


| Basic Information | |
|---|---|
| Family ID | F077681 |
| Family Type | Metagenome |
| Number of Sequences | 117 |
| Average Sequence Length | 45 residues |
| Representative Sequence | ESMITGFHERFNPQGIKNRDAKPYLDPSFVQKAVERLKLGKK |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 14.53 % |
| % of genes near scaffold ends (potentially truncated) | 82.05 % |
| % of genes from short scaffolds (< 2000 bps) | 88.03 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.145 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (13.675 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.624 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.462 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.00% β-sheet: 0.00% Coil/Unstructured: 80.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF09084 | NMT1 | 9.40 |
| PF07690 | MFS_1 | 6.84 |
| PF13379 | NMT1_2 | 5.98 |
| PF00924 | MS_channel | 5.13 |
| PF07883 | Cupin_2 | 3.42 |
| PF00330 | Aconitase | 2.56 |
| PF00753 | Lactamase_B | 2.56 |
| PF13439 | Glyco_transf_4 | 1.71 |
| PF07995 | GSDH | 1.71 |
| PF03401 | TctC | 0.85 |
| PF00196 | GerE | 0.85 |
| PF05378 | Hydant_A_N | 0.85 |
| PF02775 | TPP_enzyme_C | 0.85 |
| PF00903 | Glyoxalase | 0.85 |
| PF02696 | SelO | 0.85 |
| PF02457 | DAC | 0.85 |
| PF00890 | FAD_binding_2 | 0.85 |
| PF02776 | TPP_enzyme_N | 0.85 |
| PF01613 | Flavin_Reduct | 0.85 |
| PF00857 | Isochorismatase | 0.85 |
| PF00483 | NTP_transferase | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 9.40 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 9.40 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 5.13 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 5.13 |
| COG0145 | N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunit | Amino acid transport and metabolism [E] | 1.71 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 1.71 |
| COG0397 | Protein adenylyltransferase (AMPylase) SelO/YdiU (selenoprotein O) | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.85 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.85 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.85 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.15 % |
| Unclassified | root | N/A | 0.85 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101352175 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300000559|F14TC_100086558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 592 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10001997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter algicola | 5349 | Open in IMG/M |
| 3300000955|JGI1027J12803_100945773 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300000955|JGI1027J12803_103447326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 758 | Open in IMG/M |
| 3300001372|YBBDRAFT_1016730 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 816 | Open in IMG/M |
| 3300003996|Ga0055467_10028704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1315 | Open in IMG/M |
| 3300003999|Ga0055469_10021704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1480 | Open in IMG/M |
| 3300004051|Ga0055492_10010624 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
| 3300004633|Ga0066395_10281493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 903 | Open in IMG/M |
| 3300005181|Ga0066678_10687294 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300005328|Ga0070676_11366746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300005332|Ga0066388_103351550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 818 | Open in IMG/M |
| 3300005366|Ga0070659_101595346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 582 | Open in IMG/M |
| 3300005518|Ga0070699_100420884 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300005719|Ga0068861_100425609 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300005764|Ga0066903_100512992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2037 | Open in IMG/M |
| 3300005764|Ga0066903_105447602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 671 | Open in IMG/M |
| 3300005873|Ga0075287_1005076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1562 | Open in IMG/M |
| 3300005875|Ga0075293_1017480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 884 | Open in IMG/M |
| 3300005876|Ga0075300_1068437 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300005885|Ga0075284_1052809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 573 | Open in IMG/M |
| 3300005895|Ga0075277_1073160 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300005937|Ga0081455_10172166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1648 | Open in IMG/M |
| 3300006173|Ga0070716_100514263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 886 | Open in IMG/M |
| 3300006844|Ga0075428_101824364 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300006845|Ga0075421_102515833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300006846|Ga0075430_101589790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300006854|Ga0075425_101040597 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300006871|Ga0075434_102073038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 574 | Open in IMG/M |
| 3300006894|Ga0079215_10001177 | All Organisms → cellular organisms → Bacteria | 6617 | Open in IMG/M |
| 3300006904|Ga0075424_100902596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 943 | Open in IMG/M |
| 3300006969|Ga0075419_10313568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1060 | Open in IMG/M |
| 3300007004|Ga0079218_10840865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 890 | Open in IMG/M |
| 3300007076|Ga0075435_100929758 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300007076|Ga0075435_101616672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300009100|Ga0075418_11761600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 673 | Open in IMG/M |
| 3300009100|Ga0075418_13058759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 510 | Open in IMG/M |
| 3300009147|Ga0114129_12313313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 645 | Open in IMG/M |
| 3300009156|Ga0111538_13109302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 579 | Open in IMG/M |
