


| Basic Information | |
|---|---|
| Family ID | F077810 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MRVSLIRKLWKEKVEIPVLQKRVDKTLKEIDVKLKRSKHNVR |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 76.92 % |
| % of genes near scaffold ends (potentially truncated) | 13.68 % |
| % of genes from short scaffolds (< 2000 bps) | 71.79 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (52.137 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (47.008 % of family members) |
| Environment Ontology (ENVO) | Unclassified (86.325 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (82.906 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.14% β-sheet: 0.00% Coil/Unstructured: 42.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF11753 | DUF3310 | 16.24 |
| PF05866 | RusA | 5.98 |
| PF01592 | NifU_N | 2.56 |
| PF01612 | DNA_pol_A_exo1 | 1.71 |
| PF09723 | Zn-ribbon_8 | 0.85 |
| PF00476 | DNA_pol_A | 0.85 |
| PF04071 | zf-like | 0.85 |
| PF05367 | Phage_endo_I | 0.85 |
| PF01106 | NifU | 0.85 |
| PF13155 | Toprim_2 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 5.98 |
| COG0822 | Fe-S cluster assembly scaffold protein IscU, NifU family | Posttranslational modification, protein turnover, chaperones [O] | 2.56 |
| COG0694 | Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domain | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 0.85 |
| COG2158 | Uncharacterized conserved protein, contains a Zn-finger-like domain | General function prediction only [R] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 52.14 % |
| All Organisms | root | All Organisms | 47.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001683|GBIDBA_10006270 | Not Available | 7817 | Open in IMG/M |
| 3300001743|JGI24515J20084_1009602 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300002518|JGI25134J35505_10027275 | All Organisms → Viruses → Predicted Viral | 1655 | Open in IMG/M |
| 3300002519|JGI25130J35507_1079973 | Not Available | 608 | Open in IMG/M |
| 3300003478|JGI26238J51125_1042062 | All Organisms → Viruses → environmental samples → uncultured marine virus | 965 | Open in IMG/M |
| 3300003542|FS900DNA_10159035 | Not Available | 646 | Open in IMG/M |
| 3300004097|Ga0055584_100080462 | All Organisms → Viruses → Predicted Viral | 3231 | Open in IMG/M |
| 3300005234|Ga0066613_1463297 | All Organisms → Viruses → Predicted Viral | 1934 | Open in IMG/M |
| 3300005398|Ga0066858_10046788 | Not Available | 1276 | Open in IMG/M |
| 3300005427|Ga0066851_10007308 | All Organisms → cellular organisms → Bacteria | 4578 | Open in IMG/M |
| 3300005427|Ga0066851_10040815 | All Organisms → Viruses → Predicted Viral | 1609 | Open in IMG/M |
| 3300005427|Ga0066851_10045540 | All Organisms → Viruses → Predicted Viral | 1508 | Open in IMG/M |
| 3300005592|Ga0066838_10013250 | All Organisms → Viruses → Predicted Viral | 2373 | Open in IMG/M |
| 3300005592|Ga0066838_10171060 | Not Available | 610 | Open in IMG/M |
| 3300005593|Ga0066837_10281144 | Not Available | 585 | Open in IMG/M |
| 3300005603|Ga0066853_10266534 | Not Available | 563 | Open in IMG/M |
| 3300005837|Ga0078893_10212768 | All Organisms → Viruses → Predicted Viral | 2396 | Open in IMG/M |
| 3300006090|Ga0082015_1022735 | Not Available | 1053 | Open in IMG/M |
| 3300006091|Ga0082018_1020798 | Not Available | 1187 | Open in IMG/M |
| 3300006091|Ga0082018_1024096 | Not Available | 1102 | Open in IMG/M |
| 3300006164|Ga0075441_10009802 | All Organisms → Viruses → Predicted Viral | 4084 | Open in IMG/M |
| 3300006310|Ga0068471_1437677 | Not Available | 935 | Open in IMG/M |
| 3300006325|Ga0068501_1003120 | Not Available | 547 | Open in IMG/M |
| 3300006336|Ga0068502_1324775 | All Organisms → Viruses → Predicted Viral | 1666 | Open in IMG/M |
| 3300006339|Ga0068481_1201483 | Not Available | 1125 | Open in IMG/M |
| 3300006339|Ga0068481_1271168 | Not Available | 582 | Open in IMG/M |
| 3300006421|Ga0082247_11453014 | Not Available | 518 | Open in IMG/M |
| 3300006465|Ga0082250_10387049 | Not Available | 516 | Open in IMG/M |
| 3300006736|Ga0098033_1051059 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1214 | Open in IMG/M |
| 3300006738|Ga0098035_1071752 | All Organisms → Viruses → Predicted Viral | 1233 | Open in IMG/M |
| 3300006738|Ga0098035_1134923 | Not Available | 845 | Open in IMG/M |
| 3300006752|Ga0098048_1001507 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 10174 | Open in IMG/M |
| 3300006789|Ga0098054_1004605 | Not Available | 6117 | Open in IMG/M |
| 3300006789|Ga0098054_1012931 | Not Available | 3415 | Open in IMG/M |
| 3300006789|Ga0098054_1207789 | Not Available | 712 | Open in IMG/M |
| 3300006793|Ga0098055_1244988 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 675 | Open in IMG/M |
| 3300006922|Ga0098045_1033955 | All Organisms → Viruses → Predicted Viral | 1305 | Open in IMG/M |
| 3300006923|Ga0098053_1014381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1761 | Open in IMG/M |
| 3300006924|Ga0098051_1068191 | Not Available | 969 | Open in IMG/M |
| 3300007229|Ga0075468_10002649 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 7644 | Open in IMG/M |
| 3300007514|Ga0105020_1023020 | Not Available | 5912 | Open in IMG/M |
| 3300007992|Ga0105748_10377007 | Not Available | 610 | Open in IMG/M |
| 3300008050|Ga0098052_1001156 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 16682 | Open in IMG/M |
| 3300008217|Ga0114899_1023402 | All Organisms → Viruses → Predicted Viral | 2368 | Open in IMG/M |
| 3300009079|Ga0102814_10240430 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 986 | Open in IMG/M |
| 3300009129|Ga0118728_1133208 | Not Available | 1100 | Open in IMG/M |
| 3300009130|Ga0118729_1101329 | All Organisms → Viruses → Predicted Viral | 1400 | Open in IMG/M |
| 3300009132|Ga0118730_1013742 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 7189 | Open in IMG/M |
| 3300009420|Ga0114994_10566331 | Not Available | 746 | Open in IMG/M |
| 3300009420|Ga0114994_10968105 | Not Available | 551 | Open in IMG/M |
| 3300009512|Ga0115003_10382841 | Not Available | 828 | Open in IMG/M |
| 3300009619|Ga0105236_1054009 | Not Available | 539 | Open in IMG/M |
| 3300009622|Ga0105173_1037436 | Not Available | 788 | Open in IMG/M |
| 3300009622|Ga0105173_1080121 | Not Available | 582 | Open in IMG/M |
| 3300010149|Ga0098049_1161453 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 692 | Open in IMG/M |
| 3300010883|Ga0133547_12071495 | All Organisms → Viruses → Predicted Viral | 1039 | Open in IMG/M |
| 3300017718|Ga0181375_1022272 | Not Available | 1084 | Open in IMG/M |
| 3300017721|Ga0181373_1031387 | Not Available | 980 | Open in IMG/M |
| 3300017771|Ga0181425_1068398 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1148 | Open in IMG/M |
| 3300017775|Ga0181432_1290308 | Not Available | 518 | Open in IMG/M |
| 3300017776|Ga0181394_1071357 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1140 | Open in IMG/M |
| 3300020262|Ga0211537_1009842 | All Organisms → Viruses → Predicted Viral | 2343 | Open in IMG/M |
| 3300020390|Ga0211555_10069785 | All Organisms → Viruses → Predicted Viral | 1303 | Open in IMG/M |
| 3300021089|Ga0206679_10025369 | All Organisms → Viruses → Predicted Viral | 3763 | Open in IMG/M |
| 3300021089|Ga0206679_10065747 | All Organisms → Viruses → Predicted Viral | 2154 | Open in IMG/M |
| 3300021185|Ga0206682_10088573 | All Organisms → Viruses → Predicted Viral | 1563 | Open in IMG/M |
| 3300021352|Ga0206680_10244184 | Not Available | 697 | Open in IMG/M |
| 3300021378|Ga0213861_10449921 | Not Available | 622 | Open in IMG/M |
| 3300021442|Ga0206685_10150892 | Not Available | 776 | Open in IMG/M |
| 3300021957|Ga0222717_10002900 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 13079 | Open in IMG/M |
| 3300022225|Ga0187833_10584192 | Not Available | 558 | Open in IMG/M |
| 3300022227|Ga0187827_10164176 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1549 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10067777 | All Organisms → Viruses → Predicted Viral | 1469 | Open in IMG/M |
| (restricted) 3300024517|Ga0255049_10094467 | Not Available | 1357 | Open in IMG/M |
| (restricted) 3300024518|Ga0255048_10359649 | Not Available | 705 | Open in IMG/M |
| 3300025046|Ga0207902_1041423 | Not Available | 573 | Open in IMG/M |
| 3300025049|Ga0207898_1017408 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp. | 905 | Open in IMG/M |
| 3300025066|Ga0208012_1009747 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1741 | Open in IMG/M |
| 3300025072|Ga0208920_1003890 | All Organisms → Viruses → Predicted Viral | 3576 | Open in IMG/M |
| 3300025072|Ga0208920_1009123 | All Organisms → Viruses → Predicted Viral | 2249 | Open in IMG/M |
| 3300025078|Ga0208668_1008837 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 2250 | Open in IMG/M |
| 3300025082|Ga0208156_1001795 | Not Available | 6635 | Open in IMG/M |
| 3300025082|Ga0208156_1080662 | Not Available | 608 | Open in IMG/M |
| 3300025084|Ga0208298_1001103 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 10335 | Open in IMG/M |
| 3300025103|Ga0208013_1001242 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 12208 | Open in IMG/M |
| 3300025122|Ga0209434_1030874 | All Organisms → Viruses → Predicted Viral | 1753 | Open in IMG/M |
| 3300025133|Ga0208299_1045583 | All Organisms → Viruses → Predicted Viral | 1706 | Open in IMG/M |
| 3300025151|Ga0209645_1002820 | Not Available | 8127 | Open in IMG/M |
| 3300025168|Ga0209337_1000475 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 32305 | Open in IMG/M |
| 3300025268|Ga0207894_1082343 | Not Available | 546 | Open in IMG/M |
| 3300025286|Ga0208315_1010771 | All Organisms → Viruses → Predicted Viral | 3203 | Open in IMG/M |
| 3300025286|Ga0208315_1013226 | All Organisms → Viruses → Predicted Viral | 2794 | Open in IMG/M |
| 3300025676|Ga0209657_1001715 | Not Available | 12917 | Open in IMG/M |
| 3300025870|Ga0209666_1130363 | All Organisms → Viruses → Predicted Viral | 1171 | Open in IMG/M |
| 3300026115|Ga0208560_1022406 | Not Available | 593 | Open in IMG/M |
| 3300026115|Ga0208560_1025094 | Not Available | 569 | Open in IMG/M |
| 3300026115|Ga0208560_1028351 | Not Available | 544 | Open in IMG/M |
| 3300026208|Ga0208640_1013416 | All Organisms → Viruses → Predicted Viral | 2427 | Open in IMG/M |
| 3300026209|Ga0207989_1004995 | Not Available | 5468 | Open in IMG/M |
| 3300026212|Ga0208409_1069782 | Not Available | 840 | Open in IMG/M |
| 3300027668|Ga0209482_1004718 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 7498 | Open in IMG/M |
| 3300027801|Ga0209091_10403727 | Not Available | 618 | Open in IMG/M |
| 3300027847|Ga0209402_10636799 | Not Available | 596 | Open in IMG/M |
| 3300028535|Ga0257111_1186589 | Not Available | 622 | Open in IMG/M |
| 3300031141|Ga0308021_10168274 | Not Available | 855 | Open in IMG/M |
| 3300031519|Ga0307488_10437311 | Not Available | 798 | Open in IMG/M |
| 3300031602|Ga0307993_1021758 | All Organisms → Viruses → Predicted Viral | 1611 | Open in IMG/M |
| 3300031606|Ga0302119_10005824 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 5340 | Open in IMG/M |
| 3300031660|Ga0307994_1054142 | All Organisms → Viruses → Predicted Viral | 1571 | Open in IMG/M |
| 3300031695|Ga0308016_10268774 | Not Available | 635 | Open in IMG/M |
| 3300031701|Ga0302120_10074615 | All Organisms → Viruses → Predicted Viral | 1405 | Open in IMG/M |
| 3300032048|Ga0315329_10080284 | All Organisms → Viruses → Predicted Viral | 1629 | Open in IMG/M |
| 3300032130|Ga0315333_10246865 | Not Available | 846 | Open in IMG/M |
| 3300032278|Ga0310345_10613212 | Not Available | 1049 | Open in IMG/M |
| 3300032278|Ga0310345_11290724 | Not Available | 714 | Open in IMG/M |
| 3300032278|Ga0310345_12243426 | Not Available | 528 | Open in IMG/M |
| 3300032820|Ga0310342_102474202 | Not Available | 621 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 47.01% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 5.98% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 5.13% |
| Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 5.13% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 3.42% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 3.42% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.42% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.42% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 2.56% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.56% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.56% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 2.56% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 1.71% |
| Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment | 1.71% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.85% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.85% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.85% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.85% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.85% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.85% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.85% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.85% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.85% |
| Diffuse Hydrothermal Flow Volcanic Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent | 0.85% |
| Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001683 | Hydrothermal vent plume microbial communities from Guaymas Basin, Gulf of California - IDBA assembly | Environmental | Open in IMG/M |
| 3300001743 | Marine viral communities from the Pacific Ocean - LP-38 | Environmental | Open in IMG/M |
| 3300002518 | Marine viral communities from the Pacific Ocean - ETNP_6_100 | Environmental | Open in IMG/M |
| 3300002519 | Marine viral communities from the Pacific Ocean - ETNP_2_300 | Environmental | Open in IMG/M |
| 3300003478 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA | Environmental | Open in IMG/M |
| 3300003542 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS900_Dependable_DNA | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300005234 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI047_100m_RNA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005398 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV201 | Environmental | Open in IMG/M |
| 3300005427 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65 | Environmental | Open in IMG/M |
| 3300005592 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV89 | Environmental | Open in IMG/M |
| 3300005593 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV86 | Environmental | Open in IMG/M |
| 3300005603 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV61 | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006090 | Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP124 | Environmental | Open in IMG/M |
| 3300006091 | Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP125 | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006310 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_3_0500m | Environmental | Open in IMG/M |
| 3300006325 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0500m | Environmental | Open in IMG/M |
| 3300006336 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0500m | Environmental | Open in IMG/M |
| 3300006339 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_3_0500m | Environmental | Open in IMG/M |
| 3300006421 | Deep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten I | Environmental | Open in IMG/M |
| 3300006465 | Deep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten IX | Environmental | Open in IMG/M |
| 3300006736 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006923 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007514 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008217 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009129 | Combined Assembly of Gp0139513, Gp0139514 | Environmental | Open in IMG/M |
| 3300009130 | Combined Assembly of Gp0139511, Gp0139512 | Environmental | Open in IMG/M |
| 3300009132 | Combined Assembly of Gp0139359, Gp0139510 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009619 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3827_250 | Environmental | Open in IMG/M |
| 3300009622 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300017718 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_11 viral metaG | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300020262 | Marine microbial communities from Tara Oceans - TARA_B100000097 (ERX556100-ERR599172) | Environmental | Open in IMG/M |
| 3300020390 | Marine microbial communities from Tara Oceans - TARA_B100002049 (ERX555953-ERR598985) | Environmental | Open in IMG/M |
| 3300021089 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021352 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021442 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300022225 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_400_PacBio MetaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300022227 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_150_PacBio MetaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300024517 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3 | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300025046 | Marine viral communities from the Pacific Ocean - LP-45 (SPAdes) | Environmental | Open in IMG/M |
| 3300025049 | Marine viral communities from the Pacific Ocean - LP-55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025066 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025072 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025078 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025082 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025122 | Marine viral communities from the Pacific Ocean - ETNP_2_300 (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025268 | Marine viral communities from the Deep Pacific Ocean - MSP-114 (SPAdes) | Environmental | Open in IMG/M |
| 3300025286 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 (SPAdes) | Environmental | Open in IMG/M |
| 3300025676 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025870 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026115 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3827_250 (SPAdes) | Environmental | Open in IMG/M |
| 3300026208 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV72 (SPAdes) | Environmental | Open in IMG/M |
| 3300026209 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65 (SPAdes) | Environmental | Open in IMG/M |
| 3300026212 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV201 (SPAdes) | Environmental | Open in IMG/M |
| 3300027668 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027801 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300027847 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300028535 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_500m | Environmental | Open in IMG/M |
| 3300031141 | Marine microbial communities from water near the shore, Antarctic Ocean - #351 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031602 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260 | Environmental | Open in IMG/M |
| 3300031606 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Tmax | Environmental | Open in IMG/M |
| 3300031660 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #261 | Environmental | Open in IMG/M |
| 3300031695 | Marine microbial communities from water near the shore, Antarctic Ocean - #233 | Environmental | Open in IMG/M |
| 3300031701 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Bottom | Environmental | Open in IMG/M |
| 3300032048 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 32315 | Environmental | Open in IMG/M |
| 3300032130 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 34915 | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GBIDBA_1000627012 | 3300001683 | Hydrothermal Vent Plume | MRVSLMRKLWKEKVTVPVLLRQADKILGQIEVKLNNKRSKNAK* |
| JGI24515J20084_10096021 | 3300001743 | Marine | MKVSLMRKLWKEKVEIPVLQRKVDKTLKEINVKLKRSKHNVK* |
| JGI25134J35505_100272754 | 3300002518 | Marine | MKVNLIRKLWKEKVQIPVLLKKADKTLKEVDVKLKRSKHNVR* |
| JGI25130J35507_10799734 | 3300002519 | Marine | MKVSLIRKLWKQKVQIPVLQKQVDKTLEKINVKLQRRKHERLERLD* |
| JGI26238J51125_10420621 | 3300003478 | Marine | LDDINGLVSMKVNLIRKLWKEKVEVPVLERKINKILKVIDVKLKRSKNVREN* |
| FS900DNA_101590352 | 3300003542 | Diffuse Hydrothermal Flow Volcanic Vent | MKVNIMRKLWKERVQIPALQKQVGKTLREIDIKLKQKKEKKC* |
| Ga0055584_1000804625 | 3300004097 | Pelagic Marine | MRVSLMRKLWKEKVEVPALEKKIEKILKAIDVKLKERSKDVR* |
| Ga0066613_14632974 | 3300005234 | Marine | MRVSLMRKLWKEKVEVPALEKKIEKILKAIDVKLKERSKDVREN* |
| Ga0066858_100467883 | 3300005398 | Marine | MIVNLMQKLWKKKVQIPVLEKRTDKILRKIHVKLKQQRRK* |
| Ga0066851_100073089 | 3300005427 | Marine | MIVNLMRKLWKEKVQIPVLEKRTDKILREIHVKLKQQRRK* |
| Ga0066851_100408154 | 3300005427 | Marine | MRVSLMRKLWKEKVQIPALQKEVDKTLKKIDVKLKRSKHNVR* |
| Ga0066851_100455404 | 3300005427 | Marine | MRVSLMRKLWKEKVEVPALEKKIDKILKAIDVKLKERSKDVREN* |
| Ga0066838_100132506 | 3300005592 | Marine | MIVNLMRKLWKKKVQIPVLEKRTDKILRKIHVKLKQQRRK* |
| Ga0066838_101710603 | 3300005592 | Marine | VELEWVLMKVNLIRKLWKEKVQIPVLLKKADKTLKEVDVKLKRSKHNVR* |
| Ga0066837_102811443 | 3300005593 | Marine | KVSLMRKLWKEKVQIPALQKEVDKTLKKINVKLKRSKHNVR* |
| Ga0066853_102665343 | 3300005603 | Marine | ELEWVLMKVNLMRKLWKEKVQIPVLLKKADKTLKEVDVKLKRSKHNVR* |
| Ga0078893_102127683 | 3300005837 | Marine Surface Water | MKVSLMRKLWKQKVEVPVLESKIDKILKKIDVKLKERSKNVREN* |
| Ga0082015_10227351 | 3300006090 | Marine | MKVNLMRKLWKEKVQIPVLLKKADKTLKEVDVKLKRSKHNVR* |
| Ga0082018_10207985 | 3300006091 | Marine | MIVNLMRKLWKEKVQIPVLEKRTDKILGEIHVKLKQQRRK* |
| Ga0082018_10240963 | 3300006091 | Marine | MKVNLIRKLWKEKVQIPVLLKKADKTLKEVDVKLRRSKHNVR* |
| Ga0075441_100098028 | 3300006164 | Marine | MRVSLIKKLWKEKVEIPVLQRQVDKILKKAYVKLKRSNDVR* |
| Ga0068471_14376773 | 3300006310 | Marine | MRVSLIRKLWKQRVEIPVLLKKVDKNLKEIDVKLKRSKHNVR* |
| Ga0068501_10031203 | 3300006325 | Marine | MRVSLIRKLWKEKVEVPVLLKRVDKTLKEVDVKLKRSKYVK* |
| Ga0068502_13247755 | 3300006336 | Marine | VRVSLIRKLWKEKVQIPVLQKQVDKKLREIDVKLLKRSKYNVK* |
| Ga0068481_12014832 | 3300006339 | Marine | MRVSLIRKLWKEKVQIPALQKEVDKTLRQIDVKLNNKRSKNNARND* |
| Ga0068481_12711682 | 3300006339 | Marine | MRVSLIRKLWKQKVEIPVLQKQVDKTLKEIDVKLKRSKHNVR* |
| Ga0082247_114530141 | 3300006421 | Sediment | MRVSLIHKLWKEKVQIPVLLKQADKTLKKIDVKLKKEKKYVR* |
| Ga0082250_103870492 | 3300006465 | Sediment | MKVNLVRKLWKEKVQIPVLLKQTDKILGQIEVKLNNKRSKNAK* |
| Ga0098033_10510592 | 3300006736 | Marine | MKVSLMRKLWKEKVQIPVLQKEVDKTLKKINVKLKRSKHERLERLD* |
| Ga0098035_10717522 | 3300006738 | Marine | VCRVADLKVNLMKKLWKQKVEIPVLLNKVDKTLREVDVKLKRSKHVK* |
| Ga0098035_11349233 | 3300006738 | Marine | MRVSLMRKLWKEKVQIPALQKEVDKTLKKINVKLKRSKHNVR* |
| Ga0098048_10015079 | 3300006752 | Marine | MRVSLMRKLWKQKVEVPVLEKEIDKILKAISVKLKKGVKYVREDKERS* |
| Ga0098054_10046059 | 3300006789 | Marine | VADLKVNLMKKLWKQKVEIPVLLKKVDKTLREVDVKLKRSKHVK* |
| Ga0098054_10129314 | 3300006789 | Marine | MRVSLIRKLWKEKVQIPVLQKEVDKTLRQIDVKLNKRSKKI* |
| Ga0098054_12077893 | 3300006789 | Marine | MRVSLIRKLWKQKVEIPVLRKKVDKTLKEIDVKLKRSKHNVR* |
| Ga0098055_12449881 | 3300006793 | Marine | MRKLWKQKVEVPVLEKEIDKILKAISVKLKKGVKYVREDKERS* |
| Ga0098045_10339555 | 3300006922 | Marine | MIVNLMRKLWKEKVQIPVLEKRTDKILGKIHVKLKQQRRK* |
| Ga0098053_10143813 | 3300006923 | Marine | MIVNLMRKLWKKKVQIPVLKKQSDKILREIHVKLKQQRRK* |
| Ga0098051_10681913 | 3300006924 | Marine | MRVSLMRKLWKEKVEVPALEKKIEKILKAIDVKLKERSKD |
| Ga0075468_100026496 | 3300007229 | Aqueous | MRKLWKEKVEVPALEKKIEKILKAIDVKLKERSKDVR* |
| Ga0105020_10230208 | 3300007514 | Marine | MRVSLIRKLWKQKVEIPVLLKKVDKNLKEIDVKLKRSKHNVR* |
| Ga0105748_103770071 | 3300007992 | Estuary Water | VDDMRVSLMRKLWKEKVEVPALEKKIEKILKAIDVKLKERSKDVREN* |
| Ga0098052_10011566 | 3300008050 | Marine | MCGVESMRVSLMRKLWKEKVEVPALEKKIDKILKAIDVKLKERSKDVREN* |
| Ga0114899_10234022 | 3300008217 | Deep Ocean | MKVNLMRKLWKEQVEIPALQKQVEKTLKKIYVKLKRSKHNVR* |
| Ga0102814_102404301 | 3300009079 | Estuarine | AVCRVDDMRVSLMRKLWKEKVEVPALEKKIEKILKAIDVKLKERSKDVREN* |
| Ga0118728_11332085 | 3300009129 | Marine | YFVCRVEGMRVSLIRKLWKQKVEIPVLLKKVDKNLKEIDVKLKRSKHNVR* |
| Ga0118729_11013292 | 3300009130 | Marine | MFRDEDKMRVSLMRKLWKQKVEVPVLESKIDKILKKIDVKLKERSKNVR* |
| Ga0118730_10137425 | 3300009132 | Marine | MYRLACMKVSLMRKLWKQKVEVPVLESKIDKILKKIDVKLKERSKNVREN* |
| Ga0114994_105663313 | 3300009420 | Marine | MKVNLMRKLWKEKVEVPVLKRKIDKILKVIDVKLKKRSKDVG* |
| Ga0114994_109681052 | 3300009420 | Marine | MDKMKVNLMRKLWKEKVEVPVLKRKIDKILKVIDVKLKKRSKDVR* |
| Ga0115003_103828413 | 3300009512 | Marine | MKVNLMAKLWKEKVSVPRLLKQTDKILKKIDVKLK |
| Ga0105236_10540091 | 3300009619 | Marine Oceanic | VSLIRKLWKQKVEIPVLQKKVDKTLKEIDVKLQRSKHNVR* |
| Ga0105173_10374362 | 3300009622 | Marine Oceanic | MKVNLVRKLWKEKVQIPVLLKQTDKILGQIEVKLNNIRSKNAK* |
| Ga0105173_10801213 | 3300009622 | Marine Oceanic | MLICRRKDMKVNLIRKLWKEKVEIPILQKQVDKTLSKINVKLKRSKNVK* |
| Ga0098049_11614531 | 3300010149 | Marine | MCGVESMKVSLMRKLWKEKVEVPALEKKIDKILKAIDVKLKERSKDVREN* |
| Ga0133547_120714951 | 3300010883 | Marine | MYRMDTMKVNLMRKLWKEKVEVPVLKRKIDKILKVIDVKLKKRSKDVG* |
| Ga0181375_10222723 | 3300017718 | Marine | MKVNLIRKLWKERVQIPVLLKKADKTLKEVDVKLKRSKHNVR |
| Ga0181373_10313872 | 3300017721 | Marine | MRVSLMRKLWKEKVEVPALEKKIDKILKAIDVKLKERSKDVR |
| Ga0181425_10683984 | 3300017771 | Seawater | VDDMRVSLMRKLWKEKVEVPALEKKIEKILKAIDVKLKERSKDVR |
| Ga0181432_12903082 | 3300017775 | Seawater | MKVNLMRKLWKERVQIPVIKKQSDKILKKIYVKLKRRNIC |
| Ga0181394_10713573 | 3300017776 | Seawater | MRVSLMRKLRKEKVEVPALEKKIEKILKAIDVKLKERSKDVREN |
| Ga0211537_10098426 | 3300020262 | Marine | MIVNLMRKLWKKKVQIPVLEKRTDKILRKIHVKLKQQRRK |
| Ga0211555_100697853 | 3300020390 | Marine | MRVSLIRKLWKQKVEIPVLQKKVDKTLKEIDVKLKRSKHNVR |
| Ga0206679_100253691 | 3300021089 | Seawater | MRVSLIRKLWKEKVQIPVLQKEVDKTLRQIDVKLNKRSKKI |
| Ga0206679_100657474 | 3300021089 | Seawater | MRVSLVRKLWKERVQIPVLQKQVDETLRQIDVKLNNNRGV |
| Ga0206682_100885734 | 3300021185 | Seawater | MRVSLMRKLWKEKVEVPALEKKIEKILKAIDVKLKERSKDVR |
| Ga0206680_102441841 | 3300021352 | Seawater | VEDLKVNLMKKLWKQKVEIPVLLKKVDKTLREVDVKLKRSKHVK |
| Ga0213861_104499211 | 3300021378 | Seawater | MRKLWKEKVEVPALEKKIEKILKAIDVKLKERSKDVR |
| Ga0206685_101508923 | 3300021442 | Seawater | MRVSLIRKLWKEKVEVPVLLKRVDKTLKEVDVKLKRSKYVK |
| Ga0222717_1000290021 | 3300021957 | Estuarine Water | MRVSLMRKLWKEKVEVPALEKKIEKILKAIDVKLKERSKDVREN |
| Ga0187833_105841921 | 3300022225 | Seawater | MRVSLMRKLWKEKVQIPALQKEVDKTLKKINVKLKRSKHNVR |
| Ga0187827_101641762 | 3300022227 | Seawater | MIVNLMRKLWKEKVQIPVLEKRTDKILREIHVKLKQQRRK |
| (restricted) Ga0233412_100677773 | 3300023210 | Seawater | VADLKVNLMKKLWKQKVEIPVLLKKVDKTLREVDVKLKRSKHVK |
| (restricted) Ga0255049_100944674 | 3300024517 | Seawater | MKVNLMKKLWKEKVEIPVLQKKVDKTLKKINVKLKRSKHNVR |
| (restricted) Ga0255048_103596491 | 3300024518 | Seawater | EYKRLQKLWTKKVTVPVLLKQADKILGAIDVKLKKRSKDVR |
| Ga0207902_10414232 | 3300025046 | Marine | MKVNLIRKLWKEKVQLPVPQKQLGKTLKKIYVKLKRRNIC |
| Ga0207898_10174083 | 3300025049 | Marine | MRVSLMRKLWKEKVTVPLLHKQVDKTLRQIDVKLNNKRSKNNAGND |
| Ga0208012_10097476 | 3300025066 | Marine | MIVNLMRKLWKKKVQIPVLKKQSDKILREIHVKLKQQRRK |
| Ga0208920_10038904 | 3300025072 | Marine | MKVNLIRKLWKEKVQIPVLLKKADKTLKEVDVKLKRSKHNVR |
| Ga0208920_10091234 | 3300025072 | Marine | MIVNLMRKLWKEKVQIPVLEKRTDKILGKIHVKLKQQRRK |
| Ga0208668_10088373 | 3300025078 | Marine | MKVNLMRKLWKEKVQIPVLLKKADKTLEKINVKLKRSKHERNKRLD |
| Ga0208156_10017959 | 3300025082 | Marine | MKVNLMRKLWKEKVQIPVLLKKADKTLEKINVKLKRSKHERSKRLD |
| Ga0208156_10806622 | 3300025082 | Marine | MKVSLMRKLWKEKVQIPVLQKEVDKTLKKINVKLKRSKHERLERLD |
| Ga0208298_10011037 | 3300025084 | Marine | MRVSLMRKLWKQKVEVPVLEKEIDKILKAISVKLKKGVKYVREDKERS |
| Ga0208013_10012428 | 3300025103 | Marine | MRVSLMRKLWKEKVEVPALEKKIDKILKAIDVKLKERSKDVREN |
| Ga0209434_10308747 | 3300025122 | Marine | MKVSLIRKLWKQKVQIPVLQKQVDKTLEKINVKLQRRKHERLERLD |
| Ga0208299_10455834 | 3300025133 | Marine | MRVSLIRKLWKQKVEIPVLQKKVDKALKEIDVKLKRSKHNVR |
| Ga0209645_10028208 | 3300025151 | Marine | MKVSLMRKLWKQKVEVPVLESKIDKILKKIDVKLKERSKNVREN |
| Ga0209337_100047519 | 3300025168 | Marine | MKVNLMRKLWKEKVEVPVLKRKIDKILKVIDVKLKKRSKDVG |
| Ga0207894_10823433 | 3300025268 | Deep Ocean | MKVNLMRKLWKEKVQIPVLLKKADKTLKEVDVKLKRSKHNVR |
| Ga0208315_10107716 | 3300025286 | Deep Ocean | MRVSLIRKLWKQKVEIPVLLKKVDKNLKEIDVKLKRSKHNVR |
| Ga0208315_10132262 | 3300025286 | Deep Ocean | MKVNLMRKLWKEQVEIPALQKQVEKTLKKIYVKLKRSKHNVR |
| Ga0209657_10017152 | 3300025676 | Marine | MKVNLIRKLWKEKVEVPVLERKINKILKVIDVKLKRSKNVREN |
| Ga0209666_11303631 | 3300025870 | Marine | VDDMRVSLMRKLWKEKVEVPALEKKIEKILKAIDVKLKERSKDVREN |
| Ga0208560_10224062 | 3300026115 | Marine Oceanic | MRVSLMRKLWKEKVTVPVLLKQADKILGTIDVKLKKRSKNVR |
| Ga0208560_10250941 | 3300026115 | Marine Oceanic | MKVNLMRKLWKERVQIPVIKKQSDKILKKIYVKLKRRNVC |
| Ga0208560_10283512 | 3300026115 | Marine Oceanic | MRVSLIRKLWKEKVQVPVLLRKVDKTLKEVDVKLKRSKHVK |
| Ga0208640_10134163 | 3300026208 | Marine | MIVNLMQKLWKKKVQIPVLEKRTDKILRKIHVKLKQQRRK |
| Ga0207989_10049954 | 3300026209 | Marine | MRVSLMRKLWKEKVQIPALQKEVDKTLKKIDVKLKRSKHNVR |
| Ga0208409_10697823 | 3300026212 | Marine | MRVSLMRKLWKEKVQIPALQKQVDKTLKKINVKLKRSRHNVR |
| Ga0209482_10047188 | 3300027668 | Marine | MRVSLIKKLWKEKVEIPVLQRQVDKILKKAYVKLKRSNDVR |
| Ga0209091_104037273 | 3300027801 | Marine | MKVNLMRKLWKEKVTVPVLQKQVDKILGEIDVKLKKRRKNVR |
| Ga0209402_106367992 | 3300027847 | Marine | MKVNLMRKLWKEKVTVPVLQKQVDKILGEIDVKLKKRRKNVD |
| Ga0257111_11865891 | 3300028535 | Marine | MKVSLMRKLWKERVEIPVLQRKVDKTLKEINVKLKRSKHNVK |
| Ga0308021_101682743 | 3300031141 | Marine | MGEMRVSLIKKLWKEKVEIPVLQRQVDKILKKAYVKLKRSNDVR |
| Ga0307488_104373112 | 3300031519 | Sackhole Brine | MHRMDKMKVNLMRKLWKEKVEVPVLKRKIDKILKVIDVKLKKRSKDVR |
| Ga0307993_10217585 | 3300031602 | Marine | RMKVNLMRKLWKEKVEVPVLKRKIDKILKVIDVKLKKRSKDVG |
| Ga0302119_100058248 | 3300031606 | Marine | MRVSLIRKLWKEKVQIPVLLRQADKTLKKIDVKLKKEKKYVR |
| Ga0307994_10541422 | 3300031660 | Marine | MRVSLIKKLWKEKVEIPVLQRQVDKILKKAYVKLKRSNDV |
| Ga0308016_102687741 | 3300031695 | Marine | GEMRVSLIKKLWKEKVEIPVLQRQVDKILKKAYVKLKRSNDVR |
| Ga0302120_100746154 | 3300031701 | Marine | MKVNLISKLWKEKVEIPVLLKKVDKTLKKIDVKLKRSKNVK |
| Ga0315329_100802843 | 3300032048 | Seawater | MKVSLMRKLWKEKVTVPVLKKQTDKILGKIDVKLKKEKKYVR |
| Ga0315333_102468653 | 3300032130 | Seawater | MRVSLIRKLWKEQVQIPALQKQVDKTLRQIDVKLNNKRSKKL |
| Ga0310345_106132124 | 3300032278 | Seawater | MRVSLIRKLWKEKVEIPVLQKRVDKTLKEIDVKLKRSKHNVR |
| Ga0310345_112907243 | 3300032278 | Seawater | MRVSLIRKLWKERVQIPVLQRQVDKKLREIDVKLKRRKHNVK |
| Ga0310345_122434262 | 3300032278 | Seawater | VRVSLIRKLWKEKVQIPVLQKQVDKKLREIDVKLLKRSKYN |
| Ga0310342_1024742023 | 3300032820 | Seawater | VRVSLIRKLWKEKVQIPVLQKQVDKKLREIDVKLLKRSKYNVK |
| ⦗Top⦘ |