


| Basic Information | |
|---|---|
| Family ID | F077954 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MVIHYQPERLRRNSDQPTAITNVLVATSGSSSRTGDIPLGTP |
| Number of Associated Samples | 80 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 99.15 % |
| % of genes near scaffold ends (potentially truncated) | 95.73 % |
| % of genes from short scaffolds (< 2000 bps) | 98.29 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.16 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (60.684 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (51.282 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.137 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (48.718 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.00% β-sheet: 0.00% Coil/Unstructured: 80.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.16 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF13453 | zf-TFIIB | 39.32 |
| PF00011 | HSP20 | 25.64 |
| PF01145 | Band_7 | 5.98 |
| PF02909 | TetR_C_1 | 1.71 |
| PF13610 | DDE_Tnp_IS240 | 0.85 |
| PF00440 | TetR_N | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 25.64 |
| COG1309 | DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA | Transcription [K] | 1.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 60.68 % |
| All Organisms | root | All Organisms | 39.32 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2070309009|GPKNP_GG3DY5402J2P14 | Not Available | 532 | Open in IMG/M |
| 3300000956|JGI10216J12902_104678978 | Not Available | 625 | Open in IMG/M |
| 3300001431|F14TB_102374086 | Not Available | 834 | Open in IMG/M |
| 3300006058|Ga0075432_10450864 | Not Available | 565 | Open in IMG/M |
| 3300006580|Ga0074049_12528739 | Not Available | 508 | Open in IMG/M |
| 3300009100|Ga0075418_11880518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 651 | Open in IMG/M |
| 3300009100|Ga0075418_11941808 | Not Available | 641 | Open in IMG/M |
| 3300009799|Ga0105075_1035735 | Not Available | 589 | Open in IMG/M |
| 3300009805|Ga0105079_1003141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. LS1 | 1061 | Open in IMG/M |
| 3300009815|Ga0105070_1120800 | Not Available | 527 | Open in IMG/M |
| 3300009818|Ga0105072_1028321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. LS1 | 1035 | Open in IMG/M |
| 3300009820|Ga0105085_1035137 | Not Available | 889 | Open in IMG/M |
| 3300009837|Ga0105058_1150564 | Not Available | 565 | Open in IMG/M |
| 3300010039|Ga0126309_10288421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 944 | Open in IMG/M |
| 3300010041|Ga0126312_11330111 | Not Available | 532 | Open in IMG/M |
| 3300010044|Ga0126310_11096613 | Not Available | 633 | Open in IMG/M |
| 3300010045|Ga0126311_11051112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 668 | Open in IMG/M |
| 3300010045|Ga0126311_11867917 | Not Available | 510 | Open in IMG/M |
| 3300010085|Ga0127445_1089879 | Not Available | 788 | Open in IMG/M |
| 3300010399|Ga0134127_13660706 | Not Available | 504 | Open in IMG/M |
| 3300010400|Ga0134122_12475763 | Not Available | 568 | Open in IMG/M |
| 3300012201|Ga0137365_10656384 | Not Available | 768 | Open in IMG/M |
| 3300012358|Ga0137368_10200410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1420 | Open in IMG/M |
