


| Basic Information | |
|---|---|
| Family ID | F077833 |
| Family Type | Metagenome |
| Number of Sequences | 117 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MNNEPLEREPIDRVRARLEALLKANAAPRCGARSKRTGKPCRGA |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 88.79 % |
| % of genes near scaffold ends (potentially truncated) | 94.02 % |
| % of genes from short scaffolds (< 2000 bps) | 92.31 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.342 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.094 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.624 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.991 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.44% β-sheet: 2.78% Coil/Unstructured: 77.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 5.98 |
| PF00239 | Resolvase | 2.56 |
| PF03401 | TctC | 0.85 |
| PF00072 | Response_reg | 0.85 |
| PF13676 | TIR_2 | 0.85 |
| PF12697 | Abhydrolase_6 | 0.85 |
| PF07452 | CHRD | 0.85 |
| PF07045 | DUF1330 | 0.85 |
| PF01068 | DNA_ligase_A_M | 0.85 |
| PF13643 | DUF4145 | 0.85 |
| PF02666 | PS_Dcarbxylase | 0.85 |
| PF04519 | Bactofilin | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 5.98 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 2.56 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 2.56 |
| COG0688 | Phosphatidylserine decarboxylase | Lipid transport and metabolism [I] | 0.85 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.85 |
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 0.85 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.85 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.85 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.34 % |
| Unclassified | root | N/A | 19.66 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459018|G1P06HT01EE6CG | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300000891|JGI10214J12806_10716565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300005163|Ga0066823_10138920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 530 | Open in IMG/M |
| 3300005184|Ga0066671_10141327 | Not Available | 1391 | Open in IMG/M |
| 3300005332|Ga0066388_105801017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 624 | Open in IMG/M |
| 3300005332|Ga0066388_106927851 | Not Available | 570 | Open in IMG/M |
| 3300005435|Ga0070714_102514823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 500 | Open in IMG/M |
| 3300005436|Ga0070713_101212251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 731 | Open in IMG/M |
| 3300005437|Ga0070710_10426123 | Not Available | 894 | Open in IMG/M |
| 3300005439|Ga0070711_100091837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2190 | Open in IMG/M |
| 3300005439|Ga0070711_100322417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1235 | Open in IMG/M |
| 3300005444|Ga0070694_101205080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 634 | Open in IMG/M |
| 3300005447|Ga0066689_10371225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 893 | Open in IMG/M |
| 3300005467|Ga0070706_101589983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 596 | Open in IMG/M |
| 3300005549|Ga0070704_101408783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 639 | Open in IMG/M |
