


| Basic Information | |
|---|---|
| Family ID | F077705 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 43 residues |
| Representative Sequence | WTGKAYWDYYGYHEDPTTGAVQDLFAPRNFRGNLVTLSVRYAF |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.86 % |
| % of genes near scaffold ends (potentially truncated) | 99.15 % |
| % of genes from short scaffolds (< 2000 bps) | 93.16 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.16 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.581 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.094 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.479 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.701 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 9.86% β-sheet: 0.00% Coil/Unstructured: 90.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.16 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF13442 | Cytochrome_CBB3 | 66.67 |
| PF03264 | Cytochrom_NNT | 11.11 |
| PF08802 | Obsolete Pfam Family | 6.84 |
| PF00033 | Cytochrome_B | 1.71 |
| PF00355 | Rieske | 1.71 |
| PF13631 | Cytochrom_B_N_2 | 0.85 |
| PF04264 | YceI | 0.85 |
| PF00326 | Peptidase_S9 | 0.85 |
| PF13424 | TPR_12 | 0.85 |
| PF04879 | Molybdop_Fe4S4 | 0.85 |
| PF07609 | DUF1572 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG3005 | Tetraheme cytochrome c subunit NapC of nitrate or TMAO reductase | Energy production and conversion [C] | 11.11 |
| COG1290 | Cytochrome b subunit of the bc complex | Energy production and conversion [C] | 1.71 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.58 % |
| Unclassified | root | N/A | 3.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001089|JGI12683J13190_1001954 | All Organisms → cellular organisms → Bacteria | 2876 | Open in IMG/M |
| 3300001593|JGI12635J15846_10000811 | All Organisms → cellular organisms → Bacteria | 27160 | Open in IMG/M |
| 3300002562|JGI25382J37095_10261877 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300004103|Ga0058903_1239222 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300004120|Ga0058901_1349115 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300004137|Ga0058883_1543619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 831 | Open in IMG/M |
| 3300004555|Ga0068922_1133640 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300004597|Ga0068947_1150649 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300004631|Ga0058899_12210312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 958 | Open in IMG/M |
| 3300004631|Ga0058899_12266201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 787 | Open in IMG/M |
| 3300005293|Ga0065715_10165322 | All Organisms → cellular organisms → Bacteria | 1592 | Open in IMG/M |
| 3300005332|Ga0066388_101195097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 1299 | Open in IMG/M |
| 3300005440|Ga0070705_101484121 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300005468|Ga0070707_100773933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 923 | Open in IMG/M |
| 3300005532|Ga0070739_10077338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1975 | Open in IMG/M |
| 3300005532|Ga0070739_10514279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300005537|Ga0070730_10374960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 923 | Open in IMG/M |
| 3300005545|Ga0070695_101786849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300005610|Ga0070763_10946135 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005952|Ga0080026_10253517 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300006028|Ga0070717_10281657 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
