


| Basic Information | |
|---|---|
| Family ID | F077989 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MIARVVKYHSIAEWNFSLWFALLSPLIGILLGILGGFLLYH |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 66.38 % |
| % of genes near scaffold ends (potentially truncated) | 34.19 % |
| % of genes from short scaffolds (< 2000 bps) | 88.03 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.889 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (24.786 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.316 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (47.863 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.52% β-sheet: 0.00% Coil/Unstructured: 43.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF13602 | ADH_zinc_N_2 | 51.28 |
| PF00171 | Aldedh | 5.13 |
| PF04542 | Sigma70_r2 | 2.56 |
| PF07992 | Pyr_redox_2 | 1.71 |
| PF05368 | NmrA | 1.71 |
| PF00069 | Pkinase | 1.71 |
| PF00072 | Response_reg | 0.85 |
| PF08240 | ADH_N | 0.85 |
| PF02627 | CMD | 0.85 |
| PF02861 | Clp_N | 0.85 |
| PF07690 | MFS_1 | 0.85 |
| PF00873 | ACR_tran | 0.85 |
| PF02915 | Rubrerythrin | 0.85 |
| PF04545 | Sigma70_r4 | 0.85 |
| PF03466 | LysR_substrate | 0.85 |
| PF03358 | FMN_red | 0.85 |
| PF02515 | CoA_transf_3 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 6.84 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 5.13 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 5.13 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 5.13 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 2.56 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 2.56 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 2.56 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 2.56 |
| COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.85 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.85 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.89 % |
| Unclassified | root | N/A | 11.11 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16649921 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 1346 | Open in IMG/M |
| 3300001369|JGI12701J14581_1015753 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 538 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100972547 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300002886|JGI25612J43240_1081560 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300005093|Ga0062594_100200582 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
| 3300005181|Ga0066678_10201334 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300005186|Ga0066676_10512849 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300005289|Ga0065704_10177121 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300005289|Ga0065704_10477133 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 684 | Open in IMG/M |
| 3300005289|Ga0065704_10653090 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 582 | Open in IMG/M |
| 3300005354|Ga0070675_101819825 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300005355|Ga0070671_100626528 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300005364|Ga0070673_101778945 | Not Available | 584 | Open in IMG/M |
| 3300005365|Ga0070688_101320313 | Not Available | 583 | Open in IMG/M |
