreated Peat Soil | FVVENRNASANDVANNIEGLCLEFERLKPYLLEMWKSKE |
| ⦗Top⦘ |