| 3300005559|Ga0066700_10389195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 983 | Open in IMG/M |
| 3300005614|Ga0068856_101109977 | Not Available | 808 | Open in IMG/M |
| 3300005764|Ga0066903_100392826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2276 | Open in IMG/M |
| 3300005764|Ga0066903_100491597 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2074 | Open in IMG/M |
| 3300005764|Ga0066903_104376688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 754 | Open in IMG/M |
| 3300005764|Ga0066903_105949517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 639 | Open in IMG/M |
| 3300005764|Ga0066903_106653320 | Not Available | 601 | Open in IMG/M |
| 3300005764|Ga0066903_107254516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 573 | Open in IMG/M |
| 3300005764|Ga0066903_107923274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 545 | Open in IMG/M |
| 3300005764|Ga0066903_108887165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300006028|Ga0070717_10541880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1053 | Open in IMG/M |
| 3300006163|Ga0070715_10684734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 611 | Open in IMG/M |
| 3300006175|Ga0070712_100386171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1154 | Open in IMG/M |
| 3300006175|Ga0070712_100688752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 870 | Open in IMG/M |
| 3300006845|Ga0075421_100958864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 971 | Open in IMG/M |
| 3300006852|Ga0075433_10267995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1514 | Open in IMG/M |
| 3300006854|Ga0075425_102381840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 587 | Open in IMG/M |
| 3300006871|Ga0075434_100795970 | Not Available | 962 | Open in IMG/M |
| 3300009143|Ga0099792_10520506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 747 | Open in IMG/M |
| 3300009147|Ga0114129_10851487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1159 | Open in IMG/M |
| 3300009147|Ga0114129_11033909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1032 | Open in IMG/M |
| 3300009156|Ga0111538_12401241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 662 | Open in IMG/M |
| 3300009553|Ga0105249_13184293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300010043|Ga0126380_10545329 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300010043|Ga0126380_10764176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 786 | Open in IMG/M |
| 3300010043|Ga0126380_11713674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 565 | Open in IMG/M |
| 3300010046|Ga0126384_10663912 | Not Available | 920 | Open in IMG/M |
| 3300010047|Ga0126382_10114186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1776 | Open in IMG/M |
| 3300010047|Ga0126382_12458565 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300010048|Ga0126373_12645636 | Not Available | 560 | Open in IMG/M |
| 3300010362|Ga0126377_12750969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 567 | Open in IMG/M |
| 3300010364|Ga0134066_10081947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 901 | Open in IMG/M |
| 3300010376|Ga0126381_100737676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1411 | Open in IMG/M |