| 3300005367|Ga0070667_100148311 | Not Available | 2058 | Open in IMG/M |
| 3300005436|Ga0070713_100256335 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
| 3300005437|Ga0070710_10327446 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300005450|Ga0066682_10757161 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300005458|Ga0070681_11989162 | Not Available | 509 | Open in IMG/M |
| 3300005549|Ga0070704_101866750 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300005552|Ga0066701_10050426 | Not Available | 2282 | Open in IMG/M |
| 3300005552|Ga0066701_10342397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 926 | Open in IMG/M |
| 3300005554|Ga0066661_10054657 | All Organisms → cellular organisms → Bacteria | 2294 | Open in IMG/M |
| 3300005555|Ga0066692_10202292 | Not Available | 1243 | Open in IMG/M |
| 3300005556|Ga0066707_10457377 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300005559|Ga0066700_10702378 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300005574|Ga0066694_10317262 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300005618|Ga0068864_102328294 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300006028|Ga0070717_11362564 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300006034|Ga0066656_10896955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 568 | Open in IMG/M |
| 3300006046|Ga0066652_100334489 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1357 | Open in IMG/M |
| 3300006175|Ga0070712_100298288 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1303 | Open in IMG/M |
| 3300006176|Ga0070765_100314124 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1451 | Open in IMG/M |
| 3300006755|Ga0079222_10013991 | All Organisms → cellular organisms → Bacteria | 3023 | Open in IMG/M |
| 3300006893|Ga0073928_10341687 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1111 | Open in IMG/M |
| 3300007255|Ga0099791_10518404 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300007788|Ga0099795_10168439 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300009038|Ga0099829_11377895 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 583 | Open in IMG/M |
| 3300009089|Ga0099828_11784884 | Not Available | 540 | Open in IMG/M |
| 3300009098|Ga0105245_13212437 | Not Available | 506 | Open in IMG/M |
| 3300009137|Ga0066709_104483297 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 510 | Open in IMG/M |
| 3300009143|Ga0099792_10761323 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 631 | Open in IMG/M |
| 3300010159|Ga0099796_10518741 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300010304|Ga0134088_10554706 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 569 | Open in IMG/M |
| 3300010396|Ga0134126_12160029 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300010862|Ga0126348_1272286 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300011269|Ga0137392_10328478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia cepacia complex → Burkholderia cenocepacia | 1266 | Open in IMG/M |
| 3300011271|Ga0137393_11005855 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300012169|Ga0153990_1118570 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300012189|Ga0137388_10349622 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