| 3300006057|Ga0075026_100454491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
| 3300006162|Ga0075030_100227398 | All Organisms → cellular organisms → Bacteria | 1499 | Open in IMG/M |
| 3300006172|Ga0075018_10656521 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300006174|Ga0075014_100924729 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300006237|Ga0097621_101587951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300006881|Ga0068865_101216612 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300006904|Ga0075424_102793921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300007076|Ga0075435_100885935 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300007255|Ga0099791_10596126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300007258|Ga0099793_10562864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300009089|Ga0099828_11821099 | Not Available | 534 | Open in IMG/M |
| 3300009520|Ga0116214_1347816 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300010043|Ga0126380_10507574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 927 | Open in IMG/M |
| 3300010046|Ga0126384_11151111 | Not Available | 713 | Open in IMG/M |
| 3300010360|Ga0126372_11203122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 782 | Open in IMG/M |
| 3300010362|Ga0126377_10072153 | All Organisms → cellular organisms → Bacteria | 3075 | Open in IMG/M |
| 3300010362|Ga0126377_12747221 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300010366|Ga0126379_13594154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300010373|Ga0134128_11282021 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300010376|Ga0126381_100051486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 5043 | Open in IMG/M |
| 3300010400|Ga0134122_11444607 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300010880|Ga0126350_11532143 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300011078|Ga0138565_1060863 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300011120|Ga0150983_10579022 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300011120|Ga0150983_12551596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 783 | Open in IMG/M |
| 3300011120|Ga0150983_13472342 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300011120|Ga0150983_13746805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300011120|Ga0150983_14791203 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300012189|Ga0137388_10526566 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300012202|Ga0137363_11192055 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300012206|Ga0137380_10291736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1463 | Open in IMG/M |
| 3300012351|Ga0137386_10193721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1460 | Open in IMG/M |
| 3300012351|Ga0137386_10363094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1042 | Open in IMG/M |
| 3300012469|Ga0150984_109785719 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300012901|Ga0157288_10101145 | Not Available | 783 | Open in IMG/M |
| 3300012944|Ga0137410_10970549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
| 3300015371|Ga0132258_12138942 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
| 3300015371|Ga0132258_13316871 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300016270|Ga0182036_11142108 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300017927|Ga0187824_10103417 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300017927|Ga0187824_10193123 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300017972|Ga0187781_10544556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 835 | Open in IMG/M |
| 3300019866|Ga0193756_1059908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300020579|Ga0210407_10462424 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300020581|Ga0210399_11067496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300021401|Ga0210393_10653931 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300021405|Ga0210387_11481178 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300021405|Ga0210387_11655159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300021406|Ga0210386_10607588 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300021407|Ga0210383_10251324 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
| 3300021407|Ga0210383_10468624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1087 | Open in IMG/M |
| 3300021420|Ga0210394_10012349 | All Organisms → cellular organisms → Bacteria | 8312 | Open in IMG/M |
| 3300021478|Ga0210402_10094693 | All Organisms → cellular organisms → Bacteria | 2675 | Open in IMG/M |
| 3300021478|Ga0210402_10198983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1841 | Open in IMG/M |
| 3300021479|Ga0210410_11808221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300021559|Ga0210409_10331932 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
| 3300021559|Ga0210409_11657611 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300021861|Ga0213853_11077204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 889 | Open in IMG/M |
| 3300022504|Ga0242642_1092669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300022531|Ga0242660_1212976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300022726|Ga0242654_10245429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300024182|Ga0247669_1030017 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300025912|Ga0207707_10178919 | All Organisms → cellular organisms → Bacteria | 1852 | Open in IMG/M |
| 3300025916|Ga0207663_11299198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300025922|Ga0207646_10717408 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300025928|Ga0207700_10081139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2532 | Open in IMG/M |
| 3300025928|Ga0207700_10677901 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300025937|Ga0207669_11470669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300027266|Ga0209215_1036757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
| 3300027497|Ga0208199_1112014 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300027562|Ga0209735_1016236 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
| 3300027565|Ga0209219_1178552 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300027591|Ga0209733_1165650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300027773|Ga0209810_1223566 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300027846|Ga0209180_10791792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300027855|Ga0209693_10536865 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300027882|Ga0209590_10889397 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300027889|Ga0209380_10840999 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300027894|Ga0209068_10159709 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
| 3300028281|Ga0247689_1054621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300028906|Ga0308309_11503148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300031231|Ga0170824_115308262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1160 | Open in IMG/M |
| 3300031247|Ga0265340_10177108 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300031469|Ga0170819_15829932 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300031474|Ga0170818_101872975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300031720|Ga0307469_10110062 | All Organisms → cellular organisms → Bacteria | 1962 | Open in IMG/M |
| 3300031720|Ga0307469_10500289 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300031754|Ga0307475_10379312 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300031754|Ga0307475_10393019 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300031962|Ga0307479_10379787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1397 | Open in IMG/M |
| 3300032782|Ga0335082_10439574 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300032893|Ga0335069_12242873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300033004|Ga0335084_11793031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300033134|Ga0335073_11218789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
| 3300033289|Ga0310914_10356388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1323 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.09% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 13.68% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.40% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.98% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.27% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.27% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.27% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.42% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.42% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.56% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.56% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.71% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.71% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.71% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.85% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.85% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.85% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.85% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.85% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001089 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004103 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF242 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004120 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF238 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004137 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004555 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 7 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004597 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 35 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011078 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 50 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
| 3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027266 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028281 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK30 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12683J13190_10019541 | 3300001089 | Forest Soil | RHWTAKAYWDYYGYHEDPTAGAVVDLFVPRNFRGNLVTLSMRYAF* |
| JGI12635J15846_1000081128 | 3300001593 | Forest Soil | HWTAKAYWDYYGYHEDPTAGAVVDLFVPRNFRGNLVTLSMRYAF* |
| JGI25382J37095_102618772 | 3300002562 | Grasslands Soil | TGKAYWDYYGYHEDPTSGAVQDSFAPRNFRGNLVTLSVRYAF* |
| Ga0058903_12392222 | 3300004103 | Forest Soil | AYWGYYGYHEDLDPTLVQDIFAPRNFHANLVTLSLRYAF* |
| Ga0058901_13491151 | 3300004120 | Forest Soil | FWDYYGYHEDPTLGAGAVAVQDIYAPRNFRGNLYTLSLKYAF* |
| Ga0058883_15436191 | 3300004137 | Forest Soil | AGKALWDYYGYHEDPTFGTGGEAPIDVFAPRNFRGNLVTLSVRYAF* |
| Ga0068922_11336401 | 3300004555 | Peatlands Soil | YGYHEDPTYGITGAEAVQDIYAPRNFRGNLYTLSVKYAF* |
| Ga0068947_11506492 | 3300004597 | Peatlands Soil | FSKEWTGKAFWDYYGYHEDATFGTGGAEAAQDIYAPRNFRGNLYTLSLKYAF* |
| Ga0058899_122103121 | 3300004631 | Forest Soil | KAFWDYYGYHEDPTFGITGAEAVQDIYAPRNFRGNLYTLSVKYAF* |
| Ga0058899_122662011 | 3300004631 | Forest Soil | GKAFWDYYGYHEDPTFGAGTEAAEDIYAPRNFRGNLYTLSLKYAF* |
| Ga0065715_101653224 | 3300005293 | Miscanthus Rhizosphere | RWIGKAYWAYHGYHEDPDVGVVQDIFVPRNFHANLVTISVRYMF* |
| Ga0066388_1011950973 | 3300005332 | Tropical Forest Soil | AKNWTGRALWDYYGYHEDASAVPQDLAAPRNFRGNLFTLSLRYAF* |
| Ga0070705_1014841212 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | FAHHWMARAAWDYYGYHEDPTAGAVEDIFVPRNFRGNLVTLSMRFAF* |
| Ga0070707_1007739333 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | WAGKALWDYYGYHEDPTFGAGGEAVIDVFAPRNFRGNLVTLSLRYAF* |
| Ga0070739_100773384 | 3300005532 | Surface Soil | KFSKEWTGKAYWDYYGYHEDSSVGEVQDILAPRNFRGNLVTLSVRYAF* |
| Ga0070739_105142792 | 3300005532 | Surface Soil | AKAYWGFYGYHEDLTALAQDFFVPRNFHANTVTLSVLYAF* |
| Ga0070730_103749601 | 3300005537 | Surface Soil | DWTGKFFWDYYGYHEDPTFGTGAIAAQDIFSPRNFRGNLVTLSVKYAF* |
| Ga0070695_1017868491 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | DYRFSKQWTGKFFWDYYGYHEDPTIGAGTIAAQDLFSPRNFRGNLVTLSVRYAF* |
| Ga0070763_109461352 | 3300005610 | Soil | WDYYGYHEDPTLGTGGEAAQDIFAARNFRGNLYTLSARYAF* |
| Ga0080026_102535172 | 3300005952 | Permafrost Soil | AFAKAWTGKAYWGYYGYHEDPSLVPQDLAAPRNFRGNLVTLSMRYAF* |
| Ga0070717_102816573 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GWTGKAFWDYYGYHEDPTFGTGGTAVQDVFGPRNFRGNLVTLSARYSF* |
| Ga0075026_1004544913 | 3300006057 | Watersheds | YYGYHEDASPVPQDLFAPRNFRGNLVTLSMRYAF* |
| Ga0075030_1002273981 | 3300006162 | Watersheds | KFSKEWTGKAYWDYYGYHEDPTAGAVQDIFAARNFRGNLFTLSVKYAF* |
| Ga0075018_106565211 | 3300006172 | Watersheds | YYGYHEDPDNVIQDIFAPRNFRANLVTISLRYAF* |
| Ga0075014_1009247292 | 3300006174 | Watersheds | GYYGYHEDESNVVQDIYAPRNFRANLVTLSLRYAF* |
| Ga0097621_1015879512 | 3300006237 | Miscanthus Rhizosphere | KAYWGYHNYHEDETPQSPQDIFVPRNFHANLVTLSLRYAF* |
| Ga0068865_1012166123 | 3300006881 | Miscanthus Rhizosphere | GYHGYHEDETAQSPQDIFVPRNFHANLVTLSLRYAF* |
| Ga0075424_1027939211 | 3300006904 | Populus Rhizosphere | AYWGYHGYHEDETAQSPQDIFVPRNFHANLVTLSLKYAF* |
| Ga0075435_1008859352 | 3300007076 | Populus Rhizosphere | KGWTGKAYWGYHDYHEDETTQSPQDIFVPRNFHANLVTLSLRYAF* |
| Ga0099791_105961261 | 3300007255 | Vadose Zone Soil | KGLTGKAYWGYHGYHEDETPQSPQDIFVPRNFHANLVTLSLRYAF* |
| Ga0099793_105628641 | 3300007258 | Vadose Zone Soil | KAFWSYYSYHEDPTAAFQDVFASRNFHGNLVTLSVRYAF* |
| Ga0099828_118210992 | 3300009089 | Vadose Zone Soil | YWGYYGYHEDLTALTQDVFAPRNFRGNTVTLSLRYAF* |
| Ga0116214_13478161 | 3300009520 | Peatlands Soil | EDATFGTGGAEAAQDIYAPRNFRGNLYTLSLKYAF* |
| Ga0126380_105075742 | 3300010043 | Tropical Forest Soil | GYYGYHEDLTALAQDIFAPRNFHSNTTTLSLQYAF* |
| Ga0126384_111511112 | 3300010046 | Tropical Forest Soil | WGYYGYHEDLTALSQDVFAPRNFHANTATLSLRYSF* |
| Ga0126372_112031221 | 3300010360 | Tropical Forest Soil | TGKAFWDYYGYHEDASAVPQDLAALRNFRGNLVTLSLRYAF* |
| Ga0126377_100721537 | 3300010362 | Tropical Forest Soil | AYWGYYGYHEDSSGVSQDIFAPRNFQSNLVTLSVRYAF* |
| Ga0126377_127472213 | 3300010362 | Tropical Forest Soil | YWGYHGYHEDPDPGVVQDIFNPRNFHANLVTLSLRYAF* |
| Ga0126379_135941542 | 3300010366 | Tropical Forest Soil | ARNWTGRAYWGFYDYSEDPTASPQDVFAPRNFRGNLETLSVRYAF* |
| Ga0134128_112820211 | 3300010373 | Terrestrial Soil | RGWTGKAYWGYYGYHEDPSLVPQDLAAPRNFRGNLVTLSMRYAF* |
| Ga0126381_1000514861 | 3300010376 | Tropical Forest Soil | TGKAYWDYYSYHEDPTVSATTGATIAQDQFAPRNFRGNLVTLSVRYAF* |
| Ga0134122_114446071 | 3300010400 | Terrestrial Soil | ERWTGKAYWGYYGYHEDPSAVAQDLFAPRNFRGNLITLSMRYAF* |
| Ga0126350_115321431 | 3300010880 | Boreal Forest Soil | GKAFWDYYGYHEDPTFGTVGGEAVQDIYAPRNFRGNLYTLSVRYAF* |
| Ga0138565_10608631 | 3300011078 | Peatlands Soil | GYHEDPTYGITGAEAVQDIYAPRNFRGNLYTLSVKYAF* |
| Ga0150983_105790221 | 3300011120 | Forest Soil | YKFSKNWTGKAFWDYYGYHEDPTFGAGGEAVQDIYAPRNFRGNLYTLSARYAF* |
| Ga0150983_125515963 | 3300011120 | Forest Soil | GRFYWDYYGYHEDPTAGAVQDVYAPRNFRANLVTLSIRYAF* |
| Ga0150983_134723421 | 3300011120 | Forest Soil | YHEDPTFGTGGEAVQDLFAPRNFRGNLVTLSLRYAF* |
| Ga0150983_137468051 | 3300011120 | Forest Soil | EDPTFGITGAEAVQDIYAPRNFRGNLYTLSVKYAF* |
| Ga0150983_147912031 | 3300011120 | Forest Soil | WTGKAFWDYYGYHEDPTFGAGTEAAEDIYAPRNFRGNLYTLSLKYAF* |
| Ga0137388_105265663 | 3300012189 | Vadose Zone Soil | FDYRFAKGWTGKAFWDYYGYHEDPTTWAVQDTLAPRNFRGSLVTLSVRYAF* |
| Ga0137363_111920553 | 3300012202 | Vadose Zone Soil | WGYCGYHEDLTALSQDVFAPRGFHANTTTLSLRYAF* |
| Ga0137380_102917361 | 3300012206 | Vadose Zone Soil | WTGKAYWDYYGYHEDPTSGAVQDIFAARNFRGNLVTLSVRYAF* |
| Ga0137386_101937211 | 3300012351 | Vadose Zone Soil | WTGKAYWDYYGYHEDPTTGAVQDLFAPRNFRGNLVTLSVRYAF* |
| Ga0137386_103630943 | 3300012351 | Vadose Zone Soil | YHEDPAVSTATGAIISQDVLAPRNFRGNLVTLSVKYAF* |
| Ga0150984_1097857192 | 3300012469 | Avena Fatua Rhizosphere | GRAYWGYYGYHEDPDNVFQDIFAPRNFRANLVTLSLRYAF* |
| Ga0157288_101011453 | 3300012901 | Soil | RWVAKAYWAYHGYHEDPDAGVVQDIFAPRNFHANLVTISLRYMF* |
| Ga0137410_109705492 | 3300012944 | Vadose Zone Soil | TGKAFWSYYNYHEDPTAAFQDIFAPRNFHGNLVTLSVRYAF* |
| Ga0132258_121389421 | 3300015371 | Arabidopsis Rhizosphere | RGYWGFYNYHEDQDSVFQDIFAPRNFRGNLVTLSIRYAF* |
| Ga0132258_133168713 | 3300015371 | Arabidopsis Rhizosphere | KAYWGYYGYHEDSSGVPQDIFVPRNFQSNLVTLSVRYAF* |
| Ga0182036_111421082 | 3300016270 | Soil | WTGKAYYEYYGYHEDPTVSTATGAIIPQDLLAPRNFRGNLVTLSVRYAF |
| Ga0187824_101034173 | 3300017927 | Freshwater Sediment | WDYYGYHEDPTFGAGTIAVQDIYSPRNFRGNLYTLSVRYAF |
| Ga0187824_101931231 | 3300017927 | Freshwater Sediment | ENWTGKAYWDYYGYHEDPTAGAVQDILAPRNFRGNLFTLSVRYSF |
| Ga0187781_105445562 | 3300017972 | Tropical Peatland | WNYYGYHEDFTDVPQDIYAPRNFHANLFLLSARYAF |
| Ga0193756_10599082 | 3300019866 | Soil | KAYWGYYGYHEDLTALPQDVFAPRNFRGNMVTLSLRYAF |
| Ga0193717_10265801 | 3300020060 | Soil | YRFAKHWVGKAFWGYYGYHEDPSDVVQDAFAPRNFRANLVTLSLRYAF |
| Ga0210407_104624243 | 3300020579 | Soil | KAYWGYYGYHEDQDNVVQDVFAPRNFRANLVTLSLRYAF |
| Ga0210399_110674961 | 3300020581 | Soil | KSWTGKAYWDYYGYHEDPTAGAVQDIFAARNFRGNLVTLSVRYAF |
| Ga0210393_106539311 | 3300021401 | Soil | KAFWDYYGYHEDPTFGTVGGEAVQDILAPRNFRGNLYTLSVRYAF |
| Ga0210387_114811782 | 3300021405 | Soil | GRVYWGYYGYHEDESNVVQDVFAPRNFRANLVTLSLRYAF |
| Ga0210387_116551591 | 3300021405 | Soil | LWNYYSYHEDSTAAYQNVFAPRNFHANNVTLSVRYAF |
| Ga0210386_106075883 | 3300021406 | Soil | KGLTGRVYWGYYGYHEDESNDVQDVFAPRNFRANLVTLSLRYAF |
| Ga0210383_102513241 | 3300021407 | Soil | TGRVYWGYYGYHEDESNVVQDVFAPRNFRANLVTLSLRYAF |
| Ga0210383_104686242 | 3300021407 | Soil | MKGLTGRVYWGYYGYHEDESNVVQDVFAPRNFRANLVTLSL |
| Ga0210394_1001234910 | 3300021420 | Soil | YGYHEDPTLGAGTAAVQDIFAPRNFRGNLYTLSIKYAF |
| Ga0210402_100946931 | 3300021478 | Soil | AYWGYYGYHEDASDVVQDTFAPRNFRANLVTLSLRYAF |
| Ga0210402_101989833 | 3300021478 | Soil | WSYYSYHEDSTAAFQDVFAPRNFHGNLVTLSVRYAF |
| Ga0210410_118082211 | 3300021479 | Soil | DYQFAKSWTGKAYWDYYGYHEDPTAGAVQDIFAARNFRGNLVTLSVRYAF |
| Ga0210409_103319321 | 3300021559 | Soil | YWGYYGYHEDPSLVPQDLVAPRNFRGNLVTLSMRYAF |
| Ga0210409_116576111 | 3300021559 | Soil | VAKSWTGKAYWGYYGYHEDLTALTQDAFAPRNFRGNTVTLSLRYVF |
| Ga0213853_110772043 | 3300021861 | Watersheds | SKQWTGKAFWDYYGYHEDATFGTGNAEAVQDIYAPRNFRGNLYTLSVKYAF |
| Ga0242642_10926692 | 3300022504 | Soil | GKSFWSYYSYHEDSTAAFQDVFAPRNFHGNLVTLSVRYAF |
| Ga0242660_12129761 | 3300022531 | Soil | GGFEYHFAKQWTGKAYWDYYGYHEDPTAGAEQDIFAPRNFRGNLVTLSVRYAF |
| Ga0242654_102454291 | 3300022726 | Soil | AGKALWDYYGYHEDPTFGAGGEAVIDVFAPRNFRGNLVTLSLRYAF |
| Ga0247669_10300173 | 3300024182 | Soil | WTGKAYWDYYGYHEDPTAGAVQDVFVPRNFRGNLVTLSLRYSF |
| Ga0207707_101789196 | 3300025912 | Corn Rhizosphere | YGGFDYRFSKQWTGKFFWDYYGYHEDPTIGAGTIAAQDLFSPRNFRGNLVTLSVRYAF |
| Ga0207663_112991982 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | GGLDYQFAKSWTGKAYWDYYGYHEDPTAGAVQDILAARNFRGNLVTLSVRYAF |
| Ga0207646_107174081 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | WAGKALWDYYGYHEDPTFGAGGEAVIDVFAPRNFRGNLVTLSLRYAF |
| Ga0207700_100811391 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LGRNWTGRAYWGYYGYHEDLTALSQDVFAPRGFHANTTTLSLRYAF |
| Ga0207700_106779013 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | GLEYKFSKEFTGKAYWDYFGYHEDPSTGAVIDIFAPRNFRANLITLSLRYAF |
| Ga0207669_114706692 | 3300025937 | Miscanthus Rhizosphere | YWGYYGYHEDPSAVAQDLFAPRNFRGNLITLSMRYAF |
| Ga0209215_10367572 | 3300027266 | Forest Soil | RWDYYGYREDLNNSPQDVFAPRNFRGNVVTLSVGYAF |
| Ga0208199_11120142 | 3300027497 | Peatlands Soil | EDATFGTGGAEAAQDIYAPRNFRGNLYTLSLKYAF |
| Ga0209735_10162361 | 3300027562 | Forest Soil | RKEWTGKAFWDYYGYHEDPTFGTTDGEAVQDIYAPRNFRGNLYTLSIRYAF |
| Ga0209219_11785521 | 3300027565 | Forest Soil | YHEDATFGTAGEAVQDIYAPRNFRGNLYTLSVRYAF |
| Ga0209733_11656502 | 3300027591 | Forest Soil | DYYGYHEDPTTGAVQDIFAPRNFRGNLVTLSVRYAF |
| Ga0209810_12235663 | 3300027773 | Surface Soil | EWTGKAYWDYYGYHEDSSVGEVQDILAPRNFRGNLVTLSVRYAF |
| Ga0209180_107917922 | 3300027846 | Vadose Zone Soil | YYGYHEDPTTGAVQDIFVARNFRGNLFTLSVRYAF |
| Ga0209693_105368651 | 3300027855 | Soil | GFEYRFSKGWTGKAFWDYYGYHEDPTLGTGGEAAQDIFAARNFRGNLYTLSARYAF |
| Ga0209590_108893971 | 3300027882 | Vadose Zone Soil | DYYGYHEDPTRGAVQDSFAPRNFRGNLVTLSVRYAF |
| Ga0209380_108409991 | 3300027889 | Soil | GKAYWDYYGYHEDPTFGTGGEAVQDIFAPRNFRGNLVTLSLRYAF |
| Ga0209068_101597091 | 3300027894 | Watersheds | GYYGYHEDPDNVIQDIFAPRNFRANLVTISLRYAF |
| Ga0247689_10546211 | 3300028281 | Soil | AGLDYRFAKNWTGRGYWGFYNYHEDQDSVFQDIFAPRNFRGNLVTLSIRYAF |
| Ga0308309_115031482 | 3300028906 | Soil | KALWDYYGYHEDPTFGTGGEAPIDVFAPRNFRGNLVTLSVRYAF |
| Ga0170824_1153082623 | 3300031231 | Forest Soil | WSYYTYHEDPTAANQDVFASRNFHGNLVTLSLRYAF |
| Ga0265340_101771081 | 3300031247 | Rhizosphere | YRFAKSWTGKAFWDYYGYHEDPTFGTTGAEAVQDIFAPRNFRGNLYTLSVRYAF |
| Ga0170819_158299322 | 3300031469 | Forest Soil | GRAYWGYYGYHEDSDNVVQDIFAPRNFRANLVTLSLRYAF |
| Ga0170818_1018729751 | 3300031474 | Forest Soil | RFAKNWVGRAYWGFYNYHEDQDSVFQDIFAPRNFRGNLVTLSIRYAF |
| Ga0307469_101100621 | 3300031720 | Hardwood Forest Soil | GLTGKAYWGYYGYHEDPSLVPQDLVAPRNFRGNLVTLSMRYAF |
| Ga0307469_105002893 | 3300031720 | Hardwood Forest Soil | YRDYYGYHEDPTAGAVQDLFAPRNFRGNLVTLSVRYAF |
| Ga0307475_103793121 | 3300031754 | Hardwood Forest Soil | WTGRAYWGYYGYHEDASSVVQDFLAPRNFRANLVTLSLRYAF |
| Ga0307475_103930193 | 3300031754 | Hardwood Forest Soil | HFAKDWTAKAYWDYYGYHEDPTPGTGQDVFAPRNFRANLVTLSVRYAF |
| Ga0307479_103797874 | 3300031962 | Hardwood Forest Soil | KNWTGKAYWDYYGYHEDPTVSATTGAIIPQDLLAPRNFRGNLVTLSVKYAF |
| Ga0335082_104395741 | 3300032782 | Soil | WTGKADWDYYGYHEDPTPGAVQDQFAPRNFQGNLVTLSVRYAF |
| Ga0335069_122428732 | 3300032893 | Soil | HWTGRAFWEYYGYHEDATAAYQDVYASRNFRGNLVTLSVRYAF |
| Ga0335084_117930312 | 3300033004 | Soil | YRIARQWTGKADWDYYGYHEDPTPGAVQDQFAPRNFQGNLITLSVRYAF |
| Ga0335073_112187891 | 3300033134 | Soil | AFWDYYSYHEDPTAAYQDVYASRNFHGNLFTLSVRYAF |
| Ga0310914_103563884 | 3300033289 | Soil | YYGYHEDPTVSAATGAIISQDLLAPRNFRGNLVTLSVKYAF |
| ⦗Top⦘ |