


| Basic Information | |
|---|---|
| Family ID | F077860 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 47 residues |
| Representative Sequence | GDPVTAEFTAPAAGEYEIACSEFCGRGHGQMKAALVSISVTKTNR |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.71 % |
| % of genes near scaffold ends (potentially truncated) | 97.44 % |
| % of genes from short scaffolds (< 2000 bps) | 96.58 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.872 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (15.385 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.171 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (74.359 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.11% β-sheet: 10.96% Coil/Unstructured: 84.93% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF07681 | DoxX | 23.08 |
| PF00116 | COX2 | 15.38 |
| PF00149 | Metallophos | 5.98 |
| PF13560 | HTH_31 | 5.13 |
| PF13620 | CarboxypepD_reg | 4.27 |
| PF08281 | Sigma70_r4_2 | 2.56 |
| PF02077 | SURF4 | 1.71 |
| PF13419 | HAD_2 | 1.71 |
| PF02517 | Rce1-like | 1.71 |
| PF12704 | MacB_PCD | 1.71 |
| PF03358 | FMN_red | 1.71 |
| PF01569 | PAP2 | 0.85 |
| PF01019 | G_glu_transpept | 0.85 |
| PF05015 | HigB-like_toxin | 0.85 |
| PF01323 | DSBA | 0.85 |
| PF01833 | TIG | 0.85 |
| PF00069 | Pkinase | 0.85 |
| PF02687 | FtsX | 0.85 |
| PF12844 | HTH_19 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 24.79 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 23.08 |
| COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 15.38 |
| COG4263 | Nitrous oxide reductase | Inorganic ion transport and metabolism [P] | 15.38 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.42 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 1.71 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 1.71 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.85 |
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.87 % |
| Unclassified | root | N/A | 5.13 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559005|cont_contig76260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
| 3300002075|JGI24738J21930_10066987 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300004480|Ga0062592_100326606 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300004643|Ga0062591_100604881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae | 970 | Open in IMG/M |
| 3300004801|Ga0058860_10098246 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300005290|Ga0065712_10160556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1304 | Open in IMG/M |
| 3300005294|Ga0065705_10689555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300005334|Ga0068869_100793954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 813 | Open in IMG/M |
| 3300005345|Ga0070692_10518823 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300005367|Ga0070667_101721198 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300005435|Ga0070714_100031938 | All Organisms → cellular organisms → Bacteria | 4395 | Open in IMG/M |
| 3300005436|Ga0070713_101320601 | Not Available | 699 | Open in IMG/M |