| 3300012198|Ga0137364_10161676 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
| 3300012200|Ga0137382_10132096 | All Organisms → cellular organisms → Bacteria | 1678 | Open in IMG/M |
| 3300012202|Ga0137363_11188122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira → unclassified Nitrosospira → Nitrosospira sp. Nsp2 | 649 | Open in IMG/M |
| 3300012203|Ga0137399_11731174 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300012350|Ga0137372_11222261 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 506 | Open in IMG/M |
| 3300012363|Ga0137390_10579569 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1091 | Open in IMG/M |
| 3300012685|Ga0137397_10613997 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 809 | Open in IMG/M |
| 3300012915|Ga0157302_10083895 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300012922|Ga0137394_10211796 | All Organisms → cellular organisms → Bacteria | 1657 | Open in IMG/M |
| 3300012923|Ga0137359_11249384 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300012927|Ga0137416_10396870 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1168 | Open in IMG/M |
| 3300012929|Ga0137404_10964679 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 779 | Open in IMG/M |
| 3300012929|Ga0137404_11544387 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 615 | Open in IMG/M |
| 3300012951|Ga0164300_10117787 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300012960|Ga0164301_10796422 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300012961|Ga0164302_10622109 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300012988|Ga0164306_10429715 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300013296|Ga0157374_10266575 | All Organisms → cellular organisms → Bacteria | 1688 | Open in IMG/M |
| 3300013296|Ga0157374_11173007 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 789 | Open in IMG/M |
| 3300013296|Ga0157374_11250960 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 764 | Open in IMG/M |
| 3300013297|Ga0157378_10098406 | All Organisms → cellular organisms → Bacteria | 2667 | Open in IMG/M |
| 3300013306|Ga0163162_13056332 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 537 | Open in IMG/M |
| 3300015052|Ga0137411_1049570 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1837 | Open in IMG/M |
| 3300015077|Ga0173483_10646413 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 589 | Open in IMG/M |
| 3300015242|Ga0137412_10154793 | All Organisms → cellular organisms → Bacteria | 1847 | Open in IMG/M |
| 3300015242|Ga0137412_11239607 | Not Available | 522 | Open in IMG/M |
| 3300015371|Ga0132258_12929282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1185 | Open in IMG/M |
| 3300017659|Ga0134083_10471882 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 558 | Open in IMG/M |
| 3300018027|Ga0184605_10189736 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300018027|Ga0184605_10510265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 522 | Open in IMG/M |
| 3300018431|Ga0066655_10955860 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300018433|Ga0066667_10027150 | All Organisms → cellular organisms → Bacteria | 3159 | Open in IMG/M |