| 3300009174|Ga0105241_11738272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300010043|Ga0126380_11732981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 562 | Open in IMG/M |
| 3300010360|Ga0126372_10803573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 932 | Open in IMG/M |
| 3300010360|Ga0126372_11537788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 702 | Open in IMG/M |
| 3300010397|Ga0134124_12977153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300010400|Ga0134122_10937424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 842 | Open in IMG/M |
| 3300010403|Ga0134123_10806832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 933 | Open in IMG/M |
| 3300011406|Ga0137454_1073712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 576 | Open in IMG/M |
| 3300011419|Ga0137446_1121224 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300011422|Ga0137425_1130465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 622 | Open in IMG/M |
| 3300011427|Ga0137448_1004789 | All Organisms → cellular organisms → Bacteria | 2585 | Open in IMG/M |
| 3300011431|Ga0137438_1253227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300011436|Ga0137458_1102164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 825 | Open in IMG/M |
| 3300011445|Ga0137427_10176285 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300012189|Ga0137388_11431426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 629 | Open in IMG/M |
| 3300012201|Ga0137365_11176738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 549 | Open in IMG/M |
| 3300012354|Ga0137366_11031101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 570 | Open in IMG/M |
| 3300012358|Ga0137368_10062900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 3055 | Open in IMG/M |
| 3300012685|Ga0137397_10092644 | All Organisms → cellular organisms → Bacteria | 2208 | Open in IMG/M |
| 3300012922|Ga0137394_10949646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 716 | Open in IMG/M |
| 3300012930|Ga0137407_11347974 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → environmental samples → uncultured Verrucomicrobiota bacterium | 678 | Open in IMG/M |
| 3300012944|Ga0137410_10908642 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300012944|Ga0137410_11221021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 648 | Open in IMG/M |
| 3300012986|Ga0164304_10403323 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300013297|Ga0157378_10719688 | Not Available | 1019 | Open in IMG/M |
| 3300014271|Ga0075326_1037188 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300014301|Ga0075323_1002906 | All Organisms → cellular organisms → Bacteria | 2502 | Open in IMG/M |
| 3300014866|Ga0180090_1101362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300014878|Ga0180065_1158403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 521 | Open in IMG/M |
| 3300015373|Ga0132257_100914285 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300015373|Ga0132257_104637734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300015374|Ga0132255_105071286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300016387|Ga0182040_10231946 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
| 3300016404|Ga0182037_11008757 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300016422|Ga0182039_11965273 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300018072|Ga0184635_10064340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1427 | Open in IMG/M |
| 3300018072|Ga0184635_10252947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 697 | Open in IMG/M |
| 3300018074|Ga0184640_10052824 | All Organisms → cellular organisms → Bacteria | 1684 | Open in IMG/M |
| 3300018082|Ga0184639_10245102 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300018432|Ga0190275_10733682 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300019377|Ga0190264_11015875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 665 | Open in IMG/M |
| 3300020186|Ga0163153_10012768 | All Organisms → cellular organisms → Bacteria | 7782 | Open in IMG/M |
| 3300020186|Ga0163153_10057157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2598 | Open in IMG/M |
| 3300021081|Ga0210379_10270998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 739 | Open in IMG/M |
| 3300022756|Ga0222622_10062440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 2157 | Open in IMG/M |
| 3300022756|Ga0222622_10662624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 756 | Open in IMG/M |
| 3300025159|Ga0209619_10021738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13 | 4237 | Open in IMG/M |
| 3300025792|Ga0210143_1072905 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300025907|Ga0207645_10907161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300025917|Ga0207660_10219835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1490 | Open in IMG/M |
| 3300025919|Ga0207657_10023607 | All Organisms → cellular organisms → Bacteria | 5722 | Open in IMG/M |
| 3300025922|Ga0207646_11811482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300025923|Ga0207681_11090407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 670 | Open in IMG/M |
| 3300025939|Ga0207665_11574716 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300025992|Ga0208775_1001073 | All Organisms → cellular organisms → Bacteria | 1707 | Open in IMG/M |
| 3300025993|Ga0208415_1005898 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300026003|Ga0208284_1025382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300026020|Ga0208531_1014528 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300026053|Ga0208422_1046941 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300026095|Ga0207676_12563990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300027326|Ga0209731_1056315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 600 | Open in IMG/M |
| 3300027637|Ga0209818_1051738 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300027731|Ga0209592_1213225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 677 | Open in IMG/M |
| 3300027907|Ga0207428_10660723 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300