| 3300005457|Ga0070662_100653180 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300005459|Ga0068867_101351432 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300005459|Ga0068867_102009909 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300005467|Ga0070706_100414601 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
| 3300005468|Ga0070707_101783984 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300005471|Ga0070698_101157086 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300005471|Ga0070698_101829447 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300005518|Ga0070699_100651281 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300005518|Ga0070699_102055995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300005526|Ga0073909_10646701 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300005536|Ga0070697_100531162 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300005538|Ga0070731_10260602 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300005543|Ga0070672_101740323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300005617|Ga0068859_102072662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300005713|Ga0066905_101324992 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300005840|Ga0068870_10281564 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300005842|Ga0068858_101534769 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300005843|Ga0068860_102035525 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300006163|Ga0070715_10247215 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300006358|Ga0068871_100880492 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300006844|Ga0075428_100270195 | All Organisms → cellular organisms → Bacteria | 1829 | Open in IMG/M |
| 3300006852|Ga0075433_10949607 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300006852|Ga0075433_11009111 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300006854|Ga0075425_100032804 | All Organisms → cellular organisms → Bacteria | 5771 | Open in IMG/M |
| 3300006854|Ga0075425_100530395 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
| 3300006854|Ga0075425_100762527 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300006854|Ga0075425_102203769 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300006903|Ga0075426_10698646 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300006904|Ga0075424_100467286 | All Organisms → cellular organisms → Bacteria | 1346 | Open in IMG/M |
| 3300006969|Ga0075419_10278470 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300006969|Ga0075419_11475517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300007076|Ga0075435_101562451 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300007265|Ga0099794_10722726 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300009012|Ga0066710_104897586 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300009098|Ga0105245_12593274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Caldibacillus → Caldibacillus debilis | 560 | Open in IMG/M |
| 3300009098|Ga0105245_12594185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300009101|Ga0105247_11863303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300009147|Ga0114129_12082997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
| 3300009147|Ga0114129_13429733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300009148|Ga0105243_12740147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300009156|Ga0111538_12885985 | Not Available | 601 | Open in IMG/M |