| 3300019789|Ga0137408_1000757 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300019879|Ga0193723_1039065 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1413 | Open in IMG/M |
| 3300019882|Ga0193713_1094734 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300019883|Ga0193725_1063683 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300019887|Ga0193729_1060391 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
| 3300020021|Ga0193726_1033038 | All Organisms → cellular organisms → Bacteria | 2552 | Open in IMG/M |
| 3300020581|Ga0210399_10610363 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300021046|Ga0215015_10382100 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae | 6079 | Open in IMG/M |
| 3300021078|Ga0210381_10160659 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300021086|Ga0179596_10677802 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 522 | Open in IMG/M |
| 3300022756|Ga0222622_10296574 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300024288|Ga0179589_10446881 | Not Available | 596 | Open in IMG/M |
| 3300025906|Ga0207699_10471367 | Not Available | 903 | Open in IMG/M |
| 3300025939|Ga0207665_10307465 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
| 3300026023|Ga0207677_12009766 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 537 | Open in IMG/M |
| 3300026351|Ga0257170_1027840 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300026354|Ga0257180_1013999 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300026515|Ga0257158_1042927 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300026557|Ga0179587_10540590 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 766 | Open in IMG/M |
| 3300026557|Ga0179587_10890954 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300027537|Ga0209419_1001157 | All Organisms → cellular organisms → Bacteria | 3220 | Open in IMG/M |
| 3300027537|Ga0209419_1005015 | Not Available | 2034 | Open in IMG/M |
| 3300027635|Ga0209625_1006428 | All Organisms → cellular organisms → Bacteria | 2554 | Open in IMG/M |
| 3300027727|Ga0209328_10001504 | All Organisms → cellular organisms → Bacteria | 6465 | Open in IMG/M |
| 3300027787|Ga0209074_10329038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 620 | Open in IMG/M |
| 3300028379|Ga0268266_10290697 | All Organisms → cellular organisms → Bacteria | 1522 | Open in IMG/M |
| 3300028673|Ga0257175_1002934 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2111 | Open in IMG/M |
| 3300030923|Ga0138296_1117897 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
| 3300031128|Ga0170823_17693159 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 516 | Open in IMG/M |
| 3300031231|Ga0170824_120871186 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 776 | Open in IMG/M |
| 3300031754|Ga0307475_11369567 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300031820|Ga0307473_11166413 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 571 | Open in IMG/M |