| 3300012373|Ga0134042_1149593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 895 | Open in IMG/M |
| 3300012396|Ga0134057_1281741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2024 | Open in IMG/M |
| 3300012515|Ga0157338_1050930 | Not Available | 594 | Open in IMG/M |
| 3300017997|Ga0184610_1006472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2809 | Open in IMG/M |
| 3300018028|Ga0184608_10305144 | Not Available | 700 | Open in IMG/M |
| 3300018053|Ga0184626_10134707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1050 | Open in IMG/M |
| 3300018071|Ga0184618_10419563 | Not Available | 565 | Open in IMG/M |
| 3300018075|Ga0184632_10294861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 702 | Open in IMG/M |
| 3300018077|Ga0184633_10352790 | Not Available | 742 | Open in IMG/M |
| 3300018432|Ga0190275_13220818 | Not Available | 528 | Open in IMG/M |
| 3300018476|Ga0190274_12280510 | Not Available | 638 | Open in IMG/M |
| 3300019254|Ga0184641_1027630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis vancoresmycina → Amycolatopsis vancoresmycina DSM 44592 | 608 | Open in IMG/M |
| 3300019254|Ga0184641_1373781 | Not Available | 511 | Open in IMG/M |
| 3300019254|Ga0184641_1388591 | Not Available | 694 | Open in IMG/M |
| 3300019255|Ga0184643_1455219 | Not Available | 697 | Open in IMG/M |
| 3300019269|Ga0184644_1426438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1159 | Open in IMG/M |
| 3300019279|Ga0184642_1592247 | Not Available | 615 | Open in IMG/M |
| 3300019279|Ga0184642_1723668 | Not Available | 545 | Open in IMG/M |
| 3300019869|Ga0193705_1045718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 914 | Open in IMG/M |
| 3300019869|Ga0193705_1082026 | Not Available | 620 | Open in IMG/M |
| 3300021951|Ga0222624_1038300 | Not Available | 510 | Open in IMG/M |
| 3300022195|Ga0222625_1370207 | Not Available | 703 | Open in IMG/M |
| 3300026118|Ga0207675_101537031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 686 | Open in IMG/M |
| 3300026704|Ga0208581_104200 | Not Available | 642 | Open in IMG/M |
| 3300027209|Ga0209875_1016471 | Not Available | 871 | Open in IMG/M |
| 3300027209|Ga0209875_1020823 | Not Available | 776 | Open in IMG/M |
| 3300027277|Ga0209846_1009935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1618 | Open in IMG/M |
| 3300027750|Ga0209461_10107333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 640 | Open in IMG/M |
| 3300028717|Ga0307298_10207067 | Not Available | 578 | Open in IMG/M |
| 3300028722|Ga0307319_10074938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1073 | Open in IMG/M |
| 3300028791|Ga0307290_10064435 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
| 3300028807|Ga0307305_10495687 | Not Available | 548 | Open in IMG/M |
| 3300028824|Ga0307310_10392643 | Not Available | 688 | Open in IMG/M |
| 3300028828|Ga0307312_10973607 | Not Available | 562 | Open in IMG/M |
| 3300028878|Ga0307278_10329854 | Not Available | 673 | Open in IMG/M |
| 3300028881|Ga0307277_10273032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 748 | Open in IMG/M |
