


| Basic Information | |
|---|---|
| Family ID | F077743 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 42 residues |
| Representative Sequence | RGYPEEQVHKELYWPKGKEPRGVAGADLAAAIDAAEANADQ |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.56 % |
| % of genes near scaffold ends (potentially truncated) | 94.87 % |
| % of genes from short scaffolds (< 2000 bps) | 93.16 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.085 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (23.932 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.752 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.009 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.99% β-sheet: 0.00% Coil/Unstructured: 71.01% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF06736 | TMEM175 | 11.11 |
| PF01035 | DNA_binding_1 | 5.98 |
| PF03129 | HGTP_anticodon | 5.13 |
| PF07676 | PD40 | 5.13 |
| PF12006 | DUF3500 | 4.27 |
| PF01266 | DAO | 3.42 |
| PF07040 | DUF1326 | 3.42 |
| PF08281 | Sigma70_r4_2 | 2.56 |
| PF02525 | Flavodoxin_2 | 2.56 |
| PF04542 | Sigma70_r2 | 1.71 |
| PF00892 | EamA | 1.71 |
| PF00970 | FAD_binding_6 | 1.71 |
| PF12706 | Lactamase_B_2 | 1.71 |
| PF12847 | Methyltransf_18 | 0.85 |
| PF13191 | AAA_16 | 0.85 |
| PF04689 | S1FA | 0.85 |
| PF04041 | Glyco_hydro_130 | 0.85 |
| PF00196 | GerE | 0.85 |
| PF00440 | TetR_N | 0.85 |
| PF10313 | DUF2415 | 0.85 |
| PF03018 | Dirigent | 0.85 |
| PF01061 | ABC2_membrane | 0.85 |
| PF01479 | S4 | 0.85 |
| PF13560 | HTH_31 | 0.85 |
| PF03577 | Peptidase_C69 | 0.85 |
| PF01872 | RibD_C | 0.85 |
| PF09851 | SHOCT | 0.85 |
| PF12697 | Abhydrolase_6 | 0.85 |
| PF13205 | Big_5 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 11.11 |
| COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 5.98 |
| COG3695 | Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain | Transcription [K] | 5.98 |
| COG0124 | Histidyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 5.13 |
| COG0423 | Glycyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 5.13 |
| COG0441 | Threonyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 5.13 |
| COG0442 | Prolyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 5.13 |
| COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 3.42 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.71 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 1.71 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.71 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 1.71 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.85 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.85 |
| COG2152 | Predicted glycosyl hydrolase, GH43/DUF377 family | Carbohydrate transport and metabolism [G] | 0.85 |
| COG4690 | Dipeptidase | Amino acid transport and metabolism [E] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.09 % |
| Unclassified | root | N/A | 29.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000574|JGI1357J11328_10206956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 527 | Open in IMG/M |
| 3300000880|AL20A1W_1347166 | Not Available | 500 | Open in IMG/M |
| 3300000956|JGI10216J12902_100314483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1952 | Open in IMG/M |
| 3300000956|JGI10216J12902_101531476 | Not Available | 982 | Open in IMG/M |
| 3300000956|JGI10216J12902_102292658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2158 | Open in IMG/M |
| 3300000956|JGI10216J12902_103854999 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300000956|JGI10216J12902_111514131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 513 | Open in IMG/M |
| 3300000956|JGI10216J12902_112625422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 720 | Open in IMG/M |
| 3300000956|JGI10216J12902_114760367 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300000956|JGI10216J12902_115659492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. | 2060 | Open in IMG/M |
| 3300000956|JGI10216J12902_117654791 | Not Available | 608 | Open in IMG/M |
| 3300000956|JGI10216J12902_118211349 | Not Available | 1374 | Open in IMG/M |
| 3300000956|JGI10216J12902_124942887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 519 | Open in IMG/M |
| 3300002568|C688J35102_117911282 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 515 | Open in IMG/M |
| 3300004081|Ga0063454_101327141 | Not Available | 604 | Open in IMG/M |
| 3300004114|Ga0062593_100615925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1039 | Open in IMG/M |
| 3300004156|Ga0062589_100770860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 866 | Open in IMG/M |
| 3300004479|Ga0062595_100116699 | All Organisms → cellular organisms → Bacteria | 1465 | Open in IMG/M |
| 3300004479|Ga0062595_102522592 | Not Available | 513 | Open in IMG/M |
| 3300005093|Ga0062594_100662124 | Not Available | 932 | Open in IMG/M |
| 3300005334|Ga0068869_101159606 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300005341|Ga0070691_11104186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 500 | Open in IMG/M |
| 3300005455|Ga0070663_101342203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 632 | Open in IMG/M |
| 3300005539|Ga0068853_100443118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter xylanophilus | 1221 | Open in IMG/M |
| 3300005543|Ga0070672_100240261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1523 | Open in IMG/M |
| 3300005545|Ga0070695_100142526 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
| 3300005764|Ga0066903_100934972 | All Organisms → cellular organisms → Bacteria | 1574 | Open in IMG/M |
| 3300005834|Ga0068851_10611754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 664 | Open in IMG/M |
| 3300005844|Ga0068862_102233726 | Not Available | 559 | Open in IMG/M |
| 3300005985|Ga0081539_10008755 | All Organisms → cellular organisms → Bacteria | 8687 | Open in IMG/M |
| 3300006046|Ga0066652_100018163 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4762 | Open in IMG/M |
| 3300006046|Ga0066652_100848558 | Not Available | 873 | Open in IMG/M |
| 3300006169|Ga0082029_1778666 | Not Available | 1320 | Open in IMG/M |
| 3300006358|Ga0068871_101828077 | Not Available | 577 | Open in IMG/M |
| 3300006358|Ga0068871_101998882 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300006581|Ga0074048_12869136 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300006845|Ga0075421_102639456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 520 | Open in IMG/M |
| 3300006852|Ga0075433_11237953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 647 | Open in IMG/M |
| 3300006953|Ga0074063_13668071 | Not Available | 607 | Open in IMG/M |
| 3300006954|Ga0079219_12224722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 528 | Open in IMG/M |
| 3300009011|Ga0105251_10544971 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300009012|Ga0066710_101456645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1059 | Open in IMG/M |
| 3300009012|Ga0066710_102833460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 684 | Open in IMG/M |
| 3300009094|Ga0111539_10451317 | Not Available | 1497 | Open in IMG/M |
| 3300009098|Ga0105245_10328488 | All Organisms → cellular organisms → Bacteria | 1509 | Open in IMG/M |
| 3300009098|Ga0105245_11745470 | Not Available | 675 | Open in IMG/M |
| 3300009100|Ga0075418_11502511 | Not Available | 731 | Open in IMG/M |
| 3300009177|Ga0105248_10140220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2727 | Open in IMG/M |
| 3300010036|Ga0126305_10420062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 884 | Open in IMG/M |
| 3300010039|Ga0126309_11278602 | Not Available | 507 | Open in IMG/M |
| 3300010397|Ga0134124_10305065 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
| 3300010397|Ga0134124_11852856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 638 | Open in IMG/M |
| 3300010401|Ga0134121_12142901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 595 | Open in IMG/M |
| 3300010403|Ga0134123_12301761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 602 | Open in IMG/M |
| 3300012203|Ga0137399_10116635 | All Organisms → cellular organisms → Bacteria | 2091 | Open in IMG/M |
| 3300012895|Ga0157309_10319994 | Not Available | 530 | Open in IMG/M |
| 3300012902|Ga0157291_10088012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 821 | Open in IMG/M |
| 3300012907|Ga0157283_10195224 | Not Available | 634 | Open in IMG/M |
| 3300012914|Ga0157297_10285060 | Not Available | 614 | Open in IMG/M |
| 3300012924|Ga0137413_11600752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
| 3300012961|Ga0164302_11444026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 564 | Open in IMG/M |
| 3300012985|Ga0164308_10610754 | Not Available | 929 | Open in IMG/M |
| 3300012986|Ga0164304_10291043 | Not Available | 1115 | Open in IMG/M |
| 3300012988|Ga0164306_11796670 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300013772|Ga0120158_10362829 | Not Available | 677 | Open in IMG/M |
| 3300013832|Ga0120132_1149603 | Not Available | 511 | Open in IMG/M |
| 3300014326|Ga0157380_10041542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 3589 | Open in IMG/M |
| 3300015371|Ga0132258_12074329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1429 | Open in IMG/M |
| 3300015372|Ga0132256_102139040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 665 | Open in IMG/M |
| 3300017792|Ga0163161_11674651 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300017965|Ga0190266_10941766 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300017974|Ga0187777_10674090 | Not Available | 732 | Open in IMG/M |
| 3300018053|Ga0184626_10378081 | Not Available | 571 | Open in IMG/M |
| 3300018066|Ga0184617_1222287 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300018422|Ga0190265_10723796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1117 | Open in IMG/M |
| 3300018429|Ga0190272_12232331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 588 | Open in IMG/M |
| 3300018432|Ga0190275_12631657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 580 | Open in IMG/M |
| 3300018432|Ga0190275_13458713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 511 | Open in IMG/M |
| 3300018466|Ga0190268_12097882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 524 | Open in IMG/M |
| 3300018476|Ga0190274_10930714 | Not Available | 938 | Open in IMG/M |
| 3300018476|Ga0190274_12750459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 589 | Open in IMG/M |
| 3300018481|Ga0190271_12184294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 660 | Open in IMG/M |
| 3300019767|Ga0190267_11113644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 568 | Open in IMG/M |
| 3300021972|Ga0193737_1044500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → Jiangella alba | 638 | Open in IMG/M |
| 3300025915|Ga0207693_10552156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 898 | Open in IMG/M |
| 3300025925|Ga0207650_10511548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1004 | Open in IMG/M |
| 3300025925|Ga0207650_11668698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
| 3300025935|Ga0207709_10180221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1491 | Open in IMG/M |
| 3300025937|Ga0207669_10042227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2660 | Open in IMG/M |
| 3300025940|Ga0207691_11582626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 533 | Open in IMG/M |
| 3300025944|Ga0207661_10348229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1336 | Open in IMG/M |
| 3300025960|Ga0207651_11129387 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300025961|Ga0207712_11575162 | Not Available | 589 | Open in IMG/M |
| 3300026118|Ga0207675_100470388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1248 | Open in IMG/M |
| 3300026118|Ga0207675_101696072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 652 | Open in IMG/M |
| 3300027787|Ga0209074_10292083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 649 | Open in IMG/M |
| 3300027876|Ga0209974_10273969 | Not Available | 640 | Open in IMG/M |
| 3300028720|Ga0307317_10037822 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
| 3300028720|Ga0307317_10154928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 770 | Open in IMG/M |
| 3300028771|Ga0307320_10343105 | Not Available | 596 | Open in IMG/M |
| 3300028784|Ga0307282_10402166 | Not Available | 663 | Open in IMG/M |
| 3300028787|Ga0307323_10141437 | Not Available | 868 | Open in IMG/M |
| 3300028828|Ga0307312_10111159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1707 | Open in IMG/M |
| 3300028875|Ga0307289_10396098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 568 | Open in IMG/M |
| 3300030336|Ga0247826_10243315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1259 | Open in IMG/M |
| 3300031226|Ga0307497_10749594 | Not Available | 508 | Open in IMG/M |
| 3300031833|Ga0310917_11178728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
| 3300031854|Ga0310904_11001947 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300031903|Ga0307407_10524575 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300031910|Ga0306923_10434598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1491 | Open in IMG/M |
| 3300032076|Ga0306924_10422333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1525 | Open in IMG/M |
| 3300032205|Ga0307472_102380075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 537 | Open in IMG/M |
| 3300032421|Ga0310812_10292814 | Not Available | 722 | Open in IMG/M |
| 3300034114|Ga0364938_030613 | Not Available | 870 | Open in IMG/M |
| 3300034115|Ga0364945_0289605 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300034125|Ga0370484_0076286 | Not Available | 857 | Open in IMG/M |
| 3300034149|Ga0364929_0164770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 723 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 23.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.27% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.42% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.42% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.56% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.56% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.71% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.71% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.71% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.85% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.85% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.85% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.85% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.85% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
| 3300000880 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-65cm-20A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300021972 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m2 | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300034114 | Sediment microbial communities from East River floodplain, Colorado, United States - 9_s17 | Environmental | Open in IMG/M |
| 3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1357J11328_102069561 | 3300000574 | Groundwater | AAEATLLERGFPEPQVKKELYWPKGKEPRGALGAADAAADADE* |
| AL20A1W_13471661 | 3300000880 | Permafrost | LLDRGYPEEQVHKELYWPKGKEPRGVAGAADVAAAMDAIEANADQ* |
| JGI10216J12902_1003144833 | 3300000956 | Soil | VHKELYWPKGKEPRGAAGADLAAAIEAAEANADQ* |
| JGI10216J12902_1015314761 | 3300000956 | Soil | LSAEATLLERGYAEDQVHKELYWPKGKEPRGAAGADLAAAIDAAESNADQ* |
| JGI10216J12902_1022926581 | 3300000956 | Soil | YPEDQVHKELYWPKGKEPRGVAGADLAAAIEAAEANADQ* |
| JGI10216J12902_1038549991 | 3300000956 | Soil | EAAVKKELYWPKGKEPRGLAAADLASAIEEAEANADQ* |
| JGI10216J12902_1115141311 | 3300000956 | Soil | RGYPEEQVHKELYWPKGKEPRGAAGADLAAAIDAAEANADQ* |
| JGI10216J12902_1126254221 | 3300000956 | Soil | YPEDQVHKELYWPKGKEPRGMAAADLAAAIEMAEANEDQ* |
| JGI10216J12902_1147603672 | 3300000956 | Soil | EDQVHKELYWPKGKEPRGATGADLAAAIDAAEANADQ* |
| JGI10216J12902_1156594923 | 3300000956 | Soil | EQVHKELYWPKGKEPRGLAAADLASAIEAAEHNADQ* |
| JGI10216J12902_1176547911 | 3300000956 | Soil | RGFEEAAVKKELYWPKGKEPRGLASADLATAIEEAEANADQ* |
| JGI10216J12902_1182113493 | 3300000956 | Soil | VHKELYWPKGKEPRGLAGADLATAIDAAEHNSDQ* |
| JGI10216J12902_1249428872 | 3300000956 | Soil | VHKELYWPKGKEPRGLAGADLAQAIDAAEANADQ* |
| C688J35102_1179112821 | 3300002568 | Soil | LERGYPEEQVHKELYWPKGKEPRGITGAADLAAAMDAAASNADQ* |
| Ga0063454_1013271412 | 3300004081 | Soil | QTLLARGYPEEQVHKELYWPKGKEPRGLAGAADIAAEIDAAISNSDE* |
| Ga0062593_1006159252 | 3300004114 | Soil | GYPEEQVHKELYWPKGKEPRGVAAADLAAAIDAAESNADQ* |
| Ga0062589_1007708602 | 3300004156 | Soil | DMILAAEATLLERGYAEEQVHKELYWPKGKEPRGVAGADLAAAIEAAEANADQ* |
| Ga0062595_1001166993 | 3300004479 | Soil | GRGYPEDQVHKELYWPKGKEPRGAAATDLAAAIEAAEANADQ* |
| Ga0062595_1025225922 | 3300004479 | Soil | LARDYPPEQVHKELYWPKGKEPRGLAAGDLAAAIDAAEANEDQ* |
| Ga0062594_1006621242 | 3300005093 | Soil | PEDQVHKELYWPKGKEPRGVVGAADVAAEIDAMAANADQ* |
| Ga0068869_1011596061 | 3300005334 | Miscanthus Rhizosphere | RGYPEDQVHKELYWPKGKEPRGVAGADLAAAIDAAEANADQ* |
| Ga0070691_111041861 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | LTAEATLLARGYPEDQVHKELYWPKGKEPRGVAGAADVAAAMDAIEANADQ* |
| Ga0070663_1013422032 | 3300005455 | Corn Rhizosphere | LLARDYPPEQVHKELYWPKGKEPRGLAGADLAAVIEAAEANSDQ* |
| Ga0068853_1004431183 | 3300005539 | Corn Rhizosphere | RGYPEDQVHKELYWPKGKEPRGVVGAADVAAEIDAMAANADQ* |
| Ga0070672_1002402611 | 3300005543 | Miscanthus Rhizosphere | EEQVHKELYWPKGKEPRGVAGADLAAAIDAAEANADQ* |
| Ga0070695_1001425264 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | IARGYPEDQIHKELYWPKGKEPRGVTGAADLAAAIDAAEANADQ* |
| Ga0066903_1009349724 | 3300005764 | Tropical Forest Soil | RGYPEDQVHKELYWPKGKEPRGVTGADLAAAIEAAEANEDQ* |
| Ga0068851_106117542 | 3300005834 | Corn Rhizosphere | PEEQVHKELYWPKGKEPRGVAGADLAAAIDAAEANADQ* |
| Ga0068862_1022337261 | 3300005844 | Switchgrass Rhizosphere | RGYPEDQVHKELYWPKGKEPRGASSADLATAIEMAEANEDQ* |
| Ga0081539_1000875511 | 3300005985 | Tabebuia Heterophylla Rhizosphere | AEETLVGRGYPEDQVHKELYWPKGKEPRGASATDLASAIDAAEANADQ* |
| Ga0066652_1000181637 | 3300006046 | Soil | EDQVHKELYWPKGKEPRGVSGADLAAAIDAAEANSDQ* |
| Ga0066652_1008485582 | 3300006046 | Soil | AEQTLLVRGYPEDQVHKELYWPKGKEPRGVAGADLAAAIEAAEANADE* |
| Ga0082029_17786662 | 3300006169 | Termite Nest | AAEQTFLERGYPEDQVHKELYWPKGKEPRGASAADLAAAIEMAEANEDQ* |
| Ga0068871_1018280772 | 3300006358 | Miscanthus Rhizosphere | VKKELYWPKGKEPRGVTGADLAAAIEAAEANADQ* |
| Ga0068871_1019988821 | 3300006358 | Miscanthus Rhizosphere | QVHKELYWPKGKEPRGLAGADLAAAIDAAEANEDQ* |
| Ga0074048_128691362 | 3300006581 | Soil | GYPEDQVHKELYWPKGKEPRGVAGADLAAAIDAAEANADQ* |
| Ga0075421_1026394562 | 3300006845 | Populus Rhizosphere | GTLLGLGFAEEAVKKELYWPKGKEPRGASASDLAAAIDAAEANADQ* |
| Ga0075433_112379532 | 3300006852 | Populus Rhizosphere | DMIIAAEATLLELGLPETAVKKELYWPKGKEPRGVAGAADVAAAEDE* |
| Ga0074063_136680711 | 3300006953 | Soil | LLGRGYPEDQVHKELYWPKGKEPRGLVGADLAAAIDAAESNEDQ* |
| Ga0079219_122247221 | 3300006954 | Agricultural Soil | EATLLERGYPGDQVHKELYWPKGKEPRGMAASDLASAIEMAEANEDQ* |
| Ga0105251_105449711 | 3300009011 | Switchgrass Rhizosphere | ERGYPEDQVHKELYWPKGKEPRGVAGADLAAAIDAAEANADQ* |
| Ga0066710_1014566451 | 3300009012 | Grasslands Soil | EETLLERGFPEEQVKKELYWPKGKEARGAAAPGESPSADLE |
| Ga0066710_1028334602 | 3300009012 | Grasslands Soil | GYPEEQIHKELYWPKGKEPRGMAAVDIAAAIDAAEANADQ |
| Ga0111539_104513171 | 3300009094 | Populus Rhizosphere | YAEDQVHKELYWPKGKEPRGVAGAADLAAEIDAAMSNTDQ* |
| Ga0105245_103284883 | 3300009098 | Miscanthus Rhizosphere | MINSAEATLLSRDYPPEQVHKELYWPKGKEPRGLAAGDLAAAIDAAEANEDQ* |
| Ga0105245_117454702 | 3300009098 | Miscanthus Rhizosphere | GYPEDQVHKELYWPKGKEPRGLAGADLAAAIEMAEGNEDQ* |
| Ga0075418_115025112 | 3300009100 | Populus Rhizosphere | LLERGYAEDQVHKELYWPKGKEPRGVAGAADLAAAIDAAEQNADQ* |
| Ga0105248_101402201 | 3300009177 | Switchgrass Rhizosphere | EQTLLELGMPEAAVKKELYWPKGKEPRGVTGADLAAAIEAAEANADQ* |
| Ga0126305_104200621 | 3300010036 | Serpentine Soil | VHKELYWPKGKEPRGVAGAADAAIAADLAEANADQ* |
| Ga0126309_112786021 | 3300010039 | Serpentine Soil | EDQVHKELYWPKGKEPRGVAAADLATAIDAAEANADQ* |
| Ga0134124_103050651 | 3300010397 | Terrestrial Soil | VHKELYWPKGKEPRGVAGAADVAAAIDAMEDNADQ* |
| Ga0134124_118528561 | 3300010397 | Terrestrial Soil | PEQVHKELYWPKGKEPRGLAAGDLAAAIDAAEANEDQ* |
| Ga0134121_121429011 | 3300010401 | Terrestrial Soil | QVHKELYWPKGKEPRGLAAGDLAAAIDAAEANEDQ* |
| Ga0134123_123017611 | 3300010403 | Terrestrial Soil | QVHKELYWPKGKEPRGVAAADLAAAIDAAEANADE* |
| Ga0137399_101166351 | 3300012203 | Vadose Zone Soil | TLLERGYAEDQVHKELYWPKGKEPRGVAGADLAAAIDAAEANADQ* |
| Ga0157309_103199941 | 3300012895 | Soil | KEQVHKELYWPKGKEPRGLANADLAAAIDAAEHNADQ* |
| Ga0157291_100880122 | 3300012902 | Soil | MILAAEATLLERGYPEDQVHKELYWPKGKEPRGVAGADLAAAIDAAEANADQ* |
| Ga0157283_101952243 | 3300012907 | Soil | YPEDQVHKELYWPKGKEPRGATAVDLATAIEMAEANQ* |
| Ga0157297_102850601 | 3300012914 | Soil | LLELGMPEAAVKKELYWPKGKEPRGVTGADLAAAIEAAEANADQ* |
| Ga0137413_116007521 | 3300012924 | Vadose Zone Soil | LERGYPEGQVHKELYWPKGKEPRGVAEGDLAAAIEAAEEHADQ* |
| Ga0164302_114440261 | 3300012961 | Soil | MILSAEETLLGRGYPEERVHKELYWPKGKEPRGVAGADLAAAIDAAEANADE* |
| Ga0164308_106107542 | 3300012985 | Soil | RGYPEEQVHKELYWPKGKEPRGVAGADLAAAIDAAEANADQ* |
| Ga0164304_102910432 | 3300012986 | Soil | AEQTLLGRGYPEDQVHKELYWPKGKEPRGLAGADLAAAIEMAEGNEDQ* |
| Ga0164306_117966701 | 3300012988 | Soil | DMILAAEATLLERGYAEDQVHKELYWPKGKEPRGMVGADLATAIDAAEANADQ* |
| Ga0120158_103628291 | 3300013772 | Permafrost | QQVHKELYWPKGKEPRGLVGADLASTIEAAEQNQDQ* |
| Ga0120132_11496032 | 3300013832 | Permafrost | EEQVHKELYWPKGKEPRGMLGADLATAIDAAEANADE* |
| Ga0157380_100415422 | 3300014326 | Switchgrass Rhizosphere | VIPTHGYWPKGKEPRGVAAADLAAAIDAAEANADQ* |
| Ga0132258_120743293 | 3300015371 | Arabidopsis Rhizosphere | RGYPADQVHKELYWPKGKEPRGASAMDLAAAIDAAEANEDQ* |
| Ga0132256_1021390401 | 3300015372 | Arabidopsis Rhizosphere | ATLLERGYPEEQVHKELYWPKGKEPRGVAAGDLAAAIEMAEENADQ* |
| Ga0163161_116746512 | 3300017792 | Switchgrass Rhizosphere | GYPEDQVHKELYWPKGKEPRGMAGADLATAIDAAEANADQ |
| Ga0190266_109417661 | 3300017965 | Soil | TLLGLGLPEEAVKKELYWPKGKEPRGAAGADLAAAIDAAEANADQ |
| Ga0187777_106740902 | 3300017974 | Tropical Peatland | AAEALLTDRGYPEEQVHKELYWPKGKEPRGATAGDLAAAIAAAEANTDE |
| Ga0184626_103780811 | 3300018053 | Groundwater Sediment | QVHKELYWPKGKEPRGVAAADLAAAIDAAEANADQ |
| Ga0184617_12222871 | 3300018066 | Groundwater Sediment | PDMILSAESTLLERGYAEEQVHKELYWPKGKEPRGFTGADLAAAIEAAEENADQ |
| Ga0190265_107237961 | 3300018422 | Soil | ELGLPEEAVKKELYWPKGKEPRGVAGADLAAAIDAAEANADQ |
| Ga0190272_122323311 | 3300018429 | Soil | EQVHKELYWPKGKEPRGVAGADLAAAIDAAEANADQ |
| Ga0190275_126316571 | 3300018432 | Soil | GFPEEAVHKELYWPKGKEPRGLAAADLAAAIDAAEANADQ |
| Ga0190275_134587131 | 3300018432 | Soil | TLLELGFPEPAVKKELYWPKGKEPRGAAVADLAAAIDAAEMNADQ |
| Ga0190268_120978821 | 3300018466 | Soil | EDQVHKELYWPKGKEPRGVAGADLAAAIEAAEANADQ |
| Ga0190274_109307141 | 3300018476 | Soil | LELGYPEEQVHKELYWPKGKEPRGAAGADLAAAIDAAEANADQ |
| Ga0190274_127504592 | 3300018476 | Soil | SAEATLLERGYPEEQVHKELYWPKGKEPRGVAGADLAAAIDAAEANADQ |
| Ga0190271_121842943 | 3300018481 | Soil | DLGLPEDAVHKELYWPKGKEPRGLAAADLATAIEAAEHNADQ |
| Ga0190267_111136442 | 3300019767 | Soil | MILSAEETLLGRGYPQEQVHKELYWPKGKEPRGVAGAADVAAAMDAVEANADQ |
| Ga0193737_10445001 | 3300021972 | Soil | TLLELDLPETAVKKELYWPKGKEPRGVATADLAAAIDAAEANADQ |
| Ga0207693_105521562 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | EATLLARGYPEEQVHKELYWPKGKEPRGVAAGDLAAAIEAAEANADQ |
| Ga0207650_105115481 | 3300025925 | Switchgrass Rhizosphere | AVKKELYWPKGKEPRGLAAADLAAAIDAAESNADQ |
| Ga0207650_116686982 | 3300025925 | Switchgrass Rhizosphere | GRGYPEDQVHKELYWPKGKEPRGMAATDLATAIEMAEANEDQ |
| Ga0207709_101802211 | 3300025935 | Miscanthus Rhizosphere | MILSAEETLLGRGYPEEQVHKELYWPKGKEPRGVAAADLAAAIDAAEANADE |
| Ga0207669_100422271 | 3300025937 | Miscanthus Rhizosphere | AAVKKELYWPKGKEPRGVTGADLAAAIEAAEANADQ |
| Ga0207691_115826262 | 3300025940 | Miscanthus Rhizosphere | YPEEQVHKELYWPKGKEPRGVAGADLAAAIDAAEANADQ |
| Ga0207661_103482293 | 3300025944 | Corn Rhizosphere | AEQTLLELGMPEAAVKKELYWPKGKEPRGVTGADLAAAIEAAEANADQ |
| Ga0207651_111293871 | 3300025960 | Switchgrass Rhizosphere | EAILLERGYPEDQVHKELYWPKGKEPRGVAGADLAAAIDAAEANADQ |
| Ga0207712_115751621 | 3300025961 | Switchgrass Rhizosphere | EQTLLELGMPEAAVKKELYWPKGKEPRGVTGADLAAAIEAAEANADQ |
| Ga0207675_1004703883 | 3300026118 | Switchgrass Rhizosphere | MILTAEATLLERGFEEAAVKKELYWPKGKEPRGLAAADLASAIEEAEANADQ |
| Ga0207675_1016960721 | 3300026118 | Switchgrass Rhizosphere | TLLSRDYPPEQVHKELYWPKGKEPRGLAAGDLAAAIDAAEANEDQ |
| Ga0209074_102920832 | 3300027787 | Agricultural Soil | ELGMAEDAVKKELYWPKGKEPRGATGADLAAAIEAAEANADQ |
| Ga0209974_102739692 | 3300027876 | Arabidopsis Thaliana Rhizosphere | PEDAVKKELYWPKGKEPRGVTGADLAAAIEAAEANADQ |
| Ga0307317_100378223 | 3300028720 | Soil | ETLLARGYPEEQVHKELYWPKGKEPRGMAGADLAAAIDAAEANADQ |
| Ga0307317_101549281 | 3300028720 | Soil | EQVHKELYWPKGKEPRGVAAGDLAAAIEAAEANADQ |
| Ga0307320_103431051 | 3300028771 | Soil | AEETLLGLGLPEEAIKKELYWPKGKEPRGVAGAADAAADADAEG |
| Ga0307282_104021661 | 3300028784 | Soil | LGRGYPEEQVHKELYWPKGKEPRGVAAADLAAAIDAAEANADQ |
| Ga0307323_101414372 | 3300028787 | Soil | ARGYPEEQVHKELYWPKGKEPRGMAGADLAAAIDAAEANADQ |
| Ga0307312_101111591 | 3300028828 | Soil | LSAEETLIGRGYPEEQVHKELYWPKGKEPRGVVGAADVAAAIDAMEANADQ |
| Ga0307289_103960981 | 3300028875 | Soil | GRGYPEEQVHKELYWPKGKEPRGVAGADLAAAIEAAEANADQ |
| Ga0247826_102433152 | 3300030336 | Soil | VIPTHGYWPKGREPRGVAAADLAAAIDAAEANADQ |
| Ga0307497_107495941 | 3300031226 | Soil | LARGYAEEQVHKELYWPKGKEPRGVAGADLAAAIDAAEANADQ |
| Ga0310917_111787282 | 3300031833 | Soil | FEEASVKKELYWPKGKEPRGLAAADLASAIEEAEANEDQ |
| Ga0310904_110019471 | 3300031854 | Soil | EQTLLGRGFAEEAIKKELFWPKGKEPRGLAAADLAAAIDAAEANADQ |
| Ga0307407_105245753 | 3300031903 | Rhizosphere | QVKKELYWPKGKEPRGVAAADLAAAIDAAEANADQ |
| Ga0306923_104345981 | 3300031910 | Soil | EEAAVKKELYWPKGKEPRGLAAADLASAIEEAEANEDQ |
| Ga0306924_104223331 | 3300032076 | Soil | LLDRGFEEASVKKELYWPKGKEPRGLAAADLASAIEEAEANEDQ |
| Ga0307472_1023800751 | 3300032205 | Hardwood Forest Soil | DRGFEETAVKKELYWPKGKEPRGLAAADLASAIEEAEANADQ |
| Ga0310812_102928141 | 3300032421 | Soil | ERGFPEEQVKKELYWPKGKEPQGLGTASLAEAIEAIEENADQ |
| Ga0364938_030613_728_868 | 3300034114 | Sediment | ETLLARGYPEDQVHKELYWPKGTEPRGVAAGDLAAAIDAAEANADQ |
| Ga0364945_0289605_22_180 | 3300034115 | Sediment | MILAAEATLLDRGYAEAQVHKELYWPKGKEPRGVVGADLATAIEAAEANADQ |
| Ga0370484_0076286_728_856 | 3300034125 | Untreated Peat Soil | LLERGFPEAQVKKELYWPKGKEPRGVTGAGDSAAAADANADE |
| Ga0364929_0164770_1_108 | 3300034149 | Sediment | AVKKELYWPKGKEPRGLAGMELASAIEAAEQNADE |
| ⦗Top⦘ |