| 3300031962|Ga0307479_11684173 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300032174|Ga0307470_10114770 | All Organisms → cellular organisms → Bacteria | 1576 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.26% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.13% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.13% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.42% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.56% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.71% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.71% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.85% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.85% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.85% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.85% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.85% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.85% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001369 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010862 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012169 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC074 MetaG | Host-Associated | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300030923 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_00986850 | 2088090014 | Soil | MTIKWHTAPEWDFSLWFALLSPLFGALLGVLGVFILGR |
| JGI12701J14581_10157532 | 3300001369 | Forest Soil | MKARPNRIVAWDFSLWFALLSPVIGTLLGILGGFLLYHWKETQR* |
| JGIcombinedJ26739_1009725472 | 3300002245 | Forest Soil | ETVMIARVVKYDSIAGWNFSLWFALLSPLIGILLGFLGGFLLYH* |
| JGI25612J43240_10815602 | 3300002886 | Grasslands Soil | MTARVVKYHSIAERNFSLWFVLFSPVIGILLGILGAFLLYH* |
| Ga0062594_1002005822 | 3300005093 | Soil | MMKTKGNGITVWDFSLWFAALSPVIGVLLGILGGFLLYN* |
| Ga0066678_102013341 | 3300005181 | Soil | RRNLRKETVMIARVVKYHSIAEWNFSLWFALHSPLIGILLGFLGGFLLYH* |
| Ga0066676_105128491 | 3300005186 | Soil | ERRRNLRKETVMIAKTKYHSITEWDFSLWFALLSPLIGILLGILGVFLLYH* |
| Ga0065704_101771212 | 3300005289 | Switchgrass Rhizosphere | MIAKTKYHSIAEWNFLLWFALLSPLIGILLGFLGVFLLYH* |
| Ga0065704_104771333 | 3300005289 | Switchgrass Rhizosphere | MIAKTKYHSIAEWDFSLWFALLSPLIGILFDILGGFLLYH* |
| Ga0065704_106530901 | 3300005289 | Switchgrass Rhizosphere | RKETVMIARVVKYHSKMPVRLGPEWNFSLWFALLSPLIGILLGILGVFLLYH* |
| Ga0065705_104906872 | 3300005294 | Switchgrass Rhizosphere | MIARVVKYHSKMPVRLGPEWNFSLWFALLSPLIGILLGILGVFLLYH* |
| Ga0070675_1018198252 | 3300005354 | Miscanthus Rhizosphere | MIAQVVKYESIAEWNFSLWFALLSPLIGILLGFLGGFLLYH* |
| Ga0070671_1006265282 | 3300005355 | Switchgrass Rhizosphere | MTARVVKYHSIAERNFSLWFVRFSPVIGILLGILGAFLLYH* |
| Ga0070673_1017789451 | 3300005364 | Switchgrass Rhizosphere | MIAQVVKYESIAEWNFSLWFALLSPLIGILSGLLGGFLPYH* |
| Ga0070688_1013203132 | 3300005365 | Switchgrass Rhizosphere | MMKTKGNGITVWDFSLWFAALSPVIGVLLGILGGFLLYH* |
| Ga0070667_1001483113 | 3300005367 | Switchgrass Rhizosphere | MTARVVKYHSIAERNFSLWFVLFSPVIGILLGILGTFLLYH* |
| Ga0070713_1002563354 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | QQRRNPRKETVMIARWNFSLWFALLSPVIGILLGILGVFLFYH* |
| Ga0070710_103274462 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MIARVVKYHSIAEWNFSLWFALLSPVIGILLGILGVFLLY |
| Ga0066682_107571611 | 3300005450 | Soil | AGQQRRRNLRKETVMIARVVKHHSIAEWDFSLWFALLSPLIGILLGILGVFLLYH* |
| Ga0070681_119891621 | 3300005458 | Corn Rhizosphere | RRNPRKETVMIARVVKYYSMAEWHFSLWFALLSPLIGILLGILGVFLLYH* |
| Ga0070704_1018667502 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MIARVVKYHSIAEWNFSLWFALLSPVIGILLGILGVFLLYH* |