| 3300009162|Ga0075423_10528044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1242 | Open in IMG/M |
| 3300009162|Ga0075423_11782151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300009174|Ga0105241_12600535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300009176|Ga0105242_11055345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 824 | Open in IMG/M |
| 3300009551|Ga0105238_10820449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
| 3300009551|Ga0105238_11899937 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300010373|Ga0134128_10453953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1430 | Open in IMG/M |
| 3300011119|Ga0105246_10274249 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1350 | Open in IMG/M |
| 3300012096|Ga0137389_10637875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 915 | Open in IMG/M |
| 3300012189|Ga0137388_11429985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300012202|Ga0137363_11051489 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300012350|Ga0137372_11125542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300012362|Ga0137361_10509673 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300012683|Ga0137398_10726706 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300012923|Ga0137359_10478714 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300012923|Ga0137359_11658007 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300012955|Ga0164298_10932510 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300012957|Ga0164303_11254468 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300012985|Ga0164308_10893660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 782 | Open in IMG/M |
| 3300013297|Ga0157378_13025253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300013308|Ga0157375_10090041 | All Organisms → cellular organisms → Bacteria | 3126 | Open in IMG/M |
| 3300014968|Ga0157379_10207066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1775 | Open in IMG/M |
| 3300014969|Ga0157376_12734073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300015264|Ga0137403_11280296 | Not Available | 579 | Open in IMG/M |
| 3300015372|Ga0132256_101237621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
| 3300015373|Ga0132257_100631944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1325 | Open in IMG/M |
| 3300015373|Ga0132257_103921044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300015374|Ga0132255_102332300 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300015374|Ga0132255_103467853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
| 3300015374|Ga0132255_105304832 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300016445|Ga0182038_10711447 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300021178|Ga0210408_11127693 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300022504|Ga0242642_1084411 | Not Available | 539 | Open in IMG/M |