| 3300010376|Ga0126381_102748690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 703 | Open in IMG/M |
| 3300010376|Ga0126381_103823242 | Not Available | 588 | Open in IMG/M |
| 3300010376|Ga0126381_105114535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300010398|Ga0126383_11054862 | Not Available | 902 | Open in IMG/M |
| 3300010398|Ga0126383_11189919 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300010398|Ga0126383_12167347 | Not Available | 642 | Open in IMG/M |
| 3300012202|Ga0137363_10358061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1209 | Open in IMG/M |
| 3300012204|Ga0137374_11250847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300012206|Ga0137380_11389747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 587 | Open in IMG/M |
| 3300012349|Ga0137387_11191969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 538 | Open in IMG/M |
| 3300012350|Ga0137372_10566833 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300012355|Ga0137369_10637840 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300012582|Ga0137358_10287161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1118 | Open in IMG/M |
| 3300012897|Ga0157285_10277997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300012948|Ga0126375_10811890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 742 | Open in IMG/M |
| 3300015371|Ga0132258_10712996 | All Organisms → cellular organisms → Bacteria | 2526 | Open in IMG/M |
| 3300015374|Ga0132255_103359954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 682 | Open in IMG/M |
| 3300016270|Ga0182036_10605948 | Not Available | 879 | Open in IMG/M |
| 3300016341|Ga0182035_10153683 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1771 | Open in IMG/M |
| 3300016341|Ga0182035_10389663 | Not Available | 1168 | Open in IMG/M |
| 3300016371|Ga0182034_10132587 | Not Available | 1844 | Open in IMG/M |
| 3300016387|Ga0182040_10252681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1325 | Open in IMG/M |
| 3300016387|Ga0182040_11110622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 663 | Open in IMG/M |
| 3300016404|Ga0182037_10077448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2323 | Open in IMG/M |
| 3300016422|Ga0182039_10907272 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300019890|Ga0193728_1099122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1349 | Open in IMG/M |
| 3300021168|Ga0210406_11051112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 603 | Open in IMG/M |
| 3300021178|Ga0210408_10540910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 925 | Open in IMG/M |
| 3300021479|Ga0210410_11259654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 632 | Open in IMG/M |
| 3300021560|Ga0126371_12907769 | Not Available | 580 | Open in IMG/M |
| 3300025915|Ga0207693_10193191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1602 | Open in IMG/M |
| 3300025915|Ga0207693_10481988 | Not Available | 969 | Open in IMG/M |
| 3300026023|Ga0207677_11552739 | Not Available | 612 | Open in IMG/M |
| 3300026532|Ga0209160_1198779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 770 | Open in IMG/M |
| 3300027071|Ga0209214_1024176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 789 | Open in IMG/M |
| 3300027646|Ga0209466_1031245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1092 | Open in IMG/M |
| 3300027654|Ga0209799_1055621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 886 | Open in IMG/M |
| 3300027654|Ga0209799_1089712 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 696 | Open in IMG/M |
| 3300027874|Ga0209465_10348155 | Not Available | 742 | Open in IMG/M |
| 3300028744|Ga0307318_10116026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 911 | Open in IMG/M |
| 3300028811|Ga0307292_10390843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 590 | Open in IMG/M |
| 3300028878|Ga0307278_10361240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300028881|Ga0307277_10387279 | Not Available | 624 | Open in IMG/M |
| 3300031572|Ga0318515_10270703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 911 | Open in IMG/M |
| 3300031681|Ga0318572_10597992 | Not Available | 657 | Open in IMG/M |
| 3300031719|Ga0306917_11495889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300031744|Ga0306918_11494845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300031753|Ga0307477_10853072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 603 | Open in IMG/M |
| 3300031764|Ga0318535_10384565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 627 | Open in IMG/M |
| 3300031770|Ga0318521_10335974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 893 | Open in IMG/M |
| 3300031793|Ga0318548_10133429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum | 1205 | Open in IMG/M |
| 3300031797|Ga0318550_10117136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1265 | Open in IMG/M |
| 3300031819|Ga0318568_10276339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1042 | Open in IMG/M |
| 3300031845|Ga0318511_10221169 | Not Available | 845 | Open in IMG/M |
| 3300031890|Ga0306925_10157584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2444 | Open in IMG/M |
| 3300031942|Ga0310916_10090404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2440 | Open in IMG/M |
| 3300031942|Ga0310916_10222495 | All Organisms → cellular organisms → Bacteria | 1584 | Open in IMG/M |
| 3300031942|Ga0310916_11507460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300031945|Ga0310913_10332383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum | 1074 | Open in IMG/M |
| 3300031946|Ga0310910_11413002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300032001|Ga0306922_11913022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300032025|Ga0318507_10410320 | Not Available | 590 | Open in IMG/M |
| 3300032025|Ga0318507_10419036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 583 | Open in IMG/M |
| 3300032059|Ga0318533_10064245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2474 | Open in IMG/M |
| 3300032094|Ga0318540_10567462 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300032174|Ga0307470_11004405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 664 | Open in IMG/M |
| 3300032174|Ga0307470_11529510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300032261|Ga0306920_101041613 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.09% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 14.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 11.97% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.11% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.84% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.27% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.56% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459018 | Litter degradation MG2 | Engineered | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2MG_01549680 | 2170459018 | Switchgrass, Maize And Mischanthus Litter | MNNEPLEREPIDRMRARLEALLKATAAPRCGARSKRRQALPGAAMPNGRCKLHGAXARGRATP |
| JGI10214J12806_107165652 | 3300000891 | Soil | MNNEPLEREPIDRVRARLEALLKANAAPRCGARSKRTGKPCQ |
| Ga0066823_101389201 | 3300005163 | Soil | MNNEPLEREPIDRVRARLEALLKANAAPRCGARSKRTGKPC |
| Ga0066671_101413273 | 3300005184 | Soil | MSDKPLAREREAIERVRAHLEALVTANAAPRCGARSKRTGKPCLSSDQAGHGC* |
| Ga0066388_1058010172 | 3300005332 | Tropical Forest Soil | MSDEALVREREPIERVRARLEALVRANAAPRCGARSKRTGKPCR |
| Ga0066388_1069278512 | 3300005332 | Tropical Forest Soil | MSDKPLAREREPIERVRARLEALVRANAAPRCGARSKRTGKPCR |
| Ga0070714_1025148231 | 3300005435 | Agricultural Soil | SDEPLVREREPIERVRARLEALVMANAAPRCGARSKRTGKPCRAAAMPNGRSKLLNGR* |
| Ga0070713_1012122512 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MVEKMTNEPLEREQTERLRAARLEALIKANAAPRCGARSKRTGLACRAAAMPNGWMRI* |
| Ga0070710_104261231 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MNNEPLEREPIDRMRARLEALLKANAAPRCGARSKRAGKPCRGA |
| Ga0070711_1000918376 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MNGEPLACEREPIERVRARLEALVMANAAPRCGARSKRTGKPCRAAAMPNGRSKLLNGR* |
| Ga0070711_1003224172 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MVEKMTNEPLEREQTEPLRAARLEALIKANAAPRCGARSKRTGLACRAAAMPNGWMRI* |
| Ga0070694_1012050802 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MNNEPLEREPIDRVRARLEALLKANAAPRCGARSKRTGKPCRGA |
| Ga0066689_103712252 | 3300005447 | Soil | MNNKPLEREPIDRVRARLEALLKANAAPRCGARSKRTGKPCR |
| Ga0070706_1015899832 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNEPFEREPMNNEPLERDPIDRVRARLEALLKANAAPRCGARSKRTGKPCQGAAMPNG |
| Ga0070704_1014087831 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MNNEPLEREPIDRMRARLEALLKANAAPRCGARSKRTGKPC |
| Ga0066700_103891953 | 3300005559 | Soil | MNNKPLEREPIDRVRARLEALLKANAAPRCGARSKRTGKPCRGAAMP |
| Ga0068856_1011099772 | 3300005614 | Corn Rhizosphere | MSDEPLARERDQIDRVRARLEALVRANAARRCGARSKRTG |
| Ga0066903_1003928265 | 3300005764 | Tropical Forest Soil | MRMNNEPLEREPIDRVRARLEALLKANAAPRCGARSKRTGKPCQGAAMPNGRCK |
| Ga0066903_1004915975 | 3300005764 | Tropical Forest Soil | MSDEPLVREREPIERVRARLEALIMANAAPRCGARSKRTGKPCQAAGRRLSGKETKEKKVS* |
| Ga0066903_1043766881 | 3300005764 | Tropical Forest Soil | MSDEPVVREREPIERVRARLEALVRANAAPRCGARSKRTGKPCR |
| Ga0066903_1059495171 | 3300005764 | Tropical Forest Soil | MSDEPVVREPEPIERVRARLEALVRANAAPRCGARSKRTGKPCRGAAMP |
| Ga0066903_1066533202 | 3300005764 | Tropical Forest Soil | MSNEPLEREPIDRMRARLEALLKANAAPRCGARSKRTGK |
| Ga0066903_1072545161 | 3300005764 | Tropical Forest Soil | MSRKMSNGSLAGKREPIERVRARLEALVRANAAPRCGARSKRTGKPCRAAAMPNGRCK |
| Ga0066903_1079232742 | 3300005764 | Tropical Forest Soil | MSNEPIVGEREPTERVRARLEALVMANAAPRCGARSKRTGKPCRAAAMPNG |
| Ga0066903_1088871652 | 3300005764 | Tropical Forest Soil | MNNGPLERESIDRVQARLEALLKANAAPRCGARSKRTGKPCRGAAMPNGRCK |
| Ga0070717_105418802 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MNNKPLEREPMNNEPFEREPIDRMRARLEALLKANAAPRCGARSKRTGKPCRGAAMPNGR |
| Ga0070715_106847341 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDANDEPLEPEPIDRMRARLEALLKANAAPRCGARSKRTGKPC |
| Ga0070712_1003861712 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MNNDPLEREPIDRVQARSEALLKANAAPRCGARSKRTGKPCRGAAMPNGRCK |
| Ga0070712_1006887522 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDEPLGREREPIERVRARLEALVMANAAPRCGARSKRTGKPCRAAAMPNGRSKLLNGR* |
| Ga0075421_1009588642 | 3300006845 | Populus Rhizosphere | MNNEPLEREPIDRVRARLEALLKANAAPRCGARSKRTGKPCRGAAMPNGR |
| Ga0075433_102679951 | 3300006852 | Populus Rhizosphere | MSDEPLAREREPIERVRARLEALVRANAAPRCGARSKRTGKPCRAAAMPN |
| Ga0075425_1023818401 | 3300006854 | Populus Rhizosphere | MNNKPLEREPIDRARARLEALLKANAAPRCGARSKRTGKPCQGAAMPN |
| Ga0075434_1007959701 | 3300006871 | Populus Rhizosphere | MNNEPLEREPIDRMRARLEALLKANAAPRCGARSKRTGK |
| Ga0099792_105205062 | 3300009143 | Vadose Zone Soil | MNNEPLEREPIDRVRARLEALLKANAAPRCGARSKRTGKPCQG |
| Ga0114129_108514872 | 3300009147 | Populus Rhizosphere | MSNEPLEREPIDRMRARLEALLKANAAPRCGARSKRTGKPCQGAAMPNG |
| Ga0114129_110339091 | 3300009147 | Populus Rhizosphere | MNNEPHEREPMNNEPLEREPIDRVRARLEALLKANAAPRCGARSKRTGKSCQGAAMPNGRCKLH |
| Ga0111538_124012412 | 3300009156 | Populus Rhizosphere | MNNEPLEREPIDRMRARLEALLKANAAPRCGARSKRTGKPCQGA |
| Ga0105249_131842932 | 3300009553 | Switchgrass Rhizosphere | MNNEPLEREPIDRVRARVEALLKANAAPRCGARSKRTG |
| Ga0126380_105453292 | 3300010043 | Tropical Forest Soil | MFGGIFAPQRQAGGWSKMSDEPLAREGERMRARLEALVMANAAPRCGARSKRTGKPCQAAAMPNGRC |
| Ga0126380_107641761 | 3300010043 | Tropical Forest Soil | MNNEPLEREPIDRVRARLEALLKANAAPRCGARSKRTGKPCRG |
| Ga0126380_117136741 | 3300010043 | Tropical Forest Soil | MSDEPLAREREPIERVRTRLEALIRANAAPRCGARSKRTGKPCRAAAM |
| Ga0126384_106639123 | 3300010046 | Tropical Forest Soil | MNDEPLEREPEPIDRVRARLEALLKANAAPRCGARSKRTG |
| Ga0126382_101141863 | 3300010047 | Tropical Forest Soil | MNNEPLEREPMNNEPLEGEPIDRVRARLEALLKANAAPRCGARSKRTGKPCRG |
| Ga0126382_124585652 | 3300010047 | Tropical Forest Soil | MSDKPLAREREPIERVRARIEALVRANAAPRCGAR |
| Ga0126373_126456361 | 3300010048 | Tropical Forest Soil | MNNEPLEREPIDRMRARLEALLKANAAPRCGARSKRTGKP |
| Ga0126377_127509692 | 3300010362 | Tropical Forest Soil | MSDEPLAREREPIERVRARLEALVMANAAPRCGARSKRTGKPCRGAAMPN |
| Ga0134066_100819471 | 3300010364 | Grasslands Soil | MNDEPPEREPMNNEPEREPTDRARARVEALLKANAAPRCGARSKRTGKPCRGAAMP |
| Ga0126381_1007376761 | 3300010376 | Tropical Forest Soil | MSDEPVAREHEPIERVRARLEALVRANAAPRCGARSKRTGKPCRGAA |
| Ga0126381_1027486902 | 3300010376 | Tropical Forest Soil | MNNEPLEREPIDRMWARLEALLKANVAPRCGARSK |
| Ga0126381_1038232421 | 3300010376 | Tropical Forest Soil | MSNEPVEREPIWRVQARLDALAKANAAPRCGARSKR |
| Ga0126381_1051145351 | 3300010376 | Tropical Forest Soil | MSDEPLAREREPIERVRARLEALIMANAAPRCGARSKRTGKPCRA |
| Ga0126383_110548621 | 3300010398 | Tropical Forest Soil | MSDEPLVREREPIERVRARLEALIMANAAPRCGARSKRTGKPCQAA |
| Ga0126383_111899191 | 3300010398 | Tropical Forest Soil | MSDKPLAREREPIERVRARLEALIMANAAPRCGARSKRTGKPCRAAAMPNGRC |
| Ga0126383_121673471 | 3300010398 | Tropical Forest Soil | MSDEPLAREGEPIERVRARLEALAMANAAPRCGARS |
| Ga0137363_103580611 | 3300012202 | Vadose Zone Soil | MNNEPLEREPMNNEPLEREPIDRVRARLEALLKANAAPRCGARSKRTGKPCQG |
| Ga0137374_112508471 | 3300012204 | Vadose Zone Soil | MSNEPLEREPIDGVRARLEALLKANAAPRCGARSKRTGKPCQGAAMPN |
| Ga0137380_113897471 | 3300012206 | Vadose Zone Soil | MNNKPLEREPIDRVRARLEALLKANAAPRCGARSKRTGKP |
| Ga0137387_111919691 | 3300012349 | Vadose Zone Soil | MNNEPLVREPIDRMRARWEALLKANAAPRCGARSKRTGKPCQ |
| Ga0137372_105668333 | 3300012350 | Vadose Zone Soil | MSNEALAREMLIDRVQARLEALRKANATPRCGARSKRTG |
| Ga0137369_106378402 | 3300012355 | Vadose Zone Soil | MSNEPLEREPIDRMRARLEALLKASAAPRCGARCK |
| Ga0137358_102871611 | 3300012582 | Vadose Zone Soil | MNNKPLEREPIDRVRARLEALLKANAAPRCGARSKRTGKPCRGAAM |
| Ga0157285_102779972 | 3300012897 | Soil | MNNKPLEREPIDRVRARLEALLKANAAPRCGARSKRTGKPC |
| Ga0126375_108118902 | 3300012948 | Tropical Forest Soil | MNDEPLDREPMNNGPLERESIDRVQARLEALLKANAAPRCGARSKRTGKPCRGAAMPNGR |
| Ga0132258_107129961 | 3300015371 | Arabidopsis Rhizosphere | MKRKPIERVRARLEALVMANGAPRCGARSKRTGKPCRAAAMP |
| Ga0132255_1033599542 | 3300015374 | Arabidopsis Rhizosphere | MSDEPLAREREPIERVRARLEALVMANGAPRCGARSK |
| Ga0182036_106059484 | 3300016270 | Soil | VTHKMNNEPLEREPVSNEPLEHEPIDRMRARLEALLKANAAPRCGARSKRTGKPCQGAAM |
| Ga0182035_101536833 | 3300016341 | Soil | MSDEPLAREREPIERVRARLEALVMANAAPRCGARSKRTGKPCRAAAM |
| Ga0182035_103896631 | 3300016341 | Soil | MNNEPLEREPIDRVRTRLEALLKANAPIDRVRARLEALLKANAAPRCGARSKRTGKPCQGAAMPNGR |
| Ga0182034_101325871 | 3300016371 | Soil | MNNEPLEREPVSNEPLEHEPIDRMRARLEALLKANAAPRCGARSKRTGKPCQGAAMPN |
| Ga0182040_102526811 | 3300016387 | Soil | MNNEPLEREPMNNEPLERELIDRMRARLEALLKANAAPRCGARSKRTGKPCQGAAMPNG |
| Ga0182040_111106222 | 3300016387 | Soil | MSDKPLAREREPIERVRARLEALIMANAAPRCGARSKRTG |
| Ga0182037_100774484 | 3300016404 | Soil | MNNKPLEREPIDRVRARLEALLKANAAPRCGARSKR |
| Ga0182039_109072723 | 3300016422 | Soil | MNNEPLEREPVSNEPLEHEPIDRMRARLEALLKANAAPRCGARSKRTGKPCQGAAMPNGR |
| Ga0193728_10991221 | 3300019890 | Soil | MSDEPLAREREPIERVRARPEALVMANAAPRCGARSKRTGKP |
| Ga0210406_110511121 | 3300021168 | Soil | MNNEPLEREPIDRVRARLEALLKANAAPRCGARSKRTGKPCRGAAMPN |
| Ga0210408_105409102 | 3300021178 | Soil | MSDEPLAREREPIERVRARLEALVMANAAPRCGARSKRTGKPCR |
| Ga0210410_112596541 | 3300021479 | Soil | MSDEPLAREREPIERVRARLEALVMANAAPRCGARSK |
| Ga0126371_129077691 | 3300021560 | Tropical Forest Soil | MSDKPLAREPLDRVRARLEALLKANAAPRCGARSKRTGKPCQGAAMPNG |
| Ga0207693_101931912 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MNNDPLEREPIDRVQARSEALLKANAAPRCGARSKRTG |
| Ga0207693_104819881 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDEPLVREREPIERVRARLEALVRANATPRCGARSKRTGKPCQGAAMPNG |
| Ga0207677_115527392 | 3300026023 | Miscanthus Rhizosphere | MNNEPLEREPIDRVRARLEALLKANAAPRCGARSKR |
| Ga0209160_11987792 | 3300026532 | Soil | MNNKPLEREPIDRVRARLEALLKANAAPRCGARSKRTGKPCRGAAMPN |
| Ga0209214_10241761 | 3300027071 | Forest Soil | MNNEPLEREPIDRVRARLEALLKANAAPRCGARSKRTGKPCQGAAMPN |
| Ga0209466_10312451 | 3300027646 | Tropical Forest Soil | MSDEPLAREREPIERVRARLEALVMANAAPRCGARS |
| Ga0209799_10556212 | 3300027654 | Tropical Forest Soil | MNNEPLEREPIDRVRARLEALLKANAAPRCGARSKRTGKP |
| Ga0209799_10897123 | 3300027654 | Tropical Forest Soil | MNNEPLEREPMNNEPLEGEPIDRVRARLEALLKANAAPRCGARSKRTGKP |
| Ga0209465_103481552 | 3300027874 | Tropical Forest Soil | MSDEPLAREREAREREPIERVRARLEALIMANAAPRCGARSKRTGKPCQAA |
| Ga0307318_101160262 | 3300028744 | Soil | MSDEPLAREREPMERVRVRLEALVMANAAPLAGTICRL |
| Ga0307292_103908431 | 3300028811 | Soil | MSDEPLVREREPIERVRARLEALVMANAAPRCGARSKRT |
| Ga0307278_103612401 | 3300028878 | Soil | MNNEPLEREPIDRMRARLEALLKANAAPRCGARSKRTGKPCQGAAMPNG |
| Ga0307277_103872792 | 3300028881 | Soil | LAASFEPLAREREPIERVRARLEALVRANAAPRCGARSKRT |
| Ga0318515_102707031 | 3300031572 | Soil | MNNEPLEREPMNNEPLERELIDRMRARLEALLKANAAPRCGARSKRTGKPCQGAAMPNGR |
| Ga0318572_105979921 | 3300031681 | Soil | MNNEPLEREPIDRVRARLEALLKANAAPRCGARSKRTGKPCQGAAMPNGAAH |
| Ga0306917_114958891 | 3300031719 | Soil | MSDEPLAREREAREREPIERVRARLEALVRANAAPRCGARSKRTGKPC |
| Ga0306918_100748135 | 3300031744 | Soil | MNNEPLEREPVSNEPLEHEPIDRMRARLEALLKANAAPRCGARSKRTGKP |
| Ga0306918_114948452 | 3300031744 | Soil | MNNEPLEREPIDRVRARLEALLKANAAPRCGARSK |
| Ga0307477_108530721 | 3300031753 | Hardwood Forest Soil | MNNEPLEREPIDRVRARLEALLKANAAPRCGARSKRTGKPCQGAA |
| Ga0318535_103845651 | 3300031764 | Soil | MSDELLAREREPIERLRALALVRANAAPRCGARSK |
| Ga0318521_103359742 | 3300031770 | Soil | MNNEPLEREPMNNEPLEREPIDGVRARLEALLKANAAPRCGARSKRTGKPCRGAAMP |
| Ga0318548_101334294 | 3300031793 | Soil | VTHKMNNEPLEREPVSNEPLEHEPIDRMRARLEALLKANAAPRCGARSKRTGKPFQGAA |
| Ga0318550_101171361 | 3300031797 | Soil | MNNKPLEREPIDRVRARLEALLKANAAPRCGARSKRTGKPCRGAA |
| Ga0318568_102763391 | 3300031819 | Soil | MNNEPLEREPIDRVRTRLEALLKANAAPRCGARSKRTGKPCQGAAMPN |
| Ga0318511_102211691 | 3300031845 | Soil | MSNEALEREPIDRMRARLEVLLEANAAPRCGARSKRTGKPCRGAAMPN |
| Ga0306925_101575841 | 3300031890 | Soil | MNNEPLEREPIDRVRARLEALLKANAAPRCGARSKRTGK |
| Ga0310916_100904044 | 3300031942 | Soil | MNNKPLEREPIDRVRARLEALLKANAAPRCGARSKRTGKPCQGAVARGAYDRLPEMAADLVSRG |
| Ga0310916_102224954 | 3300031942 | Soil | MSDEPLAREREAREREPIERVRARLEALVRANAAPRCGARSKRTGKPCL |
| Ga0310916_115074601 | 3300031942 | Soil | MSNEPLAREREPIERVRARLEALVRANAAPRCGARSKRTGKPCRGAA |
| Ga0310913_103323831 | 3300031945 | Soil | VTHKMNNEPLEREPVSNEPLEHEPIDRMRARLEALLKANAAPRCGARSKRTGKPCQGAA |
| Ga0310910_114130022 | 3300031946 | Soil | MAGDDRKMNNEPLEREPIDRVRARLEALLKANAAPRCGA |
| Ga0306922_119130222 | 3300032001 | Soil | MSDEPLAREREPIERVRARLEALVMANAAPRCGARSKRTAKPC |
| Ga0318507_104103201 | 3300032025 | Soil | VTHKMNNEPLEREPVSNEPLEHEPIDRMRARLEALLKANAAPRCGARSKRTGKPCQ |
| Ga0318507_104190362 | 3300032025 | Soil | MSDEPLAREREAREREPIERVRARLEALVRANAAPRCGARSKRTGKPCRAAAMPNGRCKL |
| Ga0318533_100642454 | 3300032059 | Soil | MNNEPLEREPIDRVRARLEALLKANAAPRCGARSKRTGKPCR |
| Ga0318540_105674621 | 3300032094 | Soil | MNNEPLEREPIDRMRTRLEALLKANAAPRCGARSKRTGKPC |
| Ga0307470_110044051 | 3300032174 | Hardwood Forest Soil | MSDEPLAREREPIERVRARLEALAMANAAPRCGARSKRTGKPCQGAAMPNG |
| Ga0307470_115295102 | 3300032174 | Hardwood Forest Soil | MNNEPREREPIDRMRARLEALLKANAAPRCGARSKRTGKPCQGAAMPNGRC |
| Ga0306920_1010416131 | 3300032261 | Soil | MSDEPLAREREAREREPIERMRARLEALVRANAAPRC |
| ⦗Top⦘ |