| Ga0066701_100504261 | 3300005552 | Soil | MKIKWHAFAEWNFSLWFALLSPLIGVLLGILGVFILYH* |
| Ga0066701_103423972 | 3300005552 | Soil | MIARVVKYHSIANWDFSLWFALLSPLIGILLGFLGGFLLYHSKQTQR* |
| Ga0066661_100546572 | 3300005554 | Soil | MKARPNSSVAWDFSLWFALLSPVIGTLLGILGVFLLYH* |
| Ga0066692_102022924 | 3300005555 | Soil | QKETITMKIKWHAFAEWNFSLWFALLSPLIGVLLGILGVFILYH* |
| Ga0066707_104573772 | 3300005556 | Soil | MIARVVKYHSIAEWTFSLWFALLSPLIGILLGFLGGFLLYH* |
| Ga0066700_107023782 | 3300005559 | Soil | MTARVVKYHSIAERNFSLWFVLFSPVIGILLGILG |
| Ga0066694_103172622 | 3300005574 | Soil | MIARVVKYHSIAEWNFSLWFAPLSPLIGILLGFLGGFLLYH* |
| Ga0068864_1023282941 | 3300005618 | Switchgrass Rhizosphere | QRRRNLGKETVMTARVVKYHSIAERNFSLWFVLFSPVIGILLGILGVFLLYH* |
| Ga0070717_113625642 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTARIVKYHSIAERNFSLWFVLFSPVIGILLGILGAFLLYH* |
| Ga0066656_108969552 | 3300006034 | Soil | MIARVVKYHSIAEWNFSLWFALLSPLIGILLGILGGFLLYH* |
| Ga0066652_1003344892 | 3300006046 | Soil | MIARVVKYHSIAEWNFSLWFAPLSPLIGILLGFLGGFLLYR* |
| Ga0070712_1002982883 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MIARVVKYHSIAEWNFSLWFALLSPLIGILLGFLGGFLLYH* |
| Ga0070765_1003141241 | 3300006176 | Soil | MIARVVKYHSVAEWNFSLWFVLLSPLIGILLGILGGFLLYH* |
| Ga0079222_100139913 | 3300006755 | Agricultural Soil | MKTKGNDIAVWDFSLWFAALSPVIGVLLGILGGFLLYH* |
| Ga0073928_103416871 | 3300006893 | Iron-Sulfur Acid Spring | RPAGQERRWSLRKETVMIARVVKYHSIAEWNLSLWFALLSPLIGILLGFLGGFLLYH* |
| Ga0099791_105184041 | 3300007255 | Vadose Zone Soil | MIAKTKYHTIAEWNFSLWFALLSPLIGILLGILGVFLLYH* |
| Ga0099795_101684394 | 3300007788 | Vadose Zone Soil | NLGKETVMTARVVKYHSIAERNFSLWFVLFSPVIGILLGILGAFLLYH* |
| Ga0099829_113778952 | 3300009038 | Vadose Zone Soil | MITMNSKWHDIAEWDFSLWFALLSPVIGILFGILGVFLLYH* |
| Ga0099828_117848841 | 3300009089 | Vadose Zone Soil | RKNRPAGQQRRRNLGKETGRTARVVKCHSIAERNFSLWFVLFSPVIGILLGILGAFLLYH |
| Ga0105245_132124372 | 3300009098 | Miscanthus Rhizosphere | GKETVMTARVVKYHSIAERNFSLWFVLFSPVIGILLGILGAFLLYH* |
| Ga0066709_1044832971 | 3300009137 | Grasslands Soil | KETVMIAKTKYRTSAEWNFSLWFALLSPLIGILFGILEGFLLYH* |
| Ga0099792_107613231 | 3300009143 | Vadose Zone Soil | PAGEQQRRNIEKETVMIAKTKYHTIAKWNFSLWFALLSPLIGILLGILGVFLLYH* |
| Ga0099796_105187412 | 3300010159 | Vadose Zone Soil | MIAKTKYHTIAEWNFSLWFALLSPLIGILLGILGVF |
| Ga0134088_105547061 | 3300010304 | Grasslands Soil | RNLRKETVMIARVVKYHSIAEWNFSFWFALLSPLIGILLGFLGGFLLYH* |
| Ga0134126_121600291 | 3300010396 | Terrestrial Soil | MTARVVKYHTIAERNFSLWFVLFSPVIGVLLGILGAFLLYH* |
| Ga0126348_12722861 | 3300010862 | Boreal Forest Soil | MTARVVKCHSIAEWNFSLWFALLSPLIGIVLGFLGGFLLYH* |
| Ga0137392_103284784 | 3300011269 | Vadose Zone Soil | MTARVVKYHSIAERNVSLWFVLFSPVIGILLGILGAFLLYH* |
| Ga0137393_110058551 | 3300011271 | Vadose Zone Soil | VMTARVVKYHSIAERNVSLWFVLFSPVIGILLGILGAFLLYH* |
| Ga0153990_11185702 | 3300012169 | Attine Ant Fungus Gardens | MKTKFESVAEWDFSLWFALLSPVIGTLLGILGVFLLYN* |
| Ga0137388_103496224 | 3300012189 | Vadose Zone Soil | KNRPAGQQRRRNLGKETVMTARVVKYHSIAERNVSLWFVLFSPVIGILLGILGAFLLYH* |
| Ga0137364_101616761 | 3300012198 | Vadose Zone Soil | NRPAGQQRRRNLGKETVMTARVVKYHSIAERNFSLWFVLFSPVIGILLGILGAFLLYH* |
