


| Basic Information | |
|---|---|
| Family ID | F077722 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MLGFKRFFNARRVVAGVELVQKIIKGQFDVPASFGTDPFCIWYNMLAA |
| Number of Associated Samples | 77 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 28.21 % |
| % of genes near scaffold ends (potentially truncated) | 50.43 % |
| % of genes from short scaffolds (< 2000 bps) | 83.76 % |
| Associated GOLD sequencing projects | 73 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.778 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (40.171 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.479 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.538 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.37% β-sheet: 0.00% Coil/Unstructured: 52.63% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF13610 | DDE_Tnp_IS240 | 9.40 |
| PF01364 | Peptidase_C25 | 1.71 |
| PF08388 | GIIM | 1.71 |
| PF00239 | Resolvase | 1.71 |
| PF00753 | Lactamase_B | 1.71 |
| PF13365 | Trypsin_2 | 1.71 |
| PF01458 | SUFBD | 1.71 |
| PF08808 | RES | 1.71 |
| PF00072 | Response_reg | 0.85 |
| PF00582 | Usp | 0.85 |
| PF06736 | TMEM175 | 0.85 |
| PF00400 | WD40 | 0.85 |
| PF05717 | TnpB_IS66 | 0.85 |
| PF05977 | MFS_3 | 0.85 |
| PF02922 | CBM_48 | 0.85 |
| PF00440 | TetR_N | 0.85 |
| PF02910 | Succ_DH_flav_C | 0.85 |
| PF01656 | CbiA | 0.85 |
| PF12833 | HTH_18 | 0.85 |
| PF04986 | Y2_Tnp | 0.85 |
| PF07929 | PRiA4_ORF3 | 0.85 |
| PF08299 | Bac_DnaA_C | 0.85 |
| PF13810 | DUF4185 | 0.85 |
| PF16925 | TetR_C_13 | 0.85 |
| PF11964 | SpoIIAA-like | 0.85 |
| PF03358 | FMN_red | 0.85 |
| PF01757 | Acyl_transf_3 | 0.85 |
| PF14534 | DUF4440 | 0.85 |
| PF01176 | eIF-1a | 0.85 |
| PF02518 | HATPase_c | 0.85 |
| PF12697 | Abhydrolase_6 | 0.85 |
| PF08734 | GYD | 0.85 |
| PF02781 | G6PD_C | 0.85 |
| PF01068 | DNA_ligase_A_M | 0.85 |
| PF01425 | Amidase | 0.85 |
| PF00085 | Thioredoxin | 0.85 |
| PF05685 | Uma2 | 0.85 |
| PF03200 | Glyco_hydro_63 | 0.85 |
| PF01051 | Rep_3 | 0.85 |
| PF03466 | LysR_substrate | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG0719 | Fe-S cluster assembly scaffold protein SufB | Posttranslational modification, protein turnover, chaperones [O] | 1.71 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 1.71 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 1.71 |
| COG5654 | Predicted toxin component of a toxin-antitoxin system, contains RES domain | Defense mechanisms [V] | 1.71 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.85 |
| COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 0.85 |
| COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 0.85 |
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 0.85 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.85 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.85 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.85 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.85 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.85 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.85 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.85 |
| COG5527 | Protein involved in initiation of plasmid replication | Mobilome: prophages, transposons [X] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.78 % |
| Unclassified | root | N/A | 22.22 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q01AQNIF | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Polaromonas → unclassified Polaromonas → Polaromonas sp. JS666 | 518 | Open in IMG/M |
| 3300000955|JGI1027J12803_108927639 | Not Available | 512 | Open in IMG/M |
| 3300004635|Ga0062388_102183524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300005168|Ga0066809_10122275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
| 3300005332|Ga0066388_105430106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 646 | Open in IMG/M |
| 3300005445|Ga0070708_100614594 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1025 | Open in IMG/M |
| 3300005467|Ga0070706_100367340 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1340 | Open in IMG/M |
| 3300005467|Ga0070706_101151104 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300005468|Ga0070707_100151288 | All Organisms → cellular organisms → Bacteria | 2260 | Open in IMG/M |
| 3300005468|Ga0070707_100276118 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1634 | Open in IMG/M |
| 3300005471|Ga0070698_100684249 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 968 | Open in IMG/M |
| 3300005518|Ga0070699_101095823 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300005536|Ga0070697_100167811 | All Organisms → cellular organisms → Bacteria | 1857 | Open in IMG/M |
| 3300005559|Ga0066700_11098921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 520 | Open in IMG/M |
| 3300005602|Ga0070762_11211142 | Not Available | 522 | Open in IMG/M |
| 3300005610|Ga0070763_10660952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300005921|Ga0070766_11083974 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300006028|Ga0070717_10444015 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300006028|Ga0070717_12046544 | Not Available | 516 | Open in IMG/M |
| 3300006052|Ga0075029_100205265 | Not Available | 1232 | Open in IMG/M |
| 3300006102|Ga0075015_100620593 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300006172|Ga0075018_10322171 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 768 | Open in IMG/M |
| 3300006176|Ga0070765_100670304 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300006893|Ga0073928_10371451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia odorifera | 1054 | Open in IMG/M |
| 3300009521|Ga0116222_1089311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1328 | Open in IMG/M |
| 3300010341|Ga0074045_10370835 | Not Available | 931 | Open in IMG/M |
| 3300010343|Ga0074044_10002598 | All Organisms → cellular organisms → Bacteria | 15732 | Open in IMG/M |
| 3300010343|Ga0074044_10076917 | All Organisms → cellular organisms → Bacteria | 2256 | Open in IMG/M |
| 3300010379|Ga0136449_101112826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1255 | Open in IMG/M |
| 3300010379|Ga0136449_101319952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1123 | Open in IMG/M |
| 3300010937|Ga0137776_1349925 | Not Available | 981 | Open in IMG/M |
| 3300010937|Ga0137776_1691274 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300010937|Ga0137776_1876444 | Not Available | 579 | Open in IMG/M |
| 3300012177|Ga0153943_1010460 | All Organisms → cellular organisms → Bacteria | 2361 | Open in IMG/M |
| 3300012202|Ga0137363_10007266 | All Organisms → cellular organisms → Bacteria | 6938 | Open in IMG/M |
| 3300012205|Ga0137362_10762492 | Not Available | 830 | Open in IMG/M |
| 3300012205|Ga0137362_11034913 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 699 | Open in IMG/M |
| 3300012361|Ga0137360_10557255 | Not Available | 979 | Open in IMG/M |
| 3300012361|Ga0137360_10990170 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300012362|Ga0137361_11901562 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 512 | Open in IMG/M |
| 3300012917|Ga0137395_10586044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 805 | Open in IMG/M |
| 3300012923|Ga0137359_11254990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300012958|Ga0164299_10591936 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300014164|Ga0181532_10022937 | All Organisms → cellular organisms → Bacteria | 4482 | Open in IMG/M |
| 3300014199|Ga0181535_10194358 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300018047|Ga0187859_10906273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300020581|Ga0210399_10296853 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
| 3300020582|Ga0210395_10235373 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
| 3300020582|Ga0210395_10267091 | Not Available | 1286 | Open in IMG/M |
| 3300020583|Ga0210401_10377190 | Not Available | 1280 | Open in IMG/M |
| 3300021171|Ga0210405_10294258 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 3300021171|Ga0210405_10801985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
| 3300021171|Ga0210405_11000810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
| 3300021178|Ga0210408_10249863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1413 | Open in IMG/M |
| 3300021178|Ga0210408_10577756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 891 | Open in IMG/M |
| 3300021178|Ga0210408_10735607 | Not Available | 775 | Open in IMG/M |
| 3300021178|Ga0210408_10810951 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300021178|Ga0210408_11009427 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 643 | Open in IMG/M |
| 3300021178|Ga0210408_11087841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300021180|Ga0210396_10075522 | All Organisms → cellular organisms → Bacteria | 3063 | Open in IMG/M |
| 3300021180|Ga0210396_10156021 | All Organisms → cellular organisms → Bacteria | 2049 | Open in IMG/M |
| 3300021180|Ga0210396_10571779 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300021180|Ga0210396_11594214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300021181|Ga0210388_10342041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1315 | Open in IMG/M |
| 3300021181|Ga0210388_10912982 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300021401|Ga0210393_10026166 | All Organisms → cellular organisms → Bacteria | 4550 | Open in IMG/M |
| 3300021401|Ga0210393_10085618 | All Organisms → cellular organisms → Bacteria | 2500 | Open in IMG/M |
| 3300021401|Ga0210393_10751445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
| 3300021402|Ga0210385_11342421 | Not Available | 547 | Open in IMG/M |
| 3300021404|Ga0210389_10116167 | All Organisms → cellular organisms → Bacteria | 2065 | Open in IMG/M |
| 3300021404|Ga0210389_11009840 | Not Available | 645 | Open in IMG/M |
| 3300021405|Ga0210387_10031223 | All Organisms → cellular organisms → Bacteria | 4199 | Open in IMG/M |
| 3300021405|Ga0210387_10038651 | All Organisms → cellular organisms → Bacteria | 3797 | Open in IMG/M |
| 3300021405|Ga0210387_10322986 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1360 | Open in IMG/M |
| 3300021405|Ga0210387_10640972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 943 | Open in IMG/M |
| 3300021405|Ga0210387_10790221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus carbonis | 839 | Open in IMG/M |
| 3300021405|Ga0210387_10792357 | Not Available | 837 | Open in IMG/M |
| 3300021405|Ga0210387_11017017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 725 | Open in IMG/M |
| 3300021406|Ga0210386_10016760 | All Organisms → cellular organisms → Bacteria | 5714 | Open in IMG/M |
| 3300021406|Ga0210386_10290739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Ewingella → Ewingella americana | 1399 | Open in IMG/M |
| 3300021407|Ga0210383_10145345 | All Organisms → cellular organisms → Bacteria | 2013 | Open in IMG/M |
| 3300021407|Ga0210383_10568940 | Not Available | 977 | Open in IMG/M |
| 3300021432|Ga0210384_11814922 | Not Available | 515 | Open in IMG/M |
| 3300021474|Ga0210390_10709530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 838 | Open in IMG/M |
| 3300021474|Ga0210390_10937279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 710 | Open in IMG/M |
| 3300021475|Ga0210392_10488677 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300021479|Ga0210410_11254681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
| 3300021559|Ga0210409_11516666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300021560|Ga0126371_12367534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300022557|Ga0212123_10536805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 751 | Open in IMG/M |
| 3300025910|Ga0207684_10191781 | Not Available | 1763 | Open in IMG/M |
| 3300025910|Ga0207684_10519418 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300025910|Ga0207684_10985573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
| 3300025910|Ga0207684_11724443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300025922|Ga0207646_10185255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1880 | Open in IMG/M |
| 3300025922|Ga0207646_10249134 | All Organisms → cellular organisms → Bacteria | 1604 | Open in IMG/M |
| 3300025922|Ga0207646_10944505 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300026514|Ga0257168_1081706 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300026551|Ga0209648_10118080 | Not Available | 2145 | Open in IMG/M |
| 3300027635|Ga0209625_1042358 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300027667|Ga0209009_1006614 | All Organisms → cellular organisms → Bacteria | 2762 | Open in IMG/M |
| 3300027783|Ga0209448_10020101 | Not Available | 2196 | Open in IMG/M |
| 3300027812|Ga0209656_10498513 | Not Available | 532 | Open in IMG/M |
| 3300027824|Ga0209040_10079027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1907 | Open in IMG/M |
| 3300027825|Ga0209039_10023186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3117 | Open in IMG/M |
| 3300027903|Ga0209488_10491700 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300027911|Ga0209698_10462846 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300028906|Ga0308309_10193514 | Not Available | 1671 | Open in IMG/M |
| 3300028906|Ga0308309_11809006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. NEAU-YJ-81 | 516 | Open in IMG/M |
| 3300029636|Ga0222749_10189190 | Not Available | 1023 | Open in IMG/M |
| 3300030738|Ga0265462_11054053 | Not Available | 706 | Open in IMG/M |
| 3300030740|Ga0265460_11446673 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300031754|Ga0307475_10305581 | Not Available | 1277 | Open in IMG/M |
| 3300031754|Ga0307475_11244969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300031962|Ga0307479_11182548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 729 | Open in IMG/M |
| 3300032160|Ga0311301_11799954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 729 | Open in IMG/M |
| 3300034268|Ga0372943_1024344 | Not Available | 551 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 40.17% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 14.53% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.13% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.27% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.42% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.42% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 2.56% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.56% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.56% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.71% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.71% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.71% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.85% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.85% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300012177 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ027 MetaG | Host-Associated | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_03729190 | 2170459005 | Grass Soil | MLGFKRFFNARRVVAGVELVQKIVKGQFDVPASFGADPFRIWYNMLAA |
| JGI1027J12803_1089276391 | 3300000955 | Soil | FNARRVVAGVELVQKIVKGQFDVPASFGTDPFCIWYNMLAA* |
| Ga0062388_1021835242 | 3300004635 | Bog Forest Soil | SRVGPMLGFKRFFNARRVVASVELVQKIVKGQFDVPASFGTDPLCIWYNMLAT* |
| Ga0066809_101222752 | 3300005168 | Soil | MLGFKRFLNARRVVTGVELVQKIVKGQFDVPASFGTDPFCIWYNMLAA* |
| Ga0066388_1054301062 | 3300005332 | Tropical Forest Soil | MLGFKRSFNARRVLSGVELVHKIIKGQFGLPDRFGTEPFQVWYNVLAA* |
| Ga0070708_1006145942 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VSPMLGFKRFFNARRVVAGVELVQKIIKGQFGLPDRFGNNVLAA* |
| Ga0070706_1003673401 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MLGFKCFFNARRVVAGVELVQKITKGKFDVPESFGNDPFPVWYNVLAA* |
| Ga0070706_1011511042 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VAPMLGFKRFFNARRVVAGVELVQKIIKGQFGVPEGFGNDPFAVWYNVLAA* |
| Ga0070707_1001512882 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MLGFKRFFNARRVLAGVELVQKIIKGQFQVPEKFGIAPVEIWHNVLAA* |
| Ga0070707_1002761181 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MLGFKRFFNARRVVAGVKLVQKIIKGQFDVPEGFGNDPFAVWYNVLAA* |
| Ga0070698_1006842492 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MLGFKRFFNARRVLAGVELAHKIIKGHFGLPESFRTDPFHVWYNLLAA* |
| Ga0070699_1010958231 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | ARRVVAGVELVQKIIKGQFDVPESFGNDPFAVWYNVLAA* |
| Ga0070697_1001678111 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | ARVGPMLGFKRFFNARRVLVQKIIKGQFQVPEKFSIAPVEIWHNVLAA* |
| Ga0066700_110989211 | 3300005559 | Soil | LAFFNARRVLAGVELAHKIIKGQFGLPESFGTEPFHVWYNVLAA* |
| Ga0070762_112111421 | 3300005602 | Soil | RFFNARRVLNGVELVQKIIKGQFGLPESFGTDPFQVWYNVLAA* |
| Ga0070763_106609521 | 3300005610 | Soil | VGPMLGFKRFFNARRVVAGVELVQKIVKGQFDVPASFGTDPFCIWYNMLAA* |
| Ga0070766_110839742 | 3300005921 | Soil | MLGFKRFFNARRVVAGVELVQKIVKGQFDVPASFGTDPFCIWYNMLAA* |
| Ga0070717_104440153 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VSPMLGFKRFFNARRVLAGVELAHKIIKGHFGLPESFRTDPFHVWYNLLAA* |
| Ga0070717_120465442 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VAGVELVQKIVKGQFDVPASFGTDPFCIWYNMLAE* |
| Ga0075029_1002052651 | 3300006052 | Watersheds | AGVELVHKIIKGQFALPESFGTDLLHVWYNVLAA* |
| Ga0075015_1006205932 | 3300006102 | Watersheds | MLGFKRFFNARRILAGVELVHKIIKGQFGLPESFGTDPFHVWYNV |
| Ga0075018_103221712 | 3300006172 | Watersheds | PMLGFKRFFNARRALAGVELVQKTIKGQFQVPEKFGIAPVEIWRNVLAA* |
| Ga0070765_1006703041 | 3300006176 | Soil | MLGFKRFFNARRVLSGVELVQKIIKGQFGLPESFGTDPFQVWYNVLAA* |
| Ga0073928_103714511 | 3300006893 | Iron-Sulfur Acid Spring | MLGFKRFFNARRVVAGVELVQKIIKGQFDVPESFGNDPFSV* |
| Ga0116222_10893113 | 3300009521 | Peatlands Soil | MLGFKRFFNARRVVAGVELAQKIVKGQFDVPASFGTDPFCIWCNMLAA* |
| Ga0074045_103708351 | 3300010341 | Bog Forest Soil | ARRVVAGVELVQKIVKGQFDVPASFGTDPFCIWYNMLAA* |
| Ga0074044_1000259821 | 3300010343 | Bog Forest Soil | MLGFKRFFNARRVLSGVELVHKIIKGQFGLPDSFGTDPFQAFQQN* |
| Ga0074044_100769173 | 3300010343 | Bog Forest Soil | MLGFKRFFNARRVVASVELVQKIVKGQFDVPASFGTDPLCIWYNMLAT* |
| Ga0136449_1011128262 | 3300010379 | Peatlands Soil | MLGFKRFFNARRVVAGVELVQKIIKGQFDVPASFGTDPFCIWYNMLAA* |
| Ga0136449_1013199522 | 3300010379 | Peatlands Soil | MLGFKRFFNARRVVAGVELAQKIVKGQFDVPASFGTDPFCIWYNMLAA* |
| Ga0137776_13499252 | 3300010937 | Sediment | RVVAGVELVQKIVKGQFDVPASLGTDPFCIWYILLAA* |
| Ga0137776_16912742 | 3300010937 | Sediment | MLGFKRFFNARRVVAGVELVQKIVKGQFDVPASLGTDPFCIWYNMLAA* |
| Ga0137776_18764441 | 3300010937 | Sediment | VAGVELVQKIVKGQFDVPASLGTDPFCIWYNMLAA* |
| Ga0153943_10104602 | 3300012177 | Attine Ant Fungus Gardens | MLGFKRFFNARRVVAGVELVQKIVKGQFDVPASLGTDPFCIWYILLAA* |
| Ga0137363_100072669 | 3300012202 | Vadose Zone Soil | MLGFKSFFNARRVLAGVEPVHKIIKGQFGLPESFGTDPFHVWYNVLAA* |
| Ga0137362_107624922 | 3300012205 | Vadose Zone Soil | MLGFKHFFNARRVLSGVELVHKIIKGQFGLPESFGTDPFQVWYNVLAA* |
| Ga0137362_110349131 | 3300012205 | Vadose Zone Soil | MLGFNRFFNARRVLAGVELVHKIIKGQFGLPESFGTDPFQVWY* |
| Ga0137360_105572551 | 3300012361 | Vadose Zone Soil | RRVVAGVELVQKIVKGQFDIPASFGTDPFCMWYNMLAA* |
| Ga0137360_109901702 | 3300012361 | Vadose Zone Soil | MLGFKRFFNARRVVAGVELVPKIIKGQFDVPESFGNDPFSV* |
| Ga0137361_119015621 | 3300012362 | Vadose Zone Soil | MLGFKRFFNARRVLSGVELVHKIIKGQFGLPESFGTDPLHVRYNVLAT* |
| Ga0137395_105860441 | 3300012917 | Vadose Zone Soil | MLGFKRFFNARRVLAGVELVHKIIKGQFGLPESFGTDPFHVWYNVLAA* |
| Ga0137359_112549901 | 3300012923 | Vadose Zone Soil | VGPMLGFKRFFNARRVVAGVELVQKIVKGQFDVPTSFGTDPFCIWYNMLAA* |
| Ga0164299_105919362 | 3300012958 | Soil | MLGFKRFFNVRRVVAGVELVQKIVKGQFDVPESLGTDPFCIWYNMLAA* |
| Ga0181532_100229373 | 3300014164 | Bog | MLGFKRFFNARRVVAGVALVQKIVKGQFDVPASFGTDPFCIWYNMLAA* |
| Ga0181535_101943582 | 3300014199 | Bog | MLGFKRFFNARRVVAGVELVQKILKGQFDVPASFGTDPFCIWYNMLAA* |
| Ga0187859_109062732 | 3300018047 | Peatland | MLGFKRFFNARRVLGGVDLVHKIIKGQFGLPASFGTDPFHVWFNVL |
| Ga0210399_102968531 | 3300020581 | Soil | LAGVELVHKIIKGQFALPESFGTDLLRVWYNVLAA |
| Ga0210395_102353732 | 3300020582 | Soil | MLGFKRFFNARRVLSGVELVQKIIKGQFGLPESFGTDPFQV |
| Ga0210395_102670913 | 3300020582 | Soil | LSGVELVQKIIKGQFGLPESFGTDPFQVWYNVLAA |
| Ga0210401_103771903 | 3300020583 | Soil | RFFNARRVVAGVELVQKIVKGQFDVPVSFGTDPFCIWYNMLAA |
| Ga0210405_102942583 | 3300021171 | Soil | NARRVLSGVELVHKIIKGQFGLPESFGTEPFHVWYNVLAA |
| Ga0210405_108019851 | 3300021171 | Soil | VGPMLGFKRFFNARRVVAGVELVQKIVKGQVDVPASFGMDPFCIWYNMLAA |
| Ga0210405_110008102 | 3300021171 | Soil | MLGFKRSFNARQVLAGVELAHKIIKGQFGLPESFGTDPFHVWYNVLAA |
| Ga0210408_102498632 | 3300021178 | Soil | VGPMLGFKRFFNARRVVAGVELVQKIVKGQFDVSVSFGTDPFCIWYNMLAA |
| Ga0210408_105777561 | 3300021178 | Soil | MLGFKRFFSARRVVAGVKLVQKIIKGRFDVPEGFGNDPFAVWYNVLAA |
| Ga0210408_107356071 | 3300021178 | Soil | FKRFFNARRVLNGVELVQKIIKGQFGLPESFGTDPFQVWYNMLAA |
| Ga0210408_108109512 | 3300021178 | Soil | FKGFFNARRVVAGVELVQKIVKGQFDVPASFGTDPFCIWYNMLAA |
| Ga0210408_110094271 | 3300021178 | Soil | RSQGMAELVQKIIKGQFQVPEKFGIAPVEIWRNVLAA |
| Ga0210408_110878411 | 3300021178 | Soil | VGPMLGLKRFFNARRVVAGVELVQKIVKGQFDVPGIFGTDPFCIWY |
| Ga0210396_100755228 | 3300021180 | Soil | RVAPMLGFKRFFNARRVLNGVELVQKIIKGQFGLPESFGTDPIPGMV |
| Ga0210396_101560215 | 3300021180 | Soil | GFKRFFNARRVLSGVELVQKIIKGQFGLPESFGMDPFQVWYNVLAA |
| Ga0210396_105717791 | 3300021180 | Soil | SRVAPLGFKRFFNARRVLSGVELVQKIIKGQFGLPESFGTDPFQVWYNVLAA |
| Ga0210396_115942141 | 3300021180 | Soil | RVAPMLGFKRFFNARRVLNGVELVQKIIKGQFGLPESFGTDPFQVWYNVLAA |
| Ga0210388_103420414 | 3300021181 | Soil | FKRFFNARRVLSGVELVQKIIKGQFGLPESFGMDPFQVWYNVLAA |
| Ga0210388_109129821 | 3300021181 | Soil | APMLGFKRVFNARRVLNGVELVQKIIKGQFGLPESFGTDPFQVWYNVLAA |
| Ga0210393_100261667 | 3300021401 | Soil | VNARRVLNGVELVQKIIKGQFGLPESFGTDPFQVWYNMLAA |
| Ga0210393_100856183 | 3300021401 | Soil | RVGPMLGFKRFFNARRVVAGVELVQKIVKGQFDVPASFGTDPFCIWYNMLAA |
| Ga0210393_107514452 | 3300021401 | Soil | MLGFKRFFNARRVVAGVELVQKIVKGQFDVSVSFGTDPFCIWYNMLAA |
| Ga0210385_113424211 | 3300021402 | Soil | KRFFNARRVVAGVELVQKIVKGQFDVSVSFGTDPFCIWYNMLAA |
| Ga0210389_101161671 | 3300021404 | Soil | KRFFNARRVLNGVELVQKIIKGQFGLPESFGTDPFQVWYNVLAA |
| Ga0210389_110098403 | 3300021404 | Soil | RRVVAGVELVQKIVKGQFDVSVSFGTDPFCIWYNMLAA |
| Ga0210387_100312231 | 3300021405 | Soil | RFFNARRVLSGVELVQKIIKGQFGLPESFGMDPFQVWYNVLAA |
| Ga0210387_100386511 | 3300021405 | Soil | LGFKRFFNARRVVAGVELVQKIVKGQFDVPASFGTDPFCIWYNMLAA |
| Ga0210387_103229861 | 3300021405 | Soil | RRVVAGVELVQKIVKGQFDVPVSFGTDPFCIWYNMLAA |
| Ga0210387_106409722 | 3300021405 | Soil | VGPMLGFKRFFNARRVVAGVELVQKNVKGQFDVPASFGTDPFCIWYNMLAA |
| Ga0210387_107902212 | 3300021405 | Soil | MLGFKRFFNARRVGVELVQKIVKGQFDVPASFGTDPFCIWYNMLAA |
| Ga0210387_107923571 | 3300021405 | Soil | FNARRAVAGVELVQKIVKGQFDVPASFGTDPFCIWYNMLAA |
| Ga0210387_110170171 | 3300021405 | Soil | MLGFKRFFNARRVLAGIELVHKIIKDLFGLPESFATAPLHVWYNLLAT |
| Ga0210386_100167601 | 3300021406 | Soil | FNARRVLNGVELVQKIIKGQFGLPESFGTDPFQVWYNMLAA |
| Ga0210386_102907391 | 3300021406 | Soil | LTPRYRLRERFFNARRVLRGVELVQKIIKGQFGLPESFGTDPFQVW |
| Ga0210383_101453451 | 3300021407 | Soil | VAPMLGFKRFFNARRVLNGVELVQKIIKGQFGLPESFGTDPFQVWYNVLAA |
| Ga0210383_105689401 | 3300021407 | Soil | VVAGVELVQKIVKGQFDVPASFGTDAFCIWYNMLAA |
| Ga0210384_118149221 | 3300021432 | Soil | VLSGVELVHKIIKGQFGLPDSFGTEPFQVWYNVLAA |
| Ga0210390_107095302 | 3300021474 | Soil | MLGFKRFFNARRVVAGVELVQKIVKGQFDVPVSFGTDPFCIWYNMLAA |
| Ga0210390_109372792 | 3300021474 | Soil | LPPASRLELVQKIIKGQFGLPESFGTDPFQVWYNVLAA |
| Ga0210392_104886771 | 3300021475 | Soil | VVAGVELVQKIVKGQFDVPASFGTDPFCIWYNMLAA |
| Ga0210410_112546811 | 3300021479 | Soil | VAPMLGFKRFFNARRVLSGVELVQKIIKGQFGLPESFGTDPFQV |
| Ga0210409_115166661 | 3300021559 | Soil | RVAPLLGFKRFFNARRVLVGVELVQKIIKGQFGLPASFGTDSFHVWYNVLAA |
| Ga0126371_123675342 | 3300021560 | Tropical Forest Soil | MLGFKCFFNARRVLAGVELVQKIIKGQFQVPEKLGIAPVEIWHNVLAV |
| Ga0212123_105368051 | 3300022557 | Iron-Sulfur Acid Spring | MLGFKRFFNARRVVAGVELVQKIIKGQFDVPESFGNDPFSV |
| Ga0207684_101917812 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VSPMLRFKSFFNARRVLAGVELVHKIIKGQFGLPESLGTDPFHVWYNVLAA |
| Ga0207684_105194181 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | FNARRVVAGVELVQKIIKGQFDVPESFGNDPFAVWYNVLAA |
| Ga0207684_109855731 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VGPMLGFKGFFNARSVVAGMELVQKIVKGQFDVPASFGTDP |
| Ga0207684_117244432 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MLGFKRFFNARHVVAGVELVQKIVKGQFDVPASFGTDPFCIWYNMLAE |
| Ga0207646_101852551 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VAPMLGFKRFFNARRVLVGVELVHKIIKGQFGLPASFGTDSFHVWYN |
| Ga0207646_102491343 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MLGFKRFFNARRVLAGVELVQKIIKGQFQVPEKFGIAPVEIWHNVLAA |
| Ga0207646_109445051 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | RVVAGVELVQKIIKGQFDVPESFGNDPFAVWYNVLAA |
| Ga0257168_10817061 | 3300026514 | Soil | DGFKRFFNARRVLADAELCQKIVQRLKGQFQVPEEVRHRSVEMWHNVLAT |
| Ga0209648_101180801 | 3300026551 | Grasslands Soil | MLGFKRFFNARRVLAGIKVVHKIIKGQFGLLESFGTDPLTCMV |
| Ga0209625_10423583 | 3300027635 | Forest Soil | MLGFKRFFNARRVLNGVELVQKIIKGQFGLPESFGTDPFQVWYNVLAA |
| Ga0209009_10066144 | 3300027667 | Forest Soil | MLGFKRFFNARRVVAGVELVQKIVKGQFDVPASFGTDPFCIWYNMLAA |
| Ga0209448_100201013 | 3300027783 | Bog Forest Soil | MLGFKRFFNARRVLSGVELVHKIIKGQFGLPDSFGTDPFQAFQQN |
| Ga0209656_104985131 | 3300027812 | Bog Forest Soil | FKRFFNARRVVAGVELVQKIVKGQFDVPASSGTDPFCICYNMLAA |
| Ga0209040_100790271 | 3300027824 | Bog Forest Soil | PMLGFKRFFNARRVVAGVELVQKIVKGQFDVPASFGTDPFCIWYNMLAA |
| Ga0209039_100231865 | 3300027825 | Bog Forest Soil | MLGFKRFFNARRVLSGVELVRKIIKGQFGLPDSFGTDPFQAFQQN |
| Ga0209488_104917002 | 3300027903 | Vadose Zone Soil | MLGFKRFFNAQRIVAGVELVQKIVKGQFDVPASFGTDPFCIWYNMLAA |
| Ga0209698_104628463 | 3300027911 | Watersheds | RRVLAGIELVHKIIKCQFGLPESFGTDPFHVWYNVLAA |
| Ga0308309_101935141 | 3300028906 | Soil | RRVLNGVELVQKIIKGQFGLPESFGTDPFQVWYNMLAA |
| Ga0308309_118090061 | 3300028906 | Soil | LTPRYRLRERFFNARRVLRGVELVQKIIKGQFGLPESFGTDPFQVWY |
| Ga0222749_101891901 | 3300029636 | Soil | VGPMLGFKGFFNARRVVAGVELVQKIVKGQFDVPASFGTDPFCIWYNMLAA |
| Ga0265462_110540533 | 3300030738 | Soil | VGPMLGFKRFFNARHVVAGVELVQKIVKGQFGVPASFGTDPFCIWYNMLAA |
| Ga0265460_114466731 | 3300030740 | Soil | MLGFKRFFNARRVVAGVELVQKIVKGQFGVPASFGTDPFCIWYNMLAA |
| Ga0307475_103055811 | 3300031754 | Hardwood Forest Soil | MLGFKRFFNARRVLAGVELAHKIIKGQFGLPESFGTDPFHVWYNVLAA |
| Ga0307475_112449691 | 3300031754 | Hardwood Forest Soil | MLGFKRFFNARRVLAGIEVVHKIIKGQFGLLESFGTDPLHVWYNVLAT |
| Ga0307479_111825481 | 3300031962 | Hardwood Forest Soil | VGPMLGLKRFFNARRVVAGVELVQKIVKGQFDVPGSFGTDPFCIWYNMLAA |
| Ga0311301_117999541 | 3300032160 | Peatlands Soil | VGPMLGFKRFFNARRVVAGVELVQKIIKGQFDVPASFGTDPFCIWYNMLAA |
| Ga0372943_1024344_30_140 | 3300034268 | Soil | VVAGIELVHKIIKGQFEVPEAFGTDPFGVWHKVVAA |
| ⦗Top⦘ |