


| Basic Information | |
|---|---|
| Family ID | F077823 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 40 residues |
| Representative Sequence | DVVARSVYALGGKIGVSTNPGKFTRFKIVLPAAEAASTAVA |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 95.73 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (24.786 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.786 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (33.333 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.59% β-sheet: 20.29% Coil/Unstructured: 68.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 82.91 |
| PF13690 | CheX | 11.97 |
| PF00486 | Trans_reg_C | 3.42 |
| PF00583 | Acetyltransf_1 | 0.85 |
| PF00528 | BPD_transp_1 | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17373632 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1438 | Open in IMG/M |
| 3300001545|JGI12630J15595_10028549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1158 | Open in IMG/M |
| 3300002067|JGI24735J21928_10108938 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 796 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101855266 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 504 | Open in IMG/M |
| 3300003330|Ga0006571J49611_1051102 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1649 | Open in IMG/M |
| 3300003331|Ga0006572J49612_1114371 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1080 | Open in IMG/M |
| 3300004120|Ga0058901_1406968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1198 | Open in IMG/M |
| 3300005260|Ga0074072_1132671 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 616 | Open in IMG/M |
| 3300005330|Ga0070690_100522880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae | 891 | Open in IMG/M |
| 3300005332|Ga0066388_102471231 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 944 | Open in IMG/M |
| 3300005347|Ga0070668_100701001 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300005467|Ga0070706_100517360 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1110 | Open in IMG/M |
| 3300005518|Ga0070699_100892775 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 814 | Open in IMG/M |
| 3300005538|Ga0070731_10575403 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 750 | Open in IMG/M |
| 3300005563|Ga0068855_100266331 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1907 | Open in IMG/M |
| 3300005610|Ga0070763_10298546 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 885 | Open in IMG/M |
| 3300005718|Ga0068866_11024093 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300005921|Ga0070766_10409967 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 889 | Open in IMG/M |
| 3300006047|Ga0075024_100604928 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 590 | Open in IMG/M |
| 3300006163|Ga0070715_10850665 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 558 | Open in IMG/M |
| 3300006173|Ga0070716_101541990 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 544 | Open in IMG/M |
| 3300006854|Ga0075425_100946085 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 984 | Open in IMG/M |
| 3300009093|Ga0105240_10298887 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1842 | Open in IMG/M |
| 3300009093|Ga0105240_11438592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales | 724 | Open in IMG/M |
| 3300009098|Ga0105245_11939822 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300009146|Ga0105091_10388644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 693 | Open in IMG/M |
| 3300009174|Ga0105241_11624144 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300009551|Ga0105238_10985350 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 863 | Open in IMG/M |
| 3300010043|Ga0126380_10923847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales | 727 | Open in IMG/M |
| 3300010048|Ga0126373_10642012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → unclassified Alteromonadaceae → Alteromonadaceae bacterium | 1117 | Open in IMG/M |
| 3300010359|Ga0126376_10662069 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 998 | Open in IMG/M |
| 3300010359|Ga0126376_11619353 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300012349|Ga0137387_10803387 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300012362|Ga0137361_10408882 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1247 | Open in IMG/M |
| 3300012927|Ga0137416_10362824 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1218 | Open in IMG/M |
| 3300012929|Ga0137404_10633407 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 963 | Open in IMG/M |
| 3300012930|Ga0137407_12190772 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300012957|Ga0164303_11284742 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300012971|Ga0126369_12479063 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300012975|Ga0134110_10200705 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 837 | Open in IMG/M |
| 3300014489|Ga0182018_10203838 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1105 | Open in IMG/M |
| 3300014968|Ga0157379_11735309 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300015052|Ga0137411_1056593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1060 | Open in IMG/M |
| 3300015373|Ga0132257_102634552 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300016404|Ga0182037_11737975 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300017947|Ga0187785_10668631 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300017993|Ga0187823_10163048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 711 | Open in IMG/M |
| 3300018422|Ga0190265_12430031 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300019270|Ga0181512_1328043 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300020027|Ga0193752_1313627 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 541 | Open in IMG/M |
| 3300020199|Ga0179592_10012560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3686 | Open in IMG/M |
| 3300020583|Ga0210401_10902016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 743 | Open in IMG/M |
| 3300021086|Ga0179596_10200517 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 971 | Open in IMG/M |
| 3300021384|Ga0213876_10418726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 712 | Open in IMG/M |
| 3300021402|Ga0210385_10321705 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1150 | Open in IMG/M |
| 3300021474|Ga0210390_10453364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1082 | Open in IMG/M |
| 3300021477|Ga0210398_10981909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 674 | Open in IMG/M |
| 3300021560|Ga0126371_11064852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 949 | Open in IMG/M |
| 3300022527|Ga0242664_1020502 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1035 | Open in IMG/M |
| 3300022726|Ga0242654_10101596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 904 | Open in IMG/M |
| 3300024288|Ga0179589_10359693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 662 | Open in IMG/M |
| 3300025572|Ga0207864_1063272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 882 | Open in IMG/M |
| 3300025914|Ga0207671_10181329 | All Organisms → cellular organisms → Bacteria | 1639 | Open in IMG/M |
| 3300025914|Ga0207671_11099518 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300025929|Ga0207664_11063114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 724 | Open in IMG/M |
| 3300025941|Ga0207711_10489311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1146 | Open in IMG/M |
| 3300026035|Ga0207703_10472637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1174 | Open in IMG/M |
| 3300026078|Ga0207702_10910276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 872 | Open in IMG/M |
| 3300026359|Ga0257163_1044954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 702 | Open in IMG/M |
| 3300027537|Ga0209419_1000894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 3438 | Open in IMG/M |
| 3300027575|Ga0209525_1139222 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300027603|Ga0209331_1094200 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300027643|Ga0209076_1123315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 731 | Open in IMG/M |
| 3300027676|Ga0209333_1141205 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300027727|Ga0209328_10179092 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300027869|Ga0209579_10039844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2530 | Open in IMG/M |
| 3300028380|Ga0268265_10705192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 975 | Open in IMG/M |
| 3300029951|Ga0311371_10681443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1297 | Open in IMG/M |
| 3300030514|Ga0268253_10144995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 732 | Open in IMG/M |
| 3300030520|Ga0311372_11618785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 787 | Open in IMG/M |
| 3300030596|Ga0210278_1136579 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 590 | Open in IMG/M |
| 3300030743|Ga0265461_13285036 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300031057|Ga0170834_109886666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 726 | Open in IMG/M |
| 3300031099|Ga0308181_1175049 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
| 3300031122|Ga0170822_15284526 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300031231|Ga0170824_101918965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 684 | Open in IMG/M |
| 3300031231|Ga0170824_126284789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1069 | Open in IMG/M |
| 3300031474|Ga0170818_112406220 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300031546|Ga0318538_10205672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1052 | Open in IMG/M |
| 3300031546|Ga0318538_10287869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 884 | Open in IMG/M |
| 3300031616|Ga0307508_10526361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 779 | Open in IMG/M |
| 3300031682|Ga0318560_10224870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1005 | Open in IMG/M |
| 3300031724|Ga0318500_10449448 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300031748|Ga0318492_10815062 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300031751|Ga0318494_10515295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 697 | Open in IMG/M |
| 3300031754|Ga0307475_11040748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 642 | Open in IMG/M |
| 3300031764|Ga0318535_10199909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 894 | Open in IMG/M |
| 3300031765|Ga0318554_10568271 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300031778|Ga0318498_10275838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 756 | Open in IMG/M |
| 3300031797|Ga0318550_10423177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 644 | Open in IMG/M |
| 3300031798|Ga0318523_10277322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 837 | Open in IMG/M |
| 3300031831|Ga0318564_10179291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 944 | Open in IMG/M |
| 3300031832|Ga0318499_10406479 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300031835|Ga0318517_10414222 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300031894|Ga0318522_10110045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1024 | Open in IMG/M |
| 3300031912|Ga0306921_10178952 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2486 | Open in IMG/M |
| 3300031959|Ga0318530_10240085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 746 | Open in IMG/M |
| 3300031959|Ga0318530_10377681 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300032044|Ga0318558_10435454 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300032065|Ga0318513_10358558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 710 | Open in IMG/M |
| 3300032089|Ga0318525_10703626 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300032126|Ga0307415_101190194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 718 | Open in IMG/M |
| 3300032180|Ga0307471_101050628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 981 | Open in IMG/M |
| 3300032261|Ga0306920_104446894 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300032515|Ga0348332_10408076 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300032893|Ga0335069_10125580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3207 | Open in IMG/M |
| 3300032893|Ga0335069_12709986 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.79% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.13% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.13% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.56% |
| Ionic Liquid And High Solid Enriched | Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched | 2.56% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.71% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.71% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.71% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.85% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.85% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.85% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.85% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.85% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.85% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.85% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.85% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.85% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.85% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Host-Associated | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003330 | Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-1-R (Metagenome Metatranscriptome, Counting Only) | Engineered | Open in IMG/M |
| 3300003331 | Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-2-R (Metagenome Metatranscriptome, Counting Only) | Engineered | Open in IMG/M |
| 3300004120 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF238 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005260 | Microbial communities on the surface of kaolinite enhanced biochar from soil with fertiliser in Sydney, Australia | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300019270 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020027 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c1 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025572 | Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-2-D (SPAdes) | Engineered | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030514 | Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (v2) | Host-Associated | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030596 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO085SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Host-Associated | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_03557280 | 2088090014 | Soil | GVGMDVVARSVYALGGKIGVSTHPGKFTRFKIVLPAAEPVSTAVA |
| JGI12630J15595_100285494 | 3300001545 | Forest Soil | YALGGKIGVSTHPGRFTRFKILLPAAAQAVSTAVA* |
| JGI24735J21928_101089383 | 3300002067 | Corn Rhizosphere | DVVARSVYALGGKIGVSTNPGKFTRFKIVLPAAEAANSGAAAAAV* |
| JGIcombinedJ26739_1018552661 | 3300002245 | Forest Soil | RSVYALGGKIGVSTHPGRFTRFKILLPAAHAVSTAVA* |
| Ga0006571J49611_10511021 | 3300003330 | Ionic Liquid And High Solid Enriched | VVARSIYALGGRIGVSTQPGRYTRFKIALPATEEHASTAVA* |
| Ga0006572J49612_11143711 | 3300003331 | Ionic Liquid And High Solid Enriched | DVVARSIYALGGRIGVSTQPGRYTRFKIALPATEEHASTAVA* |
| Ga0058901_14069681 | 3300004120 | Forest Soil | MDVVARSVYALGGKIGVSTHPGRYTRFKISLPAGAASSAVA* |
| Ga0074072_11326711 | 3300005260 | Soil | VARSVYALGGKIGVSTNPGKFTRFKIVLPAAEAANSGAAAAAV* |
| Ga0070690_1005228801 | 3300005330 | Switchgrass Rhizosphere | VVARSVYALGGKIGVSTNPGKFTRFKIVLPAAEAANSGAAAAAV* |
| Ga0066388_1024712313 | 3300005332 | Tropical Forest Soil | GVGMDVVARSVYALGGKIGVSTHPGRFTRFKIVLPVSDAVGSTAVA* |
| Ga0070668_1007010011 | 3300005347 | Switchgrass Rhizosphere | VAKSVYAIGGKIGVTTNPGKFTRFKVSLPASSEEASTAVA* |
| Ga0070706_1005173601 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VAKSVYAIGGKIGVTTNPGKFTRFKVSLPATEEANTAVA* |
| Ga0070699_1008927753 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VGMDVVARSVYALGGKIGVSTHPGKFTRFKIVLPSAEAVSTAVA* |
| Ga0070731_105754033 | 3300005538 | Surface Soil | ALGGKIGVSTHPGRFTRFKIVLPVSETLGSTAVA* |
| Ga0068855_1002663316 | 3300005563 | Corn Rhizosphere | SVYALGGKIGVSTHPGKFTRFKIVLPATDAVGSTAVA* |
| Ga0070763_102985461 | 3300005610 | Soil | YALGGKIGVSTNPGKFTRFKIVLPAAEATSSTAVA* |
| Ga0068866_110240932 | 3300005718 | Miscanthus Rhizosphere | SVYAIGGKIGVTTNPGKFTRFKVSLPASSEEASTAVA* |
| Ga0070766_104099673 | 3300005921 | Soil | RSVYALGGKIGVSTHPGKYTRFKISLPGGQAAGNSAVA* |
| Ga0075024_1006049282 | 3300006047 | Watersheds | VYALGGKIGVSTHPGKYTRFKIVLPAADAVGSTAVA* |
| Ga0070715_108506651 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VYALGGKIGVSTHPGKFTRFKIVLPSAEAVSTAVA* |
| Ga0070716_1015419901 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | DVVARSVYALGGKIGVSTNPGKFTRFKIVLPAAESANAAVAV* |
| Ga0075425_1009460851 | 3300006854 | Populus Rhizosphere | GMDVVARSVYALGGKIGVSTHPGKFTRFKIVLPATDAVGSTAVA* |
| Ga0105240_102988871 | 3300009093 | Corn Rhizosphere | RSVYALGGKIGVSTNPGKFTRFKIVLPAAEAASTAVA* |
| Ga0105240_114385923 | 3300009093 | Corn Rhizosphere | VGMDVVARSVHALGGKIGVSTNPGKFTRFKIALPAAEAANTAVA* |
| Ga0105245_119398222 | 3300009098 | Miscanthus Rhizosphere | SVYALGGKIGVSTNPGKFTRFKIVLPAAEAASTAVA* |
| Ga0105091_103886441 | 3300009146 | Freshwater Sediment | RSVYAAGGRIGVATGLGKFTRFKITLPAIAAAANTAVA* |
| Ga0105241_116241441 | 3300009174 | Corn Rhizosphere | MDVVARSIYALGGKIGVSTNPGKFTRFKIVLPAAEAASTAVA* |
| Ga0105238_109853501 | 3300009551 | Corn Rhizosphere | SVYALGGKIGVSTNPGKFTRFKIVLPAAESPSAAVAV* |
| Ga0126380_109238473 | 3300010043 | Tropical Forest Soil | VARSVYALGGKIGVSTHPGKFTRFKIVLPAAEPVSTAVA* |
| Ga0126373_106420123 | 3300010048 | Tropical Forest Soil | MDVVARNIYALGGRIGVSTSPGKFTRFKITLPLSPERADTAVA* |
| Ga0126376_106620693 | 3300010359 | Tropical Forest Soil | YALGGKVGVSTHPGKFTRFRIVLPATEAVSTAVA* |
| Ga0126376_116193531 | 3300010359 | Tropical Forest Soil | DVVAKSVYAIGGKIGVTTNPGKFTRFKVSLPATEEANTAVA* |
| Ga0137387_108033871 | 3300012349 | Vadose Zone Soil | GMDVVARSVYALGGKIGVSTNPGKFTRFKIVLPAAESANAAVAV* |
| Ga0137361_104088824 | 3300012362 | Vadose Zone Soil | GVGMDVVARSVYKLGGKIGVSTNPGKYTRFKILLPAAGAASTAVA* |
| Ga0137416_103628244 | 3300012927 | Vadose Zone Soil | MDVVARSVYSLGGKIGVSTHPGRFTRFKILLPAVQAVSSAVA* |
| Ga0137404_106334073 | 3300012929 | Vadose Zone Soil | GVGMDVVARSVYALGGKIGVSTNPGKFTRFKIVLPAAEAANNAAVAV* |
| Ga0137407_121907721 | 3300012930 | Vadose Zone Soil | YALGGKIGVSTNPGKFTRFKIVLPAAEAANNAAVAV* |
| Ga0164303_112847421 | 3300012957 | Soil | SVYALGGKIGVSTHPGKRTRFKIVLPAAEAVSTAVA* |
| Ga0126369_124790631 | 3300012971 | Tropical Forest Soil | VGMDVVARSVYALGGKIGVSTHPGRFTRFKIVLPVSDAVGSTAVA* |
| Ga0134110_102007053 | 3300012975 | Grasslands Soil | VYALGGRIGVSTHPGRFTRFKILLPAAQAVSSAVA* |
| Ga0182018_102038384 | 3300014489 | Palsa | SVANLGGKIGVSTHPGKFTRFRVVLPGVDADSAAVA* |
| Ga0157379_117353091 | 3300014968 | Switchgrass Rhizosphere | RSVYALGGKIGVSTNPGKFTRFKIVLPAAESANAAMAV* |
| Ga0137411_10565931 | 3300015052 | Vadose Zone Soil | ALGGKIDALGGKIGVSTHPGRFTRFKILLPAAAQAVSTAVA* |
| Ga0132257_1026345523 | 3300015373 | Arabidopsis Rhizosphere | KSVYAIGGKIGVTTNTGKFTRFKVSLPASSEEASTAVA* |
| Ga0182037_117379751 | 3300016404 | Soil | MDVVARSVYALGGKIGVSTHPGKFTRFKIVLPAAEPVSTAVA |
| Ga0187785_106686312 | 3300017947 | Tropical Peatland | VARSVYALGGKIGVSTHPGKFTRFKIVLPATDSVSSTAVA |
| Ga0187823_101630481 | 3300017993 | Freshwater Sediment | VGMDVIARSVYALGGKIGVSTHPGKYTRFKISLPAGQASSSAVA |
| Ga0190265_124300311 | 3300018422 | Soil | MDVVARSVYGAGGRIGVATGLGKFTRFKITLPAIAAVANTAVA |
| Ga0181512_13280431 | 3300019270 | Peatland | RGVGMDVVARSVYALGGKIGVSTNPGKFTRFKIVLPAAEAANSGAAVAAV |
| Ga0193752_13136272 | 3300020027 | Soil | GVGMDVVAKSVHAIGGKIGVTTNPGKFTRFKVSLPATEEANTAVA |
| Ga0179592_100125609 | 3300020199 | Vadose Zone Soil | RSVYSLGGKIGVSTHPGRFTRFKILLPAAQAVSSAVA |
| Ga0210401_109020163 | 3300020583 | Soil | VYALGGKIGVSTHPGKFTRFKIVLPAVDAAGSSAVA |
| Ga0179596_102005171 | 3300021086 | Vadose Zone Soil | DVVARSVYALGGKIGVSTNPGKFTRFKIVLPAAEAASTAVA |
| Ga0213876_104187263 | 3300021384 | Plant Roots | VVARSVYALGGKIGVSTNPGKFTRFKIVLPAAEAPSAAVAV |
| Ga0210385_103217054 | 3300021402 | Soil | VYALGGKIGVSTHPGRFTRFKIVLPAVEAARTAVA |
| Ga0210390_104533641 | 3300021474 | Soil | VVARSVYALGGKIGVSTHPGRYTRFKISLPAGAASSAVA |
| Ga0210398_109819093 | 3300021477 | Soil | VGMDVVARSVYALGGKIGVSTNPGKFTRFKIVLPAAESANTAVAV |
| Ga0126371_110648523 | 3300021560 | Tropical Forest Soil | GVGMDVVARSVYALGGKIGVSTHPGKFTRFKIVLPAAEAVSTAVA |
| Ga0242664_10205021 | 3300022527 | Soil | RGVGMDVVARSVYALGGKIGVSTNPGKFTRFKIVLPAAEASSSTAVA |
| Ga0242654_101015963 | 3300022726 | Soil | EVVARSVYALGGKIGVSTHPGRYTRFKISLPAGAASSAVA |
| Ga0179589_103596933 | 3300024288 | Vadose Zone Soil | YALGGKIGVSTNPGKFTRFKIVLPAAEAANSGAAVAV |
| Ga0207864_10632721 | 3300025572 | Ionic Liquid And High Solid Enriched | VAKSVYAIGGKIGVTTNPGKFTRFKVSLPASEETSTAVA |
| Ga0207671_101813294 | 3300025914 | Corn Rhizosphere | RSVYALGGKIGVSTNPGKFTRFKIVLPAAEAASTAVA |
| Ga0207671_110995181 | 3300025914 | Corn Rhizosphere | GMDVVARSIYALGGKIGVATNPGKFTRFKIALPAVRQETSTAVA |
| Ga0207664_110631143 | 3300025929 | Agricultural Soil | VGMDVVARSVYALGGKIGVSTNPGKFTRFKIVLPAAEEASTAVA |
| Ga0207711_104893113 | 3300025941 | Switchgrass Rhizosphere | YALGGKIGVSTNPGKFTRFKIVLPAAEAANSGAAAAAV |
| Ga0207703_104726371 | 3300026035 | Switchgrass Rhizosphere | VVARSIYALSGKIGVATNPGKFTRFKIALPAVRQETSTAVA |
| Ga0207702_109102761 | 3300026078 | Corn Rhizosphere | RSVYALGGKIGVSTNPGKFTRFKIVLPAAEEASAVA |
| Ga0257163_10449543 | 3300026359 | Soil | DVVARSVYALGGKIGVSTHPGRFTRFKILLPAAAQAVSSAVA |
| Ga0209419_10008941 | 3300027537 | Forest Soil | MDVVARSVYALGGKIGVSTHPGRFTRFKILLPAAQAVSTAVA |
| Ga0209525_11392222 | 3300027575 | Forest Soil | GVGMDVVARSVYALGGKIGVSTHPGRFTRFKILLPAAQAVSTAVA |
| Ga0209331_10942003 | 3300027603 | Forest Soil | RSVYALGGKIGVSTNPGKFTRFKIVLPAAEPANAAVAV |
| Ga0209076_11233151 | 3300027643 | Vadose Zone Soil | ARSVYSLGGKIGVSTHPGRFTRFKILLPAVQAVSSAVA |
| Ga0209333_11412052 | 3300027676 | Forest Soil | MDVVARSVHALGGKIGVSTHPGKFTRFKIVLPAVEAARTAVA |
| Ga0209328_101790923 | 3300027727 | Forest Soil | VVARAVYALGGKIGVSTHPGKFTRFKIVLPASDAVTAVA |
| Ga0209579_100398448 | 3300027869 | Surface Soil | RSVALLGGKIGVTTNPGKFTRFKIALPVSEGADSAVA |
| Ga0268265_107051921 | 3300028380 | Switchgrass Rhizosphere | KSVYAIGGKIGVTTNPGKFTRFKVSLPATEEANTAVA |
| Ga0311371_106814431 | 3300029951 | Palsa | VARSVYALGGKIGVSTHPGRFTRFKIVLPAVEAARTAVA |
| Ga0268253_101449953 | 3300030514 | Agave | GVGMDVVAKSVYAIGGKIGVTTNPGKFTRFKVSLPASEEASTQVA |
| Ga0311372_116187851 | 3300030520 | Palsa | MDVVARSVYALGGKIGVSTNPGKFTRFKIVLPAAEAASSTAVA |
| Ga0210278_11365792 | 3300030596 | Soil | RGVGMDVVARSVYALGGKIGVSTHPGRFTRFKILLPPAQAVSTAVA |
| Ga0265461_132850362 | 3300030743 | Soil | VGMDVVARSVYALGGKIGVSTHPGRFTRFKILLPPAQAVSTAVA |
| Ga0170834_1098866663 | 3300031057 | Forest Soil | ARSVYALGGKIGVSTHPGRFTRFKIVLPSSDSVSSTAVA |
| Ga0308181_11750492 | 3300031099 | Soil | VGMDVVAKSVYAIGGKIGVTTNPGKFTRFKVSLPATEEANTAVA |
| Ga0170822_152845261 | 3300031122 | Forest Soil | RGVGMDVVARSVANLGGKIGVSTHPGKFTRFRVVLPSADESSAAVA |
| Ga0170824_1019189653 | 3300031231 | Forest Soil | RSVYALGGKIGVSTNPGKFTRFKIVLPAAEAANTGAAVAV |
| Ga0170824_1262847893 | 3300031231 | Forest Soil | DVVARSVYTLGGKIGVSTNPGKLTRFKIVLPATEEASTAVA |
| Ga0170818_1124062202 | 3300031474 | Forest Soil | VGMDVVARSVYALGGKIGVSTNPGKFTRFKIVLPAAEAASTAVA |
| Ga0318538_102056723 | 3300031546 | Soil | SVYALGGKIGVSTHPGKFTRFKIVLPATEAVSTAVA |
| Ga0318538_102878693 | 3300031546 | Soil | VYALGGKLGVSTHPGKFTRFKIVLPATEAVSTAVA |
| Ga0307508_105263611 | 3300031616 | Ectomycorrhiza | VVARSVYALGGKIGVSTNPGKFTRFKIVLPAAEAANSGASAAAV |
| Ga0318560_102248703 | 3300031682 | Soil | RSVYALGGKLGVSTHPGKFTRFKIVLPATEAVSTAVA |
| Ga0318500_104494481 | 3300031724 | Soil | MDVVARSVYALGGKIGVSTHPGKFTRFKIVLPATEAVSTAVA |
| Ga0318492_108150622 | 3300031748 | Soil | GMDVVARSISAIGGKIGVSTNPGKFTRFRIALPLTQDADSAVA |
| Ga0318494_105152951 | 3300031751 | Soil | DLVARSVYALGGKIGVSTHPGKFTRFKIVLPATEAVSTAVA |
| Ga0307475_110407483 | 3300031754 | Hardwood Forest Soil | VGMDVVARSVYALGGRIGVSTHPGKYTRFKISLPAGQASSSAVA |
| Ga0318535_101999091 | 3300031764 | Soil | GMDVVARSVYALGGKIGVSTHPGKFTRFKIVLPAAEPVSTAVA |
| Ga0318554_105682711 | 3300031765 | Soil | MDVVARSVAGLGGKIGVSTHPGKYTRFRVVLPDIDPDSVAVA |
| Ga0318498_102758383 | 3300031778 | Soil | VGMDVVARSVYALGGKIGVSTHPGKFTRFKIVLPAAEPVSTAVA |
| Ga0318550_104231773 | 3300031797 | Soil | VHLLGGRIGVSTHPGRYTRFKIVLPADESLSTAVA |
| Ga0318523_102773223 | 3300031798 | Soil | ARSVYALGGKIGVSTHPGKFTRFKIVLPATDSLNTAVA |
| Ga0318564_101792911 | 3300031831 | Soil | VYALGGKIGVSTHAGKFTRFKIVLPATEAVSTAVA |
| Ga0318499_104064792 | 3300031832 | Soil | VYALGGKIGVSTHPGKFTRFKIVLPTSESVSTAVA |
| Ga0318517_104142222 | 3300031835 | Soil | GMDLVARSVYALGGKIGVSTHPGKFTRFKIVLPATEAVSTAVA |
| Ga0318522_101100453 | 3300031894 | Soil | VVARSVYALGGKIGVSTHPGKFTRFKIVLPATDESVSTAVA |
| Ga0306921_101789525 | 3300031912 | Soil | VARSVYALGGRIGVSTHPGRYTRFKIVLPADESLSTAVA |
| Ga0318530_102400853 | 3300031959 | Soil | VYALGGKIGVSTHPGKFTRFKIVLPATEPASTAVA |
| Ga0318530_103776811 | 3300031959 | Soil | VGMDVVARSVYALGGKIGVSTHPGKFTRFKIVLPATEAVSTAVA |
| Ga0318558_104354543 | 3300032044 | Soil | DLVARSVYALGGKIGVSTHPGKFTRFKIVLPAAEPVSTAVA |
| Ga0318513_103585583 | 3300032065 | Soil | VYALGGRIGVSTHPGRYTRFKIVLPADESLSTAVA |
| Ga0318525_107036262 | 3300032089 | Soil | VGMDVVARSVYALGGKIGVSTHPGKFTRFKIVLPAAEAVSTAVA |
| Ga0307415_1011901941 | 3300032126 | Rhizosphere | VVAKSVYAIGGKIGVTTNPGKFTRFKVSLPATEEANTAVA |
| Ga0307471_1010506283 | 3300032180 | Hardwood Forest Soil | DVVARSVYALGGKIGVSTHPGKFTRFKIVLPSAEAVSTAVA |
| Ga0306920_1044468942 | 3300032261 | Soil | SVYALGGKIGVSTHPGKFTRFKIVLPATDSLNTAVA |
| Ga0348332_104080761 | 3300032515 | Plant Litter | RSVANLGGKIVVSTHPGKFTRFRVVLPGADSDSAAVA |
| Ga0335069_101255805 | 3300032893 | Soil | DVVARSVYALGGKIGVSTHPGKYTRFKILLPGAEPASTAVA |
| Ga0335069_127099862 | 3300032893 | Soil | SVYALGGKIGVSTHPGKYTRFKISLPGGAAAGNSAVA |
| ⦗Top⦘ |