| 3300028884|Ga0307308_10259116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. LS1 | 833 | Open in IMG/M |
| 3300030830|Ga0308205_1031612 | Not Available | 650 | Open in IMG/M |
| 3300030831|Ga0308152_101040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1190 | Open in IMG/M |
| 3300030831|Ga0308152_101537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1047 | Open in IMG/M |
| 3300030831|Ga0308152_101954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 970 | Open in IMG/M |
| 3300030831|Ga0308152_102060 | Not Available | 953 | Open in IMG/M |
| 3300030831|Ga0308152_104819 | Not Available | 732 | Open in IMG/M |
| 3300030902|Ga0308202_1018557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1066 | Open in IMG/M |
| 3300030986|Ga0308154_103353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 880 | Open in IMG/M |
| 3300030987|Ga0308155_1005337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 917 | Open in IMG/M |
| 3300030988|Ga0308183_1073128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 734 | Open in IMG/M |
| 3300030990|Ga0308178_1020484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1044 | Open in IMG/M |
| 3300030990|Ga0308178_1021723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1025 | Open in IMG/M |
| 3300031081|Ga0308185_1009763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1003 | Open in IMG/M |
| 3300031081|Ga0308185_1012897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. LS1 | 906 | Open in IMG/M |
| 3300031081|Ga0308185_1019165 | Not Available | 779 | Open in IMG/M |
| 3300031091|Ga0308201_10099664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 836 | Open in IMG/M |
| 3300031095|Ga0308184_1008246 | Not Available | 938 | Open in IMG/M |
| 3300031100|Ga0308180_1009431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 835 | Open in IMG/M |
| 3300031100|Ga0308180_1026574 | Not Available | 586 | Open in IMG/M |
| 3300031100|Ga0308180_1037410 | Not Available | 524 | Open in IMG/M |
| 3300031114|Ga0308187_10112663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 861 | Open in IMG/M |
| 3300031114|Ga0308187_10314318 | Not Available | 592 | Open in IMG/M |
| 3300031114|Ga0308187_10413142 | Not Available | 536 | Open in IMG/M |
| 3300031124|Ga0308151_1011698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 820 | Open in IMG/M |
| 3300031124|Ga0308151_1021315 | Not Available | 671 | Open in IMG/M |
| 3300031125|Ga0308182_1021155 | Not Available | 558 | Open in IMG/M |
| 3300031423|Ga0308177_1002232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1105 | Open in IMG/M |
| 3300031423|Ga0308177_1008508 | Not Available | 750 | Open in IMG/M |
| 3300031424|Ga0308179_1022477 | Not Available | 703 | Open in IMG/M |
| 3300031424|Ga0308179_1036133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 602 | Open in IMG/M |
| 3300031424|Ga0308179_1045588 | Not Available | 558 | Open in IMG/M |
| 3300031505|Ga0308150_1001004 | Not Available | 1917 | Open in IMG/M |
| 3300031505|Ga0308150_1004818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1133 | Open in IMG/M |
| 3300031903|Ga0307407_10930258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 668 | Open in IMG/M |
| 3300031903|Ga0307407_11605211 | Not Available | 516 | Open in IMG/M |
| 3300031903|Ga0307407_11626070 | Not Available | 513 | Open in IMG/M |
| 3300032002|Ga0307416_100273743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1660 | Open in IMG/M |
| 3300032002|Ga0307416_101922685 | Not Available | 695 | Open in IMG/M |
| 3300032004|Ga0307414_11299197 | Not Available | 675 | Open in IMG/M |
| 3300032004|Ga0307414_11553644 | Not Available | 616 | Open in IMG/M |
| 3300032005|Ga0307411_11430975 | Not Available | 633 | Open in IMG/M |
| 3300032126|Ga0307415_100794045 | Not Available | 863 | Open in IMG/M |
| 3300032126|Ga0307415_101058844 | Not Available | 757 | Open in IMG/M |
| 3300034448|Ga0370540_11190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 580 | Open in IMG/M |
| 3300034643|Ga0370545_049294 | Not Available | 814 | Open in IMG/M |
| 3300034644|Ga0370548_082330 | Not Available | 626 | Open in IMG/M |
| 3300034680|Ga0370541_007246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1049 | Open in IMG/M |
| 3300034680|Ga0370541_007325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. LS1 | 1045 | Open in IMG/M |
| 3300034680|Ga0370541_018405 | Not Available | 770 | Open in IMG/M |
| 3300034680|Ga0370541_022275 | Not Available | 721 | Open in IMG/M |
| 3300034680|Ga0370541_024882 | Not Available | 695 | Open in IMG/M |
| 3300034680|Ga0370541_033921 | Not Available | 624 | Open in IMG/M |
| 3300034681|Ga0370546_012870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1018 | Open in IMG/M |
| 3300034681|Ga0370546_015040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 968 | Open in IMG/M |
| 3300034681|Ga0370546_034891 | Not Available | 729 | Open in IMG/M |
| 3300034681|Ga0370546_077789 | Not Available | 552 | Open in IMG/M |
| 3300034681|Ga0370546_089313 | Not Available | 523 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 51.28% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 8.55% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 7.69% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 7.69% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.13% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.27% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.56% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.56% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.71% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2070309009 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009799 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 | Environmental | Open in IMG/M |
| 3300009805 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_0_10 | Environmental | Open in IMG/M |
| 3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010085 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012373 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012396 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019254 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
| 3300021951 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026704 | Grasslands soil microbial communities from Gorham, Kansas, USA that are Nitrogen fertilized - NN606 (SPAdes) | Environmental | Open in IMG/M |
| 3300027209 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027277 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030830 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030831 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_141 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030986 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_143 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030987 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_144 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030988 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031081 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_159 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031095 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_158 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031100 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_151 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031124 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_140 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031125 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_153 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031423 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_148 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031424 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_150 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031505 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_139 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300034448 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_115 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034680 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_116 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034681 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_121 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPKNP_08990520 | 2070309009 | Soil | MVIHYPPAQLRRNSDQPTAITGVLVATSGIVPPHR |
| JGI10216J12902_1046789781 | 3300000956 | Soil | MVAHYPPARLRHNSDRPTAITDVLVATSPSSHRTGEIP |
| F14TB_1023740863 | 3300001431 | Soil | MLTHFEPGRLXXXSDRPTAITDVLVATSPSGYRTGDI |
| Ga0075432_104508641 | 3300006058 | Populus Rhizosphere | MVIHYQPERLRHNSDQPTAITDVLVATPGSSHQTSEILL |
| Ga0074049_125287391 | 3300006580 | Soil | MVIHYPSARLRRNSDQPTAITDVLVATAGSSSRTG |
| Ga0075418_118805183 | 3300009100 | Populus Rhizosphere | MVIHYPPERLRSNSDRPSAITDVLVATTGSSSTGEISLGAPTCSAR |
| Ga0075418_119418083 | 3300009100 | Populus Rhizosphere | MGIHCQPERLRHDSDQPTAITNVLVATSGSSYHTGDIPLGVP |
| Ga0105075_10357353 | 3300009799 | Groundwater Sand | MVIHYQPGRLRRNSDQPTAITNVLVATSGSSARTGDIPLGTPTCSVRTRH |
| Ga0105079_10031412 | 3300009805 | Groundwater Sand | MVIHYQPGRLRRNSDQPTVVTDVLVATSPSSWRTGDIPLGT |
| Ga0105070_11208003 | 3300009815 | Groundwater Sand | MVIHYQPGRLRRNSDQPTAITDVLVATSGSSARTGDIPLGTP |
| Ga0105072_10283211 | 3300009818 | Groundwater Sand | MVIHYQPGRLRRNSDQPTAITNVLVATSGSSARTGDIPLG |
| Ga0105085_10351371 | 3300009820 | Groundwater Sand | MVLHYQPERLRYNSDQPTAITNVLVATSGSSCRTGEIPLGT |
| Ga0105058_11505641 | 3300009837 | Groundwater Sand | MVIHYQPGRLRRNSDQPTAITNVLVATSGSSARTGDIPL |
| Ga0126309_102884213 | 3300010039 | Serpentine Soil | MVIHYPPTRLRSNSDQPTAITNVLVTTSGCTRTGDI |
| Ga0126312_113301111 | 3300010041 | Serpentine Soil | MVIHYPPERLRRNSDRPTAITDVLVATSGSSYRTGD |
| Ga0126310_110966133 | 3300010044 | Serpentine Soil | MVTHYPPARLRYNSDQPTAITNVLLATSGSSSRTGDI |
| Ga0126311_110511123 | 3300010045 | Serpentine Soil | MVIHYPPARLRSNSDQPTAITNVLVTTSGSSHQSGEIPLGTP |
| Ga0126311_118679172 | 3300010045 | Serpentine Soil | MVIHYPPARLRHNSDQPTAITNVLVATSGSSSRTGEIPLGSPT |
| Ga0127445_10898791 | 3300010085 | Grasslands Soil | MVIPYQPERLRYNSDQPTAVTNVLVATSGSTCRTGDIPLGIP |
| Ga0134127_136607061 | 3300010399 | Terrestrial Soil | MVIHYPPERLRSNSERLSAITDVLVTTTGSSSTGEIS |
| Ga0134122_124757631 | 3300010400 | Terrestrial Soil | MVIHYPPERLRSNSDRPSAITDVLVTTTGSSSTGEI |
| Ga0137365_106563842 | 3300012201 | Vadose Zone Soil | MVIHHQPGRLGRSSDQPTAITNVLAATSGSSHRTGDLPLGIPTC |
| Ga0137368_102004101 | 3300012358 | Vadose Zone Soil | MVIHYQPGQLRRDRDQPTAITGAQVATSPLFSRSSDLPLGTPTC |
| Ga0134042_11495931 | 3300012373 | Grasslands Soil | MVIHYQPERLRYNSDQPTAITNVLVATSGSSHQTRDIPLGTP |
| Ga0134057_12817414 | 3300012396 | Grasslands Soil | MVTHYSPARLRRNSDQPTAITNVLVATSPSSYRTGDIPLGTP |
| Ga0157338_10509301 | 3300012515 | Arabidopsis Rhizosphere | MVLHYQPERLRYTSDQPTAITNVLINRSGSSSRSGEIPLGSP |
| Ga0184610_10064721 | 3300017997 | Groundwater Sediment | MVIHYQPGRLRRNSDQPTAITNVLVATSGSSWRTSEIPL |
| Ga0184608_103051443 | 3300018028 | Groundwater Sediment | MVIHYPPARLRRNSDQPTAITDVLITGSGSSSRTG |
| Ga0184626_101347071 | 3300018053 | Groundwater Sediment | MVIHYQPGRLRRNSDQPTAIADVLVATSPSSYRTGDIPLGTPTCSA |
| Ga0184618_104195632 | 3300018071 | Groundwater Sediment | MVIHYPPERLRRNSDQPTAITNVMVATSGSSSHTGDIPLGTPTCSA |
| Ga0184632_102948611 | 3300018075 | Groundwater Sediment | MVIHYQPGRLRRNSDQPTAITNVVVATSPSSYRTSDIPL |
| Ga0184633_103527903 | 3300018077 | Groundwater Sediment | MVTHYPPARLRRNSDQPTTITDALVATSGSSYRTGEIPLGTPTC |
| Ga0190275_132208181 | 3300018432 | Soil | MVIHYPPERLRHNSDQPTAITNVLLATSGSSYRTGDIPLGTPTCSA |
| Ga0190274_122805101 | 3300018476 | Soil | MVIHYPPERLRSNSDRPTAITNVLVTTAGSTYHTGDIALGTPTC |
| Ga0184641_10276303 | 3300019254 | Groundwater Sediment | MVLHYPPARLRRNSDQPTAITDVLVATSGSSSRSGEIPLGTP |
| Ga0184641_13737811 | 3300019254 | Groundwater Sediment | MVIHYEPGQIRRNSDQPTAITGVLLATQGSSYRSGEIPLGTPTCS |
| Ga0184641_13885911 | 3300019254 | Groundwater Sediment | MVIHFTPAQLRRNSDRPTAITGVLVAGSPSIHAGTSDITLGTPTYS |
| Ga0184643_14552193 | 3300019255 | Groundwater Sediment | MVIHYPPARLRRNSDQPTAITDVLINRSGSSCRSGDIPLGTP |
| Ga0184644_14264383 | 3300019269 | Groundwater Sediment | MVTHYPPARLRYNSDQPTAITDVLINRSGSSSRSGEIPLGSPT |
| Ga0184642_15922472 | 3300019279 | Groundwater Sediment | MVIHYPSGRLRRNSDRPTAITDVLLATSGSSYRAGDIPLGT |
| Ga0184642_17236682 | 3300019279 | Groundwater Sediment | MVIHYEPGQIRRNSDQPTAITGVLLATQGSSYRSGEIPLGTPTCSSR |
| Ga0193705_10457183 | 3300019869 | Soil | VIHYPSARLRRNSDQPTAITNVLVATAGSSSRPGD |
| Ga0193705_10820261 | 3300019869 | Soil | MVIHDQPARLRQNSDQPTAITNVLVATAGSSSRPGDLPLAT |
| Ga0222624_10383001 | 3300021951 | Groundwater Sediment | MVTHYEPARLRRAGDQPTAITDVLVATSASTYRTGDIPLG |
| Ga0222625_13702072 | 3300022195 | Groundwater Sediment | MVTHYEPARLRRNRDQPSAITGVLVATSASTYRTGDI |
| Ga0207675_1015370311 | 3300026118 | Switchgrass Rhizosphere | MVIHYPPERLRSNSDRPSAITDVLVATTGSSSTGEIS |
| Ga0208581_1042002 | 3300026704 | Soil | MVIHYQPGRLRRNSDQPTAITDVLITTSGSSYTGDIPLGT |
| Ga0209875_10164713 | 3300027209 | Groundwater Sand | MVIHYQPERLRYNSDQPTAITDVLVATSGSSCRTGEIPLG |
| Ga0209875_10208232 | 3300027209 | Groundwater Sand | MVIHYQPGRLRRNSDQPTAITNVLVATSGSSARTGDIPLGT |
| Ga0209846_10099354 | 3300027277 | Groundwater Sand | MVIHYPPARLRYNSDQPTAITNVLVATSGSSHTGEIPLGT |
| Ga0209461_101073331 | 3300027750 | Agave | MVIHYPPARLRRNSDQPTAITDLLVATSGSSSPIGD |
| Ga0307298_102070673 | 3300028717 | Soil | MVTHYPPERLRHNSDRPTAITNVLISTSGSSRQSGEIPL |
| Ga0307319_100749383 | 3300028722 | Soil | MVIHYPPARLRRNSDQPTAITDVLITGSGSSSRTGDIPLGT |
| Ga0307290_100644351 | 3300028791 | Soil | MVIHYPPARLRHNSDQPAAITNVLVTTSGSSSRTGEIPLGT |
| Ga0307305_104956871 | 3300028807 | Soil | MVIHYPPARLRQNSDQPTAITDVLVATSGSSSRTGDLPLGTPTCSA |
| Ga0307310_103926431 | 3300028824 | Soil | VIHHPPARLRQNSDQPTAITNVLVATAGSSSRPGD |
| Ga0307312_109736072 | 3300028828 | Soil | MVLHYPPARLRRNSDQPTAITDVLVATSGSSSRSGEIPLGTPTCSAR |
| Ga0307278_103298543 | 3300028878 | Soil | MVIHYPPARLRHNSDQPAAITNVLVTTSGSSSRTGEIPLGTPTCSA |
| Ga0307277_102730323 | 3300028881 | Soil | MVTHYPPARLRHNSSGQPTAITNVLLTTSGSSSTGEIPLGPPTYSARS |
| Ga0307308_102591161 | 3300028884 | Soil | MVIHHRSGRPRRNGDQPTAITDVLVATSRSSHRTGDIPLGIPTCS |
| Ga0308205_10316121 | 3300030830 | Soil | MVIHYPPARLRYNSDQPTAITDVLVATSGSSSHTGDIPLGTPTC |
| Ga0308152_1010403 | 3300030831 | Soil | MVIHYQPERLRRNSDQPTAITNVLVATSGSSSRTGDIPLGTP |
| Ga0308152_1015372 | 3300030831 | Soil | MVTHYQPGRLRRNSDQPTAITNVLIATGSSHSTGDIPLGT |
| Ga0308152_1019543 | 3300030831 | Soil | MVTHYPPERLRYNSDQPTAITNVLVATSESSSRTGEI |
| Ga0308152_1020601 | 3300030831 | Soil | MVFHFTPNRLRRNSDQPTAITDVLVATSPSTYRTCD |
| Ga0308152_1048192 | 3300030831 | Soil | MVIHYPPARLRHNSDQPTAITDVLVATSGSSSRIGEIPLGTP |
| Ga0308202_10185573 | 3300030902 | Soil | MVIHYPPARLRHNSDQPSAITNVLVTTSGSSSRTGEIPLGT |
| Ga0308154_1033531 | 3300030986 | Soil | MVTHYPPERLRYNSDQPTAITNVLVATSESSSRTGEILLGTPTCSARSS |
| Ga0308155_10053373 | 3300030987 | Soil | MVIHYQPGRLRRNSDQPTAITNVVVATSPSSYRTSDIPLGTPTCS |
| Ga0308183_10731283 | 3300030988 | Soil | MVIHYPPERLRHNSDRPTAITSVLVATSASSQSGEIPLGTPTC |
| Ga0308178_10204842 | 3300030990 | Soil | MVIHYLPERLRYNSDQPTAITSVMVATSGSSSRTGEIPLGAPTC |
| Ga0308178_10217231 | 3300030990 | Soil | MVIHYPPARLRHNSDQPAAITNVLVATSGSSSRTGELPLGTP |
| Ga0308185_10097633 | 3300031081 | Soil | MVIHYPPERLRHNSDQPTAITNVLVTTAGSSHQTGEIPLGAPTCSA |
| Ga0308185_10128971 | 3300031081 | Soil | MVIHHRSGRPRRNGDQPTAITDVLVATSRSSHRTGDIPLGIPTCSA |
| Ga0308185_10191653 | 3300031081 | Soil | MVIHYPPARFRHNSDQPTAITNVLVATSGSSYTGDIPLGTPTCSART |
| Ga0308201_100996641 | 3300031091 | Soil | MVTHYPPERLRHNSDRPTAITNVLISTSGSSRQSGEIPLG |
| Ga0308184_10082462 | 3300031095 | Soil | MVIHFPPDRLRRNSDQPTAITDVLVATSGSSSRTGDIPLGTPTCS |
| Ga0308180_10094313 | 3300031100 | Soil | MVTHYPPERLRYNSDQPTAITNVLVATSESSSRTGEIPLGTPTCSAH |
| Ga0308180_10265742 | 3300031100 | Soil | MVIHYPPARLRYNSDQPTAITDVLVATSGSSYHTGDIPLGTPTCSA |
| Ga0308180_10374101 | 3300031100 | Soil | MVTHYPPARLRHNSSGQPIAITNVLLTTSGSSSTGEIPL |
| Ga0308187_101126631 | 3300031114 | Soil | MVIHYPPERLRHNSDRPTAITSVLVATSASSQSGEIPL |
| Ga0308187_103143183 | 3300031114 | Soil | MVLHYQPERLRHNSDQPTAITNVLVATSGSSHQTSD |
| Ga0308187_104131422 | 3300031114 | Soil | MVIHYQPERLRHNSDQPTAITNILVATSGSSCRTGDIPLGIPTCS |
| Ga0308151_10116981 | 3300031124 | Soil | MVTHYQPGRLRRNSDQPTAITNVLIATGSSHSTGDIPLGTPTCS |
| Ga0308151_10213152 | 3300031124 | Soil | MVIHYPPARLRHNSDRPTAITNVLVATSGSSHQTRDIP |
| Ga0308182_10211551 | 3300031125 | Soil | MVIHYPPARLRHNSDRPTAITNVLVATSGSSHQTRDIPLGTP |
| Ga0308177_10022323 | 3300031423 | Soil | MVTHYPPERLRYNSDQPTAITNVLVATSESSSRTGEIPLGT |
| Ga0308177_10085082 | 3300031423 | Soil | MVTHYPPARLRYNSDQPTAITDVLINRSGSSSRSGEIPLGTP |
| Ga0308179_10224771 | 3300031424 | Soil | VIHYPPARLRYNSDQPTAITNVLITASGSSHTGEIPLGTPTCS |
| Ga0308179_10361333 | 3300031424 | Soil | MVIHYEPARLRRNSDQPTAITGVLAATSASTYRTGD |
| Ga0308179_10455883 | 3300031424 | Soil | MVIHDQPARLRQNSDQPTAITNVLVATAGSSSRPGD |
| Ga0308150_10010042 | 3300031505 | Soil | MVIHYPPARFRHNSDQPTAITNVLVATSGSSYTGDIPLGTPTCSGST |
| Ga0308150_10048181 | 3300031505 | Soil | MVTHYPPERLRYNSDQPTAITNVLVATSESSSRTGEIPLGTPTCSAHS |
| Ga0307407_109302582 | 3300031903 | Rhizosphere | MVIHYPPERLRRNSDRPTAITDVLVATSGSSSRIGDIPL |
| Ga0307407_116052111 | 3300031903 | Rhizosphere | MVIHHPPARLRQNSDQPTAITDVLVATSGSSSRTGD |
| Ga0307407_116260701 | 3300031903 | Rhizosphere | MVTHYPPARLRHNSDQPTAITNVLVATSGSFSNGEIPLG |
| Ga0307416_1002737434 | 3300032002 | Rhizosphere | MVTRFPPDRLRRNSDRPTAITDVLVASSPSGYRTTDILLG |
| Ga0307416_1019226852 | 3300032002 | Rhizosphere | MVIHYPPARLRHNSDQPTAITNVLVATSGSSSRPCEIPLG |
| Ga0307414_112991971 | 3300032004 | Rhizosphere | MVIHYPPARLRHNSGRPTAITNVLVATSGSYATGEIPL |
| Ga0307414_115536441 | 3300032004 | Rhizosphere | MVIHYQPERLRYNSDQPTAITNVLVATSGSSCRTGDLPLG |
| Ga0307411_114309751 | 3300032005 | Rhizosphere | MVIHYQPERLRHNSDQPTAITNVLVATSGSSHRTRDIPLGTP |
| Ga0307415_1007940451 | 3300032126 | Rhizosphere | MVIHYPPSQLRSDSDQPAAITNVLLATSGSSYRPR |
| Ga0307415_1010588441 | 3300032126 | Rhizosphere | MVIHYPPARLRRNSDQPTAITNVLVTTSGSTRTGD |
| Ga0370540_11190_466_579 | 3300034448 | Soil | MVIHYPPARLRYASDQPTAITNVLVATSGSSHQTRDIL |
| Ga0370545_049294_2_127 | 3300034643 | Soil | MVIHFTPDRLRRNSDRPTAITDVLVAGSPSSYRTSDILLDTP |
| Ga0370548_082330_1_105 | 3300034644 | Soil | MVIHYPPARLRYNSDQPTAITDVLVATSGSSSRSG |
| Ga0370541_007246_3_125 | 3300034680 | Soil | MVIHYQPGRLRRNSDQPTAITNVVVATSPSSYRTSDIPLGT |
| Ga0370541_007325_215_322 | 3300034680 | Soil | MVIHYPPARLRRNSDQPTAITGVLLATQGSSYRTG |
| Ga0370541_018405_637_768 | 3300034680 | Soil | MVLHYQPERLRYNSDQPTAITNVLVATSGSSCRTGEIPLGTPTC |
| Ga0370541_022275_594_719 | 3300034680 | Soil | MVIHYPPERLRYNSDQPTAITDVLVATSGSSSHTGEIPLGTP |
| Ga0370541_024882_2_130 | 3300034680 | Soil | MVIHFTPDRLCRNSDRPTAITDVLVASSPATSPATYRTCDIPL |
| Ga0370541_033921_2_142 | 3300034680 | Soil | MVIHYPAQQLRHDGGRPAAITNVLVATSGSSHQTREIPLGTPTCSAR |
| Ga0370546_012870_2_130 | 3300034681 | Soil | MVIHYPPARLRHNSDQPAAITNVLVATSGSSSRTGELPLGTPT |
| Ga0370546_015040_861_968 | 3300034681 | Soil | MVTHYPPERLRYNSDQPTAITNVLVATSESSSRTGE |
| Ga0370546_034891_604_729 | 3300034681 | Soil | MVLHYPPARLRYNSDQPTAITNVLVATAGSSSRPGDIPLGIP |
| Ga0370546_077789_432_551 | 3300034681 | Soil | MVIHYPSGRLRRNSDRPTAITDVLLATSGSSYRAGDIPLG |
| Ga0370546_089313_2_121 | 3300034681 | Soil | MVIHYQPARLRRNSDQPTALTNVLLASGTGEVPLGTPTCS |
| ⦗Top⦘ |