


| Basic Information | |
|---|---|
| Family ID | F077752 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MTFSFLDSRQLAVSLAGAFITSLLFVSAATSLPIA |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 80.34 % |
| % of genes near scaffold ends (potentially truncated) | 19.66 % |
| % of genes from short scaffolds (< 2000 bps) | 82.05 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.889 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere (18.803 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.299 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (40.171 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.86% β-sheet: 0.00% Coil/Unstructured: 57.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF04024 | PspC | 52.99 |
| PF13561 | adh_short_C2 | 16.24 |
| PF00664 | ABC_membrane | 6.84 |
| PF01553 | Acyltransferase | 5.13 |
| PF00578 | AhpC-TSA | 4.27 |
| PF13453 | zf-TFIIB | 2.56 |
| PF07715 | Plug | 1.71 |
| PF06035 | Peptidase_C93 | 1.71 |
| PF01189 | Methyltr_RsmB-F | 0.85 |
| PF03841 | SelA | 0.85 |
| PF08837 | DUF1810 | 0.85 |
| PF02325 | YGGT | 0.85 |
| PF00106 | adh_short | 0.85 |
| PF01435 | Peptidase_M48 | 0.85 |
| PF00005 | ABC_tran | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG3672 | Predicted transglutaminase-like protein | Posttranslational modification, protein turnover, chaperones [O] | 1.71 |
| COG0144 | 16S rRNA C967 or C1407 C5-methylase, RsmB/RsmF family | Translation, ribosomal structure and biogenesis [J] | 0.85 |
| COG0762 | Cytochrome b6 maturation protein CCB3/Ycf19 and related maturases, YggT family | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.85 |
| COG5579 | Uncharacterized conserved protein, DUF1810 family | Function unknown [S] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.89 % |
| Unclassified | root | N/A | 11.11 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig556147 | Not Available | 532 | Open in IMG/M |
| 2228664021|ICCgaii200_c0599050 | Not Available | 502 | Open in IMG/M |
| 3300000559|F14TC_101019546 | Not Available | 811 | Open in IMG/M |
| 3300000956|JGI10216J12902_101619635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 3438 | Open in IMG/M |
| 3300000956|JGI10216J12902_107132452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium | 1211 | Open in IMG/M |
| 3300000956|JGI10216J12902_110726337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → Sphingobium indicum | 737 | Open in IMG/M |
| 3300002074|JGI24748J21848_1046672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 560 | Open in IMG/M |
| 3300005293|Ga0065715_10153001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 1708 | Open in IMG/M |
| 3300005543|Ga0070672_100001248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 15651 | Open in IMG/M |
| 3300005543|Ga0070672_102066009 | Not Available | 513 | Open in IMG/M |
| 3300005548|Ga0070665_100603228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 1111 | Open in IMG/M |
| 3300005618|Ga0068864_100173396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 1968 | Open in IMG/M |
| 3300005719|Ga0068861_100553931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1048 | Open in IMG/M |
| 3300005844|Ga0068862_100232610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1673 | Open in IMG/M |
| 3300005844|Ga0068862_100628383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 1034 | Open in IMG/M |
| 3300006169|Ga0082029_1416956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 3511 | Open in IMG/M |
| 3300006755|Ga0079222_11092716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 699 | Open in IMG/M |
| 3300006845|Ga0075421_100003729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 18292 | Open in IMG/M |
| 3300006846|Ga0075430_101528573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 548 | Open in IMG/M |
| 3300006865|Ga0073934_10000092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 258329 | Open in IMG/M |
| 3300006865|Ga0073934_10217020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 1285 | Open in IMG/M |
| 3300006969|Ga0075419_11315085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 537 | Open in IMG/M |
| 3300007004|Ga0079218_11063059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 820 | Open in IMG/M |
| 3300007004|Ga0079218_11773809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 689 | Open in IMG/M |
| 3300009094|Ga0111539_10524435 | Not Available | 1380 | Open in IMG/M |
| 3300009095|Ga0079224_103533395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 622 | Open in IMG/M |
| 3300009100|Ga0075418_11590862 | Not Available | 710 | Open in IMG/M |
| 3300009147|Ga0114129_10718928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 1282 | Open in IMG/M |
| 3300009153|Ga0105094_10298786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 927 | Open in IMG/M |
| 3300009156|Ga0111538_10084756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 4032 | Open in IMG/M |
| 3300009156|Ga0111538_10780220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 1210 | Open in IMG/M |
| 3300009162|Ga0075423_10386388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 1469 | Open in IMG/M |
| 3300009162|Ga0075423_12031124 | Not Available | 623 | Open in IMG/M |
| 3300009174|Ga0105241_10440772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 1150 | Open in IMG/M |
| 3300009610|Ga0105340_1216894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 810 | Open in IMG/M |
| 3300009610|Ga0105340_1501277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 543 | Open in IMG/M |
| 3300009840|Ga0126313_11275775 | Not Available | 607 | Open in IMG/M |
| 3300009840|Ga0126313_11334946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 593 | Open in IMG/M |
| 3300010037|Ga0126304_11216937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Caenibius → Caenibius tardaugens → Caenibius tardaugens NBRC 16725 | 517 | Open in IMG/M |
| 3300010364|Ga0134066_10149746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 732 | Open in IMG/M |
| 3300011333|Ga0127502_11143629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 648 | Open in IMG/M |
| 3300011333|Ga0127502_11358582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 554 | Open in IMG/M |
| 3300011993|Ga0120182_1000480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 1443 | Open in IMG/M |
| 3300012022|Ga0120191_10068338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Caenibius → Caenibius tardaugens → Caenibius tardaugens NBRC 16725 | 665 | Open in IMG/M |
| 3300012043|Ga0136631_10206063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium resinovorum | 769 | Open in IMG/M |
| 3300012469|Ga0150984_122179375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 835 | Open in IMG/M |
| 3300012984|Ga0164309_10128766 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1649 | Open in IMG/M |
| 3300014326|Ga0157380_10023442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 4655 | Open in IMG/M |
| 3300014326|Ga0157380_10489689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 1191 | Open in IMG/M |
| 3300015371|Ga0132258_10372754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 3537 | Open in IMG/M |
| 3300017792|Ga0163161_11091025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 686 | Open in IMG/M |
| 3300018067|Ga0184611_1090118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1058 | Open in IMG/M |
| 3300018072|Ga0184635_10204369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 787 | Open in IMG/M |
| 3300018081|Ga0184625_10345115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 774 | Open in IMG/M |
| 3300018429|Ga0190272_11911590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 624 | Open in IMG/M |
| 3300018465|Ga0190269_10120817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1313 | Open in IMG/M |
| 3300018465|Ga0190269_10920982 | Not Available | 648 | Open in IMG/M |
| 3300018476|Ga0190274_10123125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 2124 | Open in IMG/M |
| 3300018476|Ga0190274_10431975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1290 | Open in IMG/M |
| 3300018476|Ga0190274_12498157 | Not Available | 614 | Open in IMG/M |
| 3300018476|Ga0190274_12552844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 608 | Open in IMG/M |
| 3300018481|Ga0190271_10221776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 1902 | Open in IMG/M |
| 3300019356|Ga0173481_10851292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Caenibius → Caenibius tardaugens → Caenibius tardaugens NBRC 16725 | 509 | Open in IMG/M |
| 3300025310|Ga0209172_10002179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 36188 | Open in IMG/M |
| 3300025310|Ga0209172_10156663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 1241 | Open in IMG/M |
| 3300025901|Ga0207688_10031444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 2930 | Open in IMG/M |
| 3300025911|Ga0207654_10424389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 928 | Open in IMG/M |
| 3300025912|Ga0207707_10121768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 2281 | Open in IMG/M |
| 3300025923|Ga0207681_10253369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1375 | Open in IMG/M |
| 3300025930|Ga0207701_10281472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 1447 | Open in IMG/M |
| 3300025932|Ga0207690_10852413 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300025972|Ga0207668_11353283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 641 | Open in IMG/M |
| 3300026095|Ga0207676_10450448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1213 | Open in IMG/M |
| 3300027036|Ga0207467_1002508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 1244 | Open in IMG/M |
| 3300027364|Ga0209967_1030495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 806 | Open in IMG/M |
| 3300027543|Ga0209999_1056369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 745 | Open in IMG/M |
| 3300027665|Ga0209983_1004495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2929 | Open in IMG/M |
| 3300027907|Ga0207428_10149512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 1778 | Open in IMG/M |
| 3300027909|Ga0209382_10001372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 38534 | Open in IMG/M |
| 3300028040|Ga0247704_1017043 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300028379|Ga0268266_10544908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 1111 | Open in IMG/M |
| 3300028608|Ga0247819_10039475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 2200 | Open in IMG/M |
| 3300028608|Ga0247819_10217624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1035 | Open in IMG/M |
| 3300030499|Ga0268259_10114355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 615 | Open in IMG/M |
| 3300031477|Ga0314812_102998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 1216 | Open in IMG/M |
| 3300031479|Ga0314809_11830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 1187 | Open in IMG/M |
| 3300031548|Ga0307408_100040594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 3295 | Open in IMG/M |
| 3300031548|Ga0307408_100049135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 3028 | Open in IMG/M |
| 3300031548|Ga0307408_100178481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1701 | Open in IMG/M |
| 3300031548|Ga0307408_100674606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 926 | Open in IMG/M |
| 3300031548|Ga0307408_100836280 | Not Available | 838 | Open in IMG/M |
| 3300031548|Ga0307408_100908362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 806 | Open in IMG/M |
| 3300031548|Ga0307408_101444579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 649 | Open in IMG/M |
| 3300031731|Ga0307405_10198794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1454 | Open in IMG/M |
| 3300031824|Ga0307413_10023647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 3333 | Open in IMG/M |
| 3300031824|Ga0307413_10215362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1398 | Open in IMG/M |
| 3300031852|Ga0307410_10049945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 2810 | Open in IMG/M |
| 3300031852|Ga0307410_10658098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 879 | Open in IMG/M |
| 3300031854|Ga0310904_10213606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1171 | Open in IMG/M |
| 3300031903|Ga0307407_10253565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. AX6 | 1207 | Open in IMG/M |
| 3300031911|Ga0307412_11257881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 665 | Open in IMG/M |
| 3300031943|Ga0310885_10255014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium resinovorum | 890 | Open in IMG/M |
| 3300031995|Ga0307409_102677802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Caenibius → Caenibius tardaugens → Caenibius tardaugens NBRC 16725 | 527 | Open in IMG/M |
| 3300032004|Ga0307414_10036186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 3293 | Open in IMG/M |
| 3300032004|Ga0307414_10300267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1358 | Open in IMG/M |
| 3300032004|Ga0307414_10414534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1173 | Open in IMG/M |
| 3300032004|Ga0307414_10513954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 1062 | Open in IMG/M |
| 3300032004|Ga0307414_10731240 | Not Available | 898 | Open in IMG/M |
| 3300032005|Ga0307411_11048489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 732 | Open in IMG/M |
| 3300032012|Ga0310902_10759817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 657 | Open in IMG/M |
| 3300032013|Ga0310906_10731785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 693 | Open in IMG/M |
| 3300032017|Ga0310899_10116665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1100 | Open in IMG/M |
| 3300032075|Ga0310890_10671850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 809 | Open in IMG/M |
| 3300032126|Ga0307415_102278040 | Not Available | 531 | Open in IMG/M |
| 3300032211|Ga0310896_10306870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 822 | Open in IMG/M |
| 3300033412|Ga0310810_10165519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 2550 | Open in IMG/M |
| 3300033419|Ga0316601_101933398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 595 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 18.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.26% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 7.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.27% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 3.42% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 3.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.42% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.56% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.56% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.56% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.71% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 1.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.71% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.85% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.85% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.85% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.85% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.85% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009095 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011993 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep1 | Environmental | Open in IMG/M |
| 3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
| 3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027036 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G07A5-10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028040 | Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 4-1-W_N | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300030499 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2) | Host-Associated | Open in IMG/M |
| 3300031477 | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - STER_R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031479 | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - STER_N_R6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_00670690 | 2124908045 | Soil | MFYSSIDPRQLVVSLTGALFTSLLFVSAATSLPIA |
| ICCgaii200_05990502 | 2228664021 | Soil | MSFSFLDTRQLAVSLAGAFITSLLFVSAATSLPIA |
| F14TC_1010195463 | 3300000559 | Soil | MTFSFLDTRQLAVSVAGAFITXLLFVSAATSLPIA* |
| JGI10216J12902_1016196354 | 3300000956 | Soil | MTFSFLDSRQLAVSLAGAFITSLLFVSAAASLPIA* |
| JGI10216J12902_1071324522 | 3300000956 | Soil | MTFSFLETRQLATSLAAALITSLLFVSAATSLPIA* |
| JGI10216J12902_1107263372 | 3300000956 | Soil | MTFSFVDARQLAVSLAGAFVTSLLFISAAGSLPIA* |
| JGI24748J21848_10466721 | 3300002074 | Corn, Switchgrass And Miscanthus Rhizosphere | KKGVFEMTYSFLDGRQLAVSLAGAFITSLLFVSAATSLPIA* |
| Ga0065715_101530015 | 3300005293 | Miscanthus Rhizosphere | SKKGVFEMTFSFVDSRQIATSLAAALITSLLFVSAATSLPIA* |
| Ga0070672_1000012484 | 3300005543 | Miscanthus Rhizosphere | MTYSFLDGRQLAVSLAGAFITSLLFVSAATSLPIA* |
| Ga0070672_1020660092 | 3300005543 | Miscanthus Rhizosphere | MTYTIIDTRQLVLSIAGALFTSLIFVSAATSLPIV* |
| Ga0070665_1006032282 | 3300005548 | Switchgrass Rhizosphere | MTYSFLDSRQLAASLAGAFITSLLFVSAATSLPIA* |
| Ga0068864_1001733965 | 3300005618 | Switchgrass Rhizosphere | MTFSNLDTRQLAVSFAGAFITSLLFVSAATSLPIA* |
| Ga0068861_1005539312 | 3300005719 | Switchgrass Rhizosphere | MSFSFIDPRQLVVTLGGALFMSLLFVSAATSLPLA* |
| Ga0068862_1002326102 | 3300005844 | Switchgrass Rhizosphere | MTFSFVDSRQLAVSLAGAFITSLLFVSAATSLPIA* |
| Ga0068862_1006283833 | 3300005844 | Switchgrass Rhizosphere | MTFSFLESRQLAASLAGAFLTSLLFVSAATSLPIA* |
| Ga0082029_14169565 | 3300006169 | Termite Nest | MTFSFVDTRQLVVSLGAALITSLMFVSAATSLPIA* |
| Ga0079222_110927163 | 3300006755 | Agricultural Soil | MTFSFLDTRQLATSLAAALITSLLFVSAATSLPIA* |
| Ga0075421_10000372927 | 3300006845 | Populus Rhizosphere | MTFSFVDSRQLIVSLAGAFITSLLFVSAATSLPIA* |
| Ga0075430_1015285732 | 3300006846 | Populus Rhizosphere | MTFSFLESRQLVVSLAGAFITSLLFVSAATSLPIA* |
| Ga0073934_10000092131 | 3300006865 | Hot Spring Sediment | MTFSFVDSRHIAASLAGAFITSLLFISAAASLPIA* |
| Ga0073934_102170202 | 3300006865 | Hot Spring Sediment | MTFSFVDSRQLVASLAGAFITSLLFVSAATSLPIA* |
| Ga0075419_113150852 | 3300006969 | Populus Rhizosphere | MTFSFLDSRQLAVSLAGAFITSLLFISAATSLPIA* |
| Ga0079218_110630593 | 3300007004 | Agricultural Soil | MFYSSIDPRQLVVSLTGALFTSLLFVSAATSLPIA* |
| Ga0079218_117738092 | 3300007004 | Agricultural Soil | MTFSFVDSRQLAVSLAGAFITSLLFISAAGSVSIA* |
| Ga0111539_105244353 | 3300009094 | Populus Rhizosphere | MFSFVDTRQIAVSLAGAFITSLLFVSAATSLPIA* |
| Ga0079224_1035333952 | 3300009095 | Agricultural Soil | MSFSFIDPRQLVISLAGALFTSLMLVSATASLPIA* |
| Ga0075418_115908622 | 3300009100 | Populus Rhizosphere | MTFSFLDSRQLAVSLAGAFITSLLFVSAATSLPIA* |
| Ga0114129_107189281 | 3300009147 | Populus Rhizosphere | MTFSFVDTRQLAVSLAGAFITSMLFISAATSLPIA* |
| Ga0105094_102987864 | 3300009153 | Freshwater Sediment | MTFSFVESRQLAASLAGAFITSLLFVSAATSLPIA* |
| Ga0111538_100847561 | 3300009156 | Populus Rhizosphere | MTYSFLDGRQLAVSLAGAFVTSLLFVSAATSLPIA* |
| Ga0111538_107802204 | 3300009156 | Populus Rhizosphere | MFFSFIETRQIAVSLAGALITSLLFVSAATSLPIA* |
| Ga0075423_103863882 | 3300009162 | Populus Rhizosphere | MTNSLLDVRQLAVSLAGAFITSLLFVSAATSMPIA* |
| Ga0075423_120311241 | 3300009162 | Populus Rhizosphere | MTFSFVDSRQLAVSLAGAFVTSLLFVSAATSLPLA* |
| Ga0105241_104407723 | 3300009174 | Corn Rhizosphere | MTNSLLDVRQLAVSLAGAFITSLLFVSAATSLPIA* |
| Ga0105340_12168943 | 3300009610 | Soil | MTFSFIETRQLYVSLAAALITSLLFVSAATSLPIA* |
| Ga0105340_15012772 | 3300009610 | Soil | MSFSFIDPRQLVITLGGALFTSLLFVSAATSLPLA* |
| Ga0126313_112757752 | 3300009840 | Serpentine Soil | MTFSFVDSRQLAVSLAGAFVTSMLFISAAASLPIA* |
| Ga0126313_113349461 | 3300009840 | Serpentine Soil | MTYSFLDTRQLAASLAGAFITSILFVSAATSLSIA* |
| Ga0126304_112169372 | 3300010037 | Serpentine Soil | MTFSFLDTRQLAVSLTGAFITSVLFVSAATSLPIA* |
| Ga0134066_101497462 | 3300010364 | Grasslands Soil | MSFSFVDSRQLAVSLAGAFITSLLFVSAATSLPIA* |
| Ga0127502_111436291 | 3300011333 | Soil | RLKMTYSSIDPRQLVVSLAGAMFTSLLFISAAGSLPIA* |
| Ga0127502_113585823 | 3300011333 | Soil | IEMTFSFLDNRQLASSLAAALITSLQFVSAATSLPIA* |
| Ga0120182_10004802 | 3300011993 | Terrestrial | MTFSFLDSRQLAVSLAGAFVTSMLFVSAATSLPIA* |
| Ga0120191_100683382 | 3300012022 | Terrestrial | MTFSFLDSRQLAVSLAGAFVTSLLFVSAATSLPIA* |
| Ga0136631_102060631 | 3300012043 | Polar Desert Sand | MTFSFLDSRQLAVSFAGAFLTAMLFVSAAIGPLPIV* |
| Ga0150984_1221793751 | 3300012469 | Avena Fatua Rhizosphere | KGSIQMSFSFLDSRQLAVSLAGAFITSLLFVSAATSLPIA* |
| Ga0164309_101287661 | 3300012984 | Soil | MTFSFVDTRQLAASLAGAFVTSLLFVSAAVGPLPIF* |
| Ga0157380_100234424 | 3300014326 | Switchgrass Rhizosphere | MTFSFLDSRQIAASLAGAFVTSLLFVSAATSLPIA* |
| Ga0157380_104896894 | 3300014326 | Switchgrass Rhizosphere | VRKREYLEMTFSFVDSRQIATSLAAALITSLLFVSAATSLPIA* |
| Ga0132258_103727544 | 3300015371 | Arabidopsis Rhizosphere | MTFSFLDSRQIAVSLAGAFITSLLFVSAATSLPIA* |
| Ga0163161_110910252 | 3300017792 | Switchgrass Rhizosphere | MTYTIIDTRQLVLSIAGALFTSLIFVSAATSLPIV |
| Ga0184611_10901182 | 3300018067 | Groundwater Sediment | MSFSFIDPRQLVITLGGALFTSLMFISAATSLPLA |
| Ga0184635_102043692 | 3300018072 | Groundwater Sediment | MTFSFLETRQLATSLAAALITSLLFVSAATSLPIA |
| Ga0184625_103451151 | 3300018081 | Groundwater Sediment | MTFSFVDSRQLAVSLAGAFITSLLFVSAATSLPIA |
| Ga0190272_119115902 | 3300018429 | Soil | MSFSFLDSRQLAVSLAGAFVTSLLFVSAATSLPIA |
| Ga0190269_101208174 | 3300018465 | Soil | MTFSFVDSRHIAASLAGAFITSLLFISAATSLPIA |
| Ga0190269_109209821 | 3300018465 | Soil | MTFSFLDSRQLAVSRAGAFITSMLFVSAATSLPIA |
| Ga0190274_101231254 | 3300018476 | Soil | MTFSFLDSRQLAVSLAGAFITSLLFVSAATSLPIA |
| Ga0190274_104319752 | 3300018476 | Soil | MTFSFLDTRQLATSLAGALITSLLFISAATSLPIA |
| Ga0190274_124981571 | 3300018476 | Soil | MTFSFIETRQLYVSLAAALVTSLLFVSAATSLPIA |
| Ga0190274_125528441 | 3300018476 | Soil | MSFSFIDPRQLVITLGGALFASLMFISAATSLPLA |
| Ga0190271_102217761 | 3300018481 | Soil | MTFSFVDSRQIATSLAAALITSLLFVSAATSLPIA |
| Ga0173481_108512922 | 3300019356 | Soil | MTFSFVDSRQLAVSLAGAFVTSLLFVSAATSLPLA |
| Ga0209172_1000217927 | 3300025310 | Hot Spring Sediment | MTFSFVDSRHIAASLAGAFITSLLFISAAASLPIA |
| Ga0209172_101566632 | 3300025310 | Hot Spring Sediment | MTFSFVDSRQLVASLAGAFITSLLFVSAATSLPIA |
| Ga0207688_100314443 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MTYSFLDGRQLAVSLAGAFITSLLFVSAATSLPIA |
| Ga0207654_104243892 | 3300025911 | Corn Rhizosphere | MTNSLLDVRQLAVSLAGAFITSLLFVSAATSLPIA |
| Ga0207707_101217682 | 3300025912 | Corn Rhizosphere | MTFSFVDTRQLAVSLAAALFTSLVFVSAATSLPIA |
| Ga0207681_102533693 | 3300025923 | Switchgrass Rhizosphere | MSFSFIDPRQLVVTLGGALFMSLLFVSAATSLPLA |
| Ga0207701_102814722 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MFFSFIETRQIAVSLAGALITSLLFVSAATSLPIA |
| Ga0207690_108524134 | 3300025932 | Corn Rhizosphere | GSKKGVFEMTYSFLDGRQLAVSLAGAFITSLLFVSAATSLPIA |
| Ga0207668_113532833 | 3300025972 | Switchgrass Rhizosphere | MTFSFLDSRQVAVSLAGAFITSLLFVSAATSLPIA |
| Ga0207676_104504481 | 3300026095 | Switchgrass Rhizosphere | MTFSNLDTRQLAVSFAGAFITSLLFVSAATSLPIA |
| Ga0207467_10025081 | 3300027036 | Soil | GSPKGRYQMTFSFIDSRQLAVSLAGAFITSLLFVSAATSLPIA |
| Ga0209967_10304953 | 3300027364 | Arabidopsis Thaliana Rhizosphere | MLFSFVDPRQLVVTLVGALFTSFIVVSAATSLPIA |
| Ga0209999_10563691 | 3300027543 | Arabidopsis Thaliana Rhizosphere | MTYSFLDTRQLAVSLAGAFITSLLFVSAATSLSIA |
| Ga0209983_10044952 | 3300027665 | Arabidopsis Thaliana Rhizosphere | MTYSFLDARQLAVSLAGAFITSLLFVSAATSLSIA |
| Ga0207428_101495122 | 3300027907 | Populus Rhizosphere | MFFSFVDTRQIAVSLAGAFITSLLFVSAATSLPIA |
| Ga0209382_1000137213 | 3300027909 | Populus Rhizosphere | MTFSFVDSRQLIVSLAGAFITSLLFVSAATSLPIA |
| Ga0247704_10170432 | 3300028040 | Soil | MPYSSIDPRQLFVSLTGALFTSLLLVSAATSLPIA |
| Ga0268266_105449082 | 3300028379 | Switchgrass Rhizosphere | MTYSFLDSRQLAASLAGAFITSLLFVSAATSLPIA |
| Ga0247819_100394751 | 3300028608 | Soil | LKKGVFEMTYSFLDGRQLAVSLAGAFITSLLFVSAATSLPIA |
| Ga0247819_102176241 | 3300028608 | Soil | MSFSFIDPRQLVITLGGALFTSLLFVSAATSLPLA |
| Ga0268259_101143551 | 3300030499 | Agave | MTNSLLDVRQLAVSLAGAFITSMLFVSAATSLPIA |
| Ga0314812_1029984 | 3300031477 | Soil | FEKGRFEMTFSFVDSRQIATSLAAALITSLLFVSAATSLPIA |
| Ga0314809_118301 | 3300031479 | Soil | EKGRFEMTFSFVDSRQIATSLAAALITSLLFVSAATSLPIA |
| Ga0307408_1000405945 | 3300031548 | Rhizosphere | MTFSFLDTRQLAVSLAGAFITSLLFVSAATSLSIA |
| Ga0307408_1000491354 | 3300031548 | Rhizosphere | MFYSSIDPRQLVVSLTGALFTSLLFVSAATSLPIV |
| Ga0307408_1001784813 | 3300031548 | Rhizosphere | MTYSFLDTRQLAVSLAGAFVTAMLFVSAATSLPIA |
| Ga0307408_1006746061 | 3300031548 | Rhizosphere | KGSNTMFYSSIDPRQLVVSLTGALFTSLLFVSAATSLPIV |
| Ga0307408_1008362801 | 3300031548 | Rhizosphere | MTFSFLDSRQLAVSLAGAFITSLLFVSAATSLSIA |
| Ga0307408_1009083622 | 3300031548 | Rhizosphere | MTFSFVDSRQLAVSLAGAFITSMLFVSAATSLPLA |
| Ga0307408_1014445792 | 3300031548 | Rhizosphere | MTFSFVDSRQLAVSLAGAFITSLLFISAAGSVSIA |
| Ga0307405_101987942 | 3300031731 | Rhizosphere | MTFSFVDSRQLAVSLAGAFITSLLFISAATSLPIA |
| Ga0307413_100236471 | 3300031824 | Rhizosphere | KMTFSFLDSRQLAVSLAGAFITSLLFVSAATSLPIA |
| Ga0307413_102153623 | 3300031824 | Rhizosphere | MTYSFLDTRQLAVSLAGAFITAMLFVSAATSLPIA |
| Ga0307410_100499452 | 3300031852 | Rhizosphere | MTYSFLDTRQLAVSLAGAFVTSLLFVSAAIGPLPIA |
| Ga0307410_106580984 | 3300031852 | Rhizosphere | KGVSKMTFSFLDSRQLAVSLAGAFITSLLFVSAATSLPIA |
| Ga0310904_102136062 | 3300031854 | Soil | MTFSFVDARQLAVSLAAALFTSLVFVSAATSLPIA |
| Ga0307407_102535651 | 3300031903 | Rhizosphere | MTYSFLDTRQLAASLAGAFITSILFVSAATSLSIA |
| Ga0307412_112578813 | 3300031911 | Rhizosphere | GRYQMTYSFLDTRQLAVSLAGAFVTSLLFVSAAIGPLPIA |
| Ga0310885_102550141 | 3300031943 | Soil | MTFSFLDSRQIIGSLAGAFVTSLLFVSAATSLPIA |
| Ga0307409_1026778021 | 3300031995 | Rhizosphere | MTFSFLDSRQLAVSLAGAFITAMLFVSAATSLPIA |
| Ga0307414_100361861 | 3300032004 | Rhizosphere | GDTKMTFSFLDSRQLAVSLAGAFITSLLFVSAATSLPIA |
| Ga0307414_103002671 | 3300032004 | Rhizosphere | KMTFSFLDSRQLAVSLAGAFITSLLFVSAATSLSIA |
| Ga0307414_104145345 | 3300032004 | Rhizosphere | MSFSFVDTRQLAVSLAGAFVTSLLFVSAATSLPIA |
| Ga0307414_105139542 | 3300032004 | Rhizosphere | MTYSFLDTRQLAVSLAGAFITSLLFVSAATSLPLA |
| Ga0307414_107312404 | 3300032004 | Rhizosphere | MTFSFVDNRQLAVSLAGAFITSLLFISAAGSLPIA |
| Ga0307411_110484894 | 3300032005 | Rhizosphere | QKGRYQMTYSFLDTRQLAVSLAGAFVTSLLFVSAAIGPLPIA |
| Ga0310902_107598171 | 3300032012 | Soil | VQKGRCKMTFSFLDTRQLAVSLAGAFITSLLFVSAATSLSIA |
| Ga0310906_107317854 | 3300032013 | Soil | NKMTFSFVDTRQLAVSLAAALFTSLVFVSAATSLPIA |
| Ga0310899_101166651 | 3300032017 | Soil | MSFSIIDPRQLVVTLGGALFMSLLFVSAATSLPLA |
| Ga0310890_106718502 | 3300032075 | Soil | MTFSFLDSRQVAASLAGAFITSLLFVSAATSLPIA |
| Ga0307415_1022780401 | 3300032126 | Rhizosphere | MTYSFLDSRQLAASLAGAFITSLLFVSAATSLPLA |
| Ga0310896_103068704 | 3300032211 | Soil | KMTFSFVDTRQLAVSLAAALFTSLVFVSAATSLPIA |
| Ga0310810_101655193 | 3300033412 | Soil | MTMTNLDTRALAVSLAGAFITSLLFVSAAIGPLQFA |
| Ga0316601_1019333982 | 3300033419 | Soil | MTFSFVDSRQLAASLAGAFITSLLFVSAATSLPIA |
| ⦗Top⦘ |