| Ga0137382_101320961 | 3300012200 | Vadose Zone Soil | RRRNLGKETVMTARVVKYHSIAERNFSLWFVLFSPVIGILLGILGAFLLYH* |
| Ga0137363_111881222 | 3300012202 | Vadose Zone Soil | MIAKTKYHSIAEWDFSLWFALLSPLIGILFGILGGFLLCH* |
| Ga0137399_117311741 | 3300012203 | Vadose Zone Soil | MIAKTKYHAIVESNFSLWFALLSPLIGTLLGILGEFLLYH* |
| Ga0137372_112222611 | 3300012350 | Vadose Zone Soil | RNLRKETVMIARVVKYHSIAEWNFSLWFALLTPLIGISFSILGGFLLYH* |
| Ga0137390_105795692 | 3300012363 | Vadose Zone Soil | MIARVVKYHSIAEWNFSLWFALLSPVIGILLGFLGVFLLYH* |
| Ga0137397_106139972 | 3300012685 | Vadose Zone Soil | MIARVVKYHTIAESNFSLWFALLSPLIGILLGILGVFLLYH* |
| Ga0157302_100838952 | 3300012915 | Soil | MIARVVKYHSIAEWNFSLWFALLSPLIGILFGMLKVFLFYH* |
| Ga0137394_102117962 | 3300012922 | Vadose Zone Soil | MIARVVKYHSIAESNFSLWFALLSPLIGILLGILGVFLLYH* |
| Ga0137359_112493842 | 3300012923 | Vadose Zone Soil | MTARVVKYHSIAERNFSLWFVLFSPVIGILLGFLGAFLLYH* |
| Ga0137416_103968702 | 3300012927 | Vadose Zone Soil | MIARVVKYHSIAEWTFSLWFALLSPLIGILLGFIESKTSQ* |
| Ga0137404_109646791 | 3300012929 | Vadose Zone Soil | AGQQRRRDVRRETVMIAKTKYHTIAERNFSLWFALLSPLIGILLGFLGGFLLYH* |
| Ga0137404_115443872 | 3300012929 | Vadose Zone Soil | YHSIDEWNFSLWFALLSPLIGILLGFLGGFLLYH* |
| Ga0164300_101177873 | 3300012951 | Soil | MTARVVKYHSIAERNFSLWFVLFSPVIGILLGILGAFLLYQ* |
| Ga0164301_107964222 | 3300012960 | Soil | MTARVVKYRSIAERNFSLWFVLFSSVIGILLGILGAFLLYH* |
| Ga0164302_106221091 | 3300012961 | Soil | TAVIARVVKYHSIAEWNFTLWFALLSPLIGILLGILGVFLLYH* |
| Ga0164306_104297151 | 3300012988 | Soil | RKNRPAGQQRRRNLGKETVMTARVVKYRSIAERNFSLWFVLFSPVIGILLGILGAFLLYH |
| Ga0157374_102665752 | 3300013296 | Miscanthus Rhizosphere | MIAQVVKYESIAEWNFSLWFVRFSPVIGILLGILGAFLLYH* |
| Ga0157374_111730071 | 3300013296 | Miscanthus Rhizosphere | RETVMIAQVVKYESIAEWNFSLWFALLSPLIGILSGLLGGFLPYH* |
| Ga0157374_112509603 | 3300013296 | Miscanthus Rhizosphere | YYSMAEWDFSLWFALLSPLIGILLGILGVFLLCH* |
| Ga0157378_100984062 | 3300013297 | Miscanthus Rhizosphere | MTGRVVKYHSIAERNFSLWFVLFSPVIGILLGILGAFLLYH* |
| Ga0163162_130563321 | 3300013306 | Switchgrass Rhizosphere | QERSRNLRKETVMIAKTKYHSIAEWDFSLWFALLSPLIGILFGILGGFLLYH* |
| Ga0137411_10495702 | 3300015052 | Vadose Zone Soil | MIAKTKYHTLAEWNFSLWFALLSPLIGILLGILGVFLLYH* |
| Ga0173483_106464131 | 3300015077 | Soil | KETVMIARVVKYHSIANWDFSLWFALLSPLIGILLGFLGGFLLYH* |
| Ga0137412_101547934 | 3300015242 | Vadose Zone Soil | MTAKTKYHTIAEWNFSLWFALLSPLIGILLGILGVFLLYH* |
| Ga0137412_112396071 | 3300015242 | Vadose Zone Soil | TVMIAKTKYHSIAEWDFSLWFALLSPLIGILFGILGGFLLCH* |
| Ga0132258_129292822 | 3300015371 | Arabidopsis Rhizosphere | MIAKTKYHSIAEWDFSLWFALLSPLIGILFGILGGFLLYH* |
| Ga0134083_104718821 | 3300017659 | Grasslands Soil | QRRRNLRKETVMIARVVKYHSIAEWNFSLWFALLSPLIGILLGFLGGFLLYR |
| Ga0184605_101897362 | 3300018027 | Groundwater Sediment | MTARVVKYHSIAERNFSLWFVLFSPVIGILLGILGAFLLYH |
| Ga0184605_105102652 | 3300018027 | Groundwater Sediment | MIARVVKYHSIAEWNFSLWFALLSPVIGILLGFLGGFLLYH |
| Ga0066655_109558602 | 3300018431 | Grasslands Soil | MIARIVKYHSIAEWNFSLGFALLSPLIGILLGFLGGFLLYH |
| Ga0066667_100271505 | 3300018433 | Grasslands Soil | MKARPNSSVAWDFSLWFALLSPVIGTLLGILGVFLLYH |
| Ga0137408_10007572 | 3300019789 | Vadose Zone Soil | MTARVVKYHSIAERNFSLWFVLLSPVIGILLGILGAFLLYH |
| Ga0193723_10390652 | 3300019879 | Soil | MIAKTKYHTIAEWNFSLWFALLSPLIGILLGILGVFLLYH |
| Ga0193713_10947342 | 3300019882 | Soil | MIARVVKYHSIAQWNFSLWFALLSPLIGILLGILGEFLLYH |
| Ga0193725_10636831 | 3300019883 | Soil | NETVMTARVVKYHSIAERNFSLWFVLFSPVIGILLGILGAFLLYH |
| Ga0193729_10603913 | 3300019887 | Soil | MIARVVKYHSIAEWNLSLWFALLSPLIGVLLGILGGFLLYH |
| Ga0193726_10330383 | 3300020021 | Soil | MIAKIKYHTIAEWDFSLSFALLSPLIGILLGFLGAFLLSH |
| Ga0210399_106103632 | 3300020581 | Soil | MIAKTKYHTIAKSNFSLWFALLSPLIGILLGILGEFLLYH |
| Ga0215015_103821002 | 3300021046 | Soil | MKIKLHTVAEWDFSLWFALLSPLIGVLLGVLGVFILYR |
| Ga0210381_101606591 | 3300021078 | Groundwater Sediment | MIARVVKYHSIAEWNFSLWFALLSPVIGILLGFLGGFLL |
| Ga0179596_106778021 | 3300021086 | Vadose Zone Soil | RNIEKETVMIAKTKYHTIAEWNFSLWFALLSPLIGILLGILGVFLLYH |
| Ga0222622_102965744 | 3300022756 | Groundwater Sediment | MTARVVKYHSIAERNFSLWFVLFGPVIGILLGILGAFLLYH |
| Ga0179589_104468811 | 3300024288 | Vadose Zone Soil | MKTKCHDIAEWDFSLWFALLSPLIGAALGLFGVSFL |
| Ga0207699_104713672 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MTARVVKYHSIAERNFSLWFVRFSPVIGILLGILGAFLLYH |
| Ga0207665_103074652 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MTARIVKYHSIAERNFSLWFVLFSPVIGILLGILGAFLLYH |
| Ga0207677_120097661 | 3300026023 | Miscanthus Rhizosphere | TEPSKETVMIAQVVRYESIAEWNFSLWFALLSPLIGILSGLLGGFLPYH |
| Ga0257170_10278402 | 3300026351 | Soil | MIARVVKYHSIAERNFSLWFVLFSPVIGILLGILGAFLLYH |
| Ga0257180_10139994 | 3300026354 | Soil | MTARVVKYHSIAERNVSLWFVLFSPVIGILLGILGAFLLYH |
| Ga0257158_10429272 | 3300026515 | Soil | MIARVVKHHSIAERNFSLWFVLFSPVIGILLGILGAFLLYH |
| Ga0179587_105405902 | 3300026557 | Vadose Zone Soil | MIAKTKYHSIAEWDFSLWFALLSPLIGILFGILGGFLLCH |
| Ga0179587_108909542 | 3300026557 | Vadose Zone Soil | MIARVVKYHSIAEWNLSLWFALLSPLIGILLGILGGFLLYH |
| Ga0209419_10011571 | 3300027537 | Forest Soil | MIARVVKYHSIAEWNFSLWFALLSPLIGILLGFLGGFLLYH |
| Ga0209419_10050154 | 3300027537 | Forest Soil | RPHSRKNRPSGQERRRNLRKETVMMTQWNFSLWFALLSPVIGILLGILGVFLLYH |
| Ga0209625_10064281 | 3300027635 | Forest Soil | MIARVVKHHSIAEWNFSLWFALLSPVIGISLGFLGAFVLYH |
| Ga0209328_100015042 | 3300027727 | Forest Soil | MKARPNRIVAWDFSLWFALLSPVIGTLLGILGGFLLYHWKETQR |
| Ga0209074_103290382 | 3300027787 | Agricultural Soil | MKTKGNDIAVWDFSLWFAALSPVIGVLLGILGGFLLYH |
| Ga0268266_102906974 | 3300028379 | Switchgrass Rhizosphere | MMKTKGNGITVWDFSLWFAALSPVIGVLLGILGGFLLYN |
| Ga0257175_10029344 | 3300028673 | Soil | MIARVVKYHSIANWDFSLWFALLSPLIGILLGFLGGFLLYH |
| Ga0138296_11178972 | 3300030923 | Soil | MKTKHHSIIEWDFSFWFALLSPVIGILLGILGGFLLYH |
| Ga0170823_176931592 | 3300031128 | Forest Soil | MKTKHYSIIEWDFSLWFALLSPVIGILLGILGIFLLYQ |
| Ga0170824_1208711862 | 3300031231 | Forest Soil | MTARVVKYHTIAERNFSLRFVLFSPVIGILLGILGAFLLYH |
| Ga0307475_113695672 | 3300031754 | Hardwood Forest Soil | MKTKHHSIIEWDFSLWFALLSPVIGILLGILGVFLLYH |
| Ga0307473_111664132 | 3300031820 | Hardwood Forest Soil | MIARVVKYHSIAERNFSLWFVLFSPVIGILLGILGAFLLYQ |
| Ga0307479_116841732 | 3300031962 | Hardwood Forest Soil | MIARVVKYHSIAEWNFPLWFALLSLLIGILLGFLGGFLLYH |
| Ga0307470_101147704 | 3300032174 | Hardwood Forest Soil | MTARVVKYHSIAERNFSLWFVLFSPVIGILLGILGAFLLYQ |
| ⦗Top⦘ |