| 3300022756|Ga0222622_10369809 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300025899|Ga0207642_10629733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300025907|Ga0207645_10475535 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300025910|Ga0207684_11155815 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300025922|Ga0207646_10282089 | All Organisms → cellular organisms → Bacteria | 1501 | Open in IMG/M |
| 3300025924|Ga0207694_11231145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300025933|Ga0207706_11227295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300025940|Ga0207691_11760039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300025942|Ga0207689_10410131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1130 | Open in IMG/M |
| 3300025945|Ga0207679_10193428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1693 | Open in IMG/M |
| 3300026035|Ga0207703_10896183 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300026035|Ga0207703_10907481 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300026088|Ga0207641_11131978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
| 3300026095|Ga0207676_10850223 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300026469|Ga0257169_1070990 | Not Available | 563 | Open in IMG/M |
| 3300027821|Ga0209811_10085766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1117 | Open in IMG/M |
| 3300027842|Ga0209580_10198804 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300027880|Ga0209481_10697488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300027894|Ga0209068_10200311 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300027903|Ga0209488_11201224 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300028799|Ga0307284_10081611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1186 | Open in IMG/M |
| 3300028828|Ga0307312_10232985 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300031226|Ga0307497_10420232 | Not Available | 643 | Open in IMG/M |
| 3300031547|Ga0310887_11144726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300031740|Ga0307468_102148178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300031831|Ga0318564_10296996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 713 | Open in IMG/M |
| 3300032013|Ga0310906_10598031 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300032180|Ga0307471_104239166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300032205|Ga0307472_101780730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300032211|Ga0310896_10100696 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
| 3300034820|Ga0373959_0005274 | All Organisms → cellular organisms → Bacteria | 2116 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 15.38% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.26% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.40% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.13% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 5.13% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.27% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.27% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.42% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.71% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.85% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.85% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.85% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.85% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| cont_0260.00005060 | 2166559005 | Simulated | DNGEPVTADFTAPAAGEYEIACSEFCGRGHAQMRAALVSVSVTKTDR |
| JGI24738J21930_100669871 | 3300002075 | Corn Rhizosphere | NSGGPVTVDFTAPPEGRYEILCSELCGFGHGQMKAALVSIGPIQTSR* |
| Ga0062592_1003266061 | 3300004480 | Soil | TIEFVAPPAGQYEIACSEFCGIGHGQMKAMLVSTSTTQMSR* |
| Ga0062591_1006048811 | 3300004643 | Soil | GGDPVTVEFTAPAAGRYEIACSEFCGSGHGHMKAAFVSVGPTQTSR* |
| Ga0058860_100982461 | 3300004801 | Host-Associated | KSGDAAIVEFTAPSAGRYEIACSEFCGRGHGQMKAVLVSIGPTQTSR* |
| Ga0065712_101605563 | 3300005290 | Miscanthus Rhizosphere | FSIRDLHIDAQIPRSGNVVVEFTAPGTGRYEIACSEFCGSGHGQMKAALVSVAATPSAR* |
| Ga0065705_106895551 | 3300005294 | Switchgrass Rhizosphere | VPKGGEPVVAEFTAPPAGRYEVACSEFCGGGHGQMKTALVSVAPTTTHR* |
| Ga0068869_1007939543 | 3300005334 | Miscanthus Rhizosphere | DFTAPLAGSYDIACSEFCGTGHGHMKAALVSIGPTQTSR* |
| Ga0070692_105188231 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | IPKLKIDVPVPKSGEPVTVEFTAPAAGRYEIACSEFCGRGHGQMKAALVSGGPTQTSR* |
| Ga0070667_1017211981 | 3300005367 | Switchgrass Rhizosphere | AIVEFVAPPPGRFEVACSEFCGSGHGQMKAALVSVAPLQVNN* |
| Ga0070714_1000319381 | 3300005435 | Agricultural Soil | RVPKSGEAVTVEFTAPPAGRYQIACSEFCGRGHGQMKAELVSVGAGR* |
| Ga0070713_1013206011 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | QVPKSGEPVTVDFTAPPPGRYEIACSEFCGSGHGQMKAALVSIGPTPTSR* |
| Ga0070662_1006531801 | 3300005457 | Corn Rhizosphere | QIPPAGEGVVQFTAPPAGRYEITCSEFCGSGHGRMKAALVSVAQAQTTR* |
| Ga0068867_1013514322 | 3300005459 | Miscanthus Rhizosphere | IPKGGRPVTVEFTAPPAGRYEIECSDFCGFGHRKMKAELVSAAPIR* |
| Ga0068867_1020099091 | 3300005459 | Miscanthus Rhizosphere | GEGVVQFTAPPAGRYEITCSEFCGSGHGRMKAALVSVAQAQTTR* |
| Ga0070706_1004146011 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | PKLKIDLHIPDSGDPVTAEFTAPVAGEYDIACSEFCGRGHGQMKAALVSISVIKTDR* |
| Ga0070707_1017839841 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | IPDSGDPVTAEFTAPAAGEYEIACSEFCGHGHGQMKAALVSTSVTKTNR* |
| Ga0070698_1011570861 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | TAEFTAPAAGEYEIACSEFCGRGHGQMKAALVSISVTKTNR* |
| Ga0070698_1018294472 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VEFTAPPAGQYEIACSEFCGSGHGQMKAALISSAAVTTTR* |
| Ga0070699_1006512812 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | GDPVTAEFTAPAAGEYEIACSEFCGRGHGQMKAALVSISVTKTNR* |
| Ga0070699_1020559951 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | TVEFIAPPPGRFEIACSEFCGSGHGQMKAALISVAAVTTNR* |
| Ga0073909_106467011 | 3300005526 | Surface Soil | KGGEPVVAEFIAPPAGRYEVACSEFCGSGHGQMKTALVSVASTTTHR* |
| Ga0070697_1005311621 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | PDSGDPVTAEFTAPAAGEYEIACSEFCGRGHAQMKAALVSISVTKTNR* |
| Ga0070731_102606023 | 3300005538 | Surface Soil | APGEYEIACSEFCGRGHAQMKAALVSVGPNKTNR* |
| Ga0070672_1017403232 | 3300005543 | Miscanthus Rhizosphere | KGGEPVVAEFIAPPAGRYEVACSEFCGSGHGQMKTALVSVAPTTTHR* |
| Ga0068859_1020726621 | 3300005617 | Switchgrass Rhizosphere | LKIDVQVPKGGDPVAVEFTAPAAGRYDIACSEFCGSGHGHMKAALVSAGPTQTNR* |
| Ga0066905_1013249923 | 3300005713 | Tropical Forest Soil | QIPRSGNVVVEFTAPREGRYEIACSEFCGSGHGQMKAALVSVAATPTGAPQ* |
| Ga0068870_102815641 | 3300005840 | Miscanthus Rhizosphere | APRAGRYEIACSEFCGSGHGHMKAAVVSVAPTPTAGS* |
| Ga0068858_1015347691 | 3300005842 | Switchgrass Rhizosphere | IDLHIPDNGEPATADFTAPAAGEYEIACSEFCGRGHGQMKAALVSVSATRTNR* |
| Ga0068860_1020355251 | 3300005843 | Switchgrass Rhizosphere | AVPKSGAPVTVEFPAPAEGRYEIACSEFCGTGHGKMKAALVSSGPRQTTR* |
| Ga0070715_102472151 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | GFAVPTLKIDVQVAKSDGEPAIVEFVAPPPGRFEVACSEFCGRGHGQMKAALVSIAPL* |
| Ga0068871_1008804921 | 3300006358 | Miscanthus Rhizosphere | PAVGEYEIACSEFCGAGHARMKATLVSVAPPTRTNR* |
| Ga0075428_1002701951 | 3300006844 | Populus Rhizosphere | IPQLKIDLRIPKGGDLIVAEFIAPSAGRYEVACSEFCGIGHRQMKAALVSVAPTTTHR* |
| Ga0075433_109496071 | 3300006852 | Populus Rhizosphere | DERIPKTGDPVTVEFTAPPAGHYEIACSEFCGFGHGHMKAELISVAPVTTTR* |
| Ga0075433_110091113 | 3300006852 | Populus Rhizosphere | PAAGEYEIACSEFCGRGHGQMKAALVSTSVTTTSR* |
| Ga0075425_1000328048 | 3300006854 | Populus Rhizosphere | TAEFTAPAAGEYEIACSEFCGRGHGQMKAALVSISVTKTDR* |
| Ga0075425_1005303953 | 3300006854 | Populus Rhizosphere | PAAGEYEIACSEFCGRGHAQMKAALVSISVTKTNR* |
| Ga0075425_1007625273 | 3300006854 | Populus Rhizosphere | PAAGEYEIACSEFCGRGHAQMKAALVSVGTTKTNR* |
| Ga0075425_1022037692 | 3300006854 | Populus Rhizosphere | IDLHVPDNGEPVTTEFTAPAAGEYEIACSEFCGHGHGQMKAALLSISATRTNH* |
| Ga0075426_106986461 | 3300006903 | Populus Rhizosphere | SGDPVTAEFTAPAAGEYEIACSEFCGRGHAQMKAALVSVSVTKTNR* |
| Ga0075424_1004672864 | 3300006904 | Populus Rhizosphere | IDERIPKTGDPVTVEFTAPPAGHYEIACSEFCGFGHGHMKAELISVAPVTTTR* |
| Ga0075419_102784701 | 3300006969 | Populus Rhizosphere | KVKVNVVVPKGGQQVTAEFTAPPPGRYEIACSEFCGLGHHGMKAELVSVAPPGGPTSR* |
| Ga0075419_114755171 | 3300006969 | Populus Rhizosphere | KGGEPVVAEFTAPPAGRYEVACSEFCGSGHGQMKTALVSVAPTTTHR* |
| Ga0075435_1015624511 | 3300007076 | Populus Rhizosphere | AIPKLKIDLHVPDSGEPVTAEFTAPAAGEYEIACSEFCGRGHAQMKAAVVSVGPTKTNR* |
| Ga0099794_107227262 | 3300007265 | Vadose Zone Soil | DLHIPDSGDSVMAEFTAPAAGEYEIACSEFCGRGHGQMKAALVSISVTKTNR* |
| Ga0066710_1048975861 | 3300009012 | Grasslands Soil | KLKVDLRIPDSGEPVTAEFTAPTAGEYEIACSEFCGRGHGQMKAALVSVSFTRTDP |
| Ga0105245_125932741 | 3300009098 | Miscanthus Rhizosphere | SIPTLKIDVQVPKGGDPATVAFTAPAAGRYEIACSEFCGSGHGHMKAALVSIAPIPTNR* |
| Ga0105245_125941852 | 3300009098 | Miscanthus Rhizosphere | SIPKLKIDVRVQKSGDAAIVEFTAPPAGRYEIACSEFCGRGHGQMKAVLVSIGPTQTSR* |
| Ga0105247_118633031 | 3300009101 | Switchgrass Rhizosphere | AVGEYEIACSEFCGAGHARMKATLVSVAPPTRTNR* |
| Ga0114129_120829971 | 3300009147 | Populus Rhizosphere | GGDLIVAEFIAPSAGRYEVACSEFCGIGHRQMKAALVSVAPTTTHR* |
| Ga0114129_134297331 | 3300009147 | Populus Rhizosphere | KSGAEPTVVEFVAPPPGRLEIACSEFCGSGHGHMKAALISIDPL* |
| Ga0105243_127401472 | 3300009148 | Miscanthus Rhizosphere | RDLKIDVQIPPAGEGVVQFTAPPAGRYEITCSEFCGSGHGRMKAALVSVAPTRTER* |
| Ga0111538_128859851 | 3300009156 | Populus Rhizosphere | PVTTEFTAPAAGEYEIACSEFCGHGHGQMKAALLSISATRTNH* |
| Ga0075423_105280443 | 3300009162 | Populus Rhizosphere | KIDLQVPKGGEPVVAEFTAPPAGRYEVACSEFCGSGHGQMKTALVSVAPTTTPR* |
| Ga0075423_117821511 | 3300009162 | Populus Rhizosphere | TAPPAGRYEVACSEFCGSGHGQMKTTLVSVAPTTTTR* |
| Ga0105241_126005351 | 3300009174 | Corn Rhizosphere | SGDAAIVEFTAPPAGRYEIACSEFCGRGHGQMKAVLVSIGPTQTSR* |
| Ga0105242_110553453 | 3300009176 | Miscanthus Rhizosphere | GFSIPKLKIDVQAPTGGDPVTVEFTAPAAGRYEIACSEFCGRGHSQMKAALISVGLTQASH* |
| Ga0105238_108204491 | 3300009551 | Corn Rhizosphere | PPAGRYEITCSEFCGSGHGRMKAALVSVAQAQTTR* |
| Ga0105238_118999371 | 3300009551 | Corn Rhizosphere | TAPPAGRYEIACSEFCGRGHGQMKAVLVSIGPTQTSR* |
| Ga0134128_104539531 | 3300010373 | Terrestrial Soil | VVEFRAPRAGRYDIACSEFCGSGHGQMKAALLSTADARELR* |
| Ga0105246_102742491 | 3300011119 | Miscanthus Rhizosphere | PAIVEFVAPPPGRFEVACSEFCGSGHGQMKAVLVSVAPLQVNN* |
| Ga0137389_106378751 | 3300012096 | Vadose Zone Soil | LVEFVAPRPGRFDIACSDFCGSGHGQMKAALISIAPFVTHD* |
| Ga0137388_114299851 | 3300012189 | Vadose Zone Soil | SLKIDVQIPKSGGDPVLVEFVAPRPGRFDIACSDFCGSGHGQMKAALISIAPFVTHD* |
| Ga0137363_110514891 | 3300012202 | Vadose Zone Soil | AIPKLKIDLHIPDSGDPATAEFTAPGAGEYEIACSEFCGRGHGQMKAALISISVTKTNG* |
| Ga0137372_111255422 | 3300012350 | Vadose Zone Soil | DFIAPPAGDYEIACSEFCGRGHGQMKAALVSVSPTKTNR* |
| Ga0137361_105096733 | 3300012362 | Vadose Zone Soil | IDLHIPDSGEPVTAEFTAPAAGEYEIACSEFCGRGHGQMKAALVSISITKTNR* |
| Ga0137398_107267061 | 3300012683 | Vadose Zone Soil | THSFSIPKLKIDLRIPDSGDPVTAEFTAPAVGEYEIACSEFCGRGHGQMKAALVSVSVTRTDR* |
| Ga0137359_104787141 | 3300012923 | Vadose Zone Soil | PDTGDPVTAEFTAPAAGEYEIACSEFCGRGHGQMKAALVSISITKTNR* |
| Ga0137359_116580071 | 3300012923 | Vadose Zone Soil | KLKIDLHIADNGEPVTADFTAPAAGEYEIACSEFCGRGHAQMKAALVSISATKTNR* |
| Ga0164298_109325102 | 3300012955 | Soil | KIDLHISDSGEPVAADFTAPAAGEYEIACSEFCGRGHGQMKAALVSVSVTKTNRGRL* |
| Ga0164303_112544682 | 3300012957 | Soil | VQFTAPPAGRYEITCSEFCGSGHGRMKAALVSVAQAQTTR* |
| Ga0164308_108936603 | 3300012985 | Soil | HGSDVQIPRRGNVVVEFTAPHAGRYEIACSELCGSGHKQMKAAIVSVAATPMAN* |
| Ga0157378_130252532 | 3300013297 | Miscanthus Rhizosphere | AFVAPAVGEYEIACSEFCGAGHARMKATLVSVAPPTRTNR* |
| Ga0157375_100900416 | 3300013308 | Miscanthus Rhizosphere | AIVEFVAPPPGRFEVACSEFCGSGHGQMKAALVSVAPLQANN* |
| Ga0157379_102070663 | 3300014968 | Switchgrass Rhizosphere | VAVAFTAPAAGRYEIACSEFCGSGHGHMKAALVSVGPTETSR* |
| Ga0157376_127340731 | 3300014969 | Miscanthus Rhizosphere | IDVQVPKSGDPVVVEFVAPPPGRFEITCSEFCGIGHGRMKAALVSDVPVQTNH* |
| Ga0137403_112802962 | 3300015264 | Vadose Zone Soil | LRIPDTGDPVTAEFTAPAAGEYEIACSEFCGRGHGQMKAALVSISVIKTDR* |
| Ga0132256_1012376211 | 3300015372 | Arabidopsis Rhizosphere | EPVTVDFTAPPAGRYEIACSEFCGSGHGQMKAALISSAAVTTTR* |
| Ga0132257_1006319442 | 3300015373 | Arabidopsis Rhizosphere | LQVPKGGEPVVAEFTAPPAGRYEVSCSEFCGSGHGQMKTALVSVAPTTTHR* |
| Ga0132257_1039210441 | 3300015373 | Arabidopsis Rhizosphere | VEFTAPPAGRYEIACSEFCGSGHGQMKAALISVVAVTTTR* |
| Ga0132255_1023323002 | 3300015374 | Arabidopsis Rhizosphere | IDVRVQKSGDAAIVEFTAPPAGRYEIACSEFCGRGHGQMKAVLVSIGPTQTSR* |
| Ga0132255_1034678532 | 3300015374 | Arabidopsis Rhizosphere | IDVRVPKTGEPVTVDFTAPPAGRYEIACSEFCGSGHGQMKAALISSAAVTTTR* |
| Ga0132255_1053048321 | 3300015374 | Arabidopsis Rhizosphere | GFAIPKLKIDLHVPDNGEPVTTEFTAPAAGEYEIACSEFCGHGHGQMKAALLSISATRTNH* |
| Ga0182038_107114471 | 3300016445 | Soil | TVAFVAPAAGEYEIACSEFCGAGHARMKATLVSAAPPTRTNR |
| Ga0210408_111276931 | 3300021178 | Soil | SGEPATAEFVAPAAGEYEIACSEFCGRGHGQMKAALVTVSAVRTGH |
| Ga0242642_10844111 | 3300022504 | Soil | DSGDPVTAEFTAPSAGEYEIACSEFCGRGHGQMKAALVSTSVTRTNR |
| Ga0222622_103698091 | 3300022756 | Groundwater Sediment | KGGDPVAVEFTAPAAGRYEIACSEFCGSGHGHMKAALVSVGPTQTNR |
| Ga0207642_106297332 | 3300025899 | Miscanthus Rhizosphere | PALKIDVQVPKSDGDPAVVEFVAPPPGRFEVACSEFCGSGHGQMKAAVVSVAPL |
| Ga0207645_104755353 | 3300025907 | Miscanthus Rhizosphere | VEFTAPPAGRYEIACSEFCGRGHGQMKAVLVSIGPTQTSR |
| Ga0207684_111558152 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | AISPAVGEYEIACSEFCGHGHGQMKAALVSISVTKTNR |
| Ga0207646_102820893 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | PVTAEFTAPAAGEYEIACSEFCGRGHAQMKAALVSISVTKTNR |
| Ga0207694_112311451 | 3300025924 | Corn Rhizosphere | VPALKIDVQVPKSDGDPAVVEFVAPPPGRFEVACSEFCGSGHGQMKAAVVSVAPL |
| Ga0207706_112272951 | 3300025933 | Corn Rhizosphere | QIPPAGEGVVQFTAPPAGRYEITCSEFCGSGHGRMKAALVSVAQAQTTR |
| Ga0207691_117600392 | 3300025940 | Miscanthus Rhizosphere | TAPAAGRYDIACSEFCGSGHGHMKAALVSAGPTQTNR |
| Ga0207689_104101313 | 3300025942 | Miscanthus Rhizosphere | MARVLILGQDPDTVDFTAPLAGSYDIACSEFCGTGHGHMKAALVSIGPTQTSR |
| Ga0207679_101934281 | 3300025945 | Corn Rhizosphere | AGEGVVQFTAPPAGRYEITCSEFCGSGHGRMKAALVSVAQAQTTR |
| Ga0207703_108961831 | 3300026035 | Switchgrass Rhizosphere | PDGGDPVTADFTAPAAGEYEITCSEFCGRGHGQMKAVLISVAATSTNR |
| Ga0207703_109074812 | 3300026035 | Switchgrass Rhizosphere | IDLHIPDNGEPATADFTAPAAGEYEIACSEFCGRGHGQMKAALVSVSATRTNR |
| Ga0207641_111319781 | 3300026088 | Switchgrass Rhizosphere | VTVEFTAPTAGRYEIACSEFCGSGHGQMKAAVVSVGPTHTSRQHKRGDS |
| Ga0207676_108502231 | 3300026095 | Switchgrass Rhizosphere | FTAPAAGEYEITCSEFCGRGHGQMKAVLVSVAANRTNR |
| Ga0257169_10709901 | 3300026469 | Soil | EFTAPAAGEYEIACSEFCGHGHGQMKAALVSISVTKTNR |
| Ga0209811_100857662 | 3300027821 | Surface Soil | KIDLQVPKGGEPVVAEFIAPPAGRYEVACSEFCGSGHGQMKTALVSVASTTTHR |
| Ga0209580_101988043 | 3300027842 | Surface Soil | HIPDNGDPVTAEFTAPSAGEYEIACSEFCGRGHGQMKAALVSTSVTRTSR |
| Ga0209481_106974882 | 3300027880 | Populus Rhizosphere | LKIDLHVPKGGEPVVAEFTAPPAGRYEVACSEFCGSGHGQMKTALVSVAPTTTHR |
| Ga0209068_102003111 | 3300027894 | Watersheds | VTVEFTAPAVGRYEIACSEFCGSGHGQMKAALVSVSPTQTSR |
| Ga0209488_112012241 | 3300027903 | Vadose Zone Soil | PDNGEPVTADFTAPAAGEYEIACSEFCGRGHAQMKAALVSISATRTNR |
| Ga0307284_100816111 | 3300028799 | Soil | VMVEFTAPAAGRYEIACSEFCGSGHGQMKAALVSVGPTQTSR |
| Ga0307312_102329852 | 3300028828 | Soil | VEFTAPAAGRYEIACSEFCGSGHGHMKAALVSVGPTQTNR |
| Ga0307497_104202321 | 3300031226 | Soil | PAAGEYEIACSEFCGRGHGQMKAALVSTSATRTNR |
| Ga0310887_111447261 | 3300031547 | Soil | GGEPVVAEFTAPPAGRYEVSCSEFCGSGHGQMKTALVSVAPTTTPR |
| Ga0307468_1021481782 | 3300031740 | Hardwood Forest Soil | FTAPAAGRYDIACSEFCGSGHGHMKAALVSAGPTQTNR |
| Ga0318564_102969961 | 3300031831 | Soil | PKGGETVTVAFVAPAAGEYEIACSEFCGAGHARMKATLVSAAPPTRTNR |
| Ga0310906_105980311 | 3300032013 | Soil | VPKLKIDRHVPAGGEPVTIELTAPSPGRFEIVCSEFCGRGHEVMRAAIVSRSTQSSR |
| Ga0307471_1042391661 | 3300032180 | Hardwood Forest Soil | IPDSGDPVTAEFTAPAAGEYEIACSEFCGRGHAQMKAALVSISVTKTNR |
| Ga0307472_1017807302 | 3300032205 | Hardwood Forest Soil | TAPPAGRFEIACSEFCGIGHNRMKAELVSVGPTLTSR |
| Ga0310896_101006963 | 3300032211 | Soil | KLKIDRHVPAGGGPVTIELTAPAPGRFEIVCSEFCGRGHEVMRAAIVSRSTQSSR |
| Ga0373959_0005274_3_128 | 3300034820 | Rhizosphere Soil | TADFTAPAAGEYEIACSEFCGRGHAQMKAALVSISATRTDR |
| ⦗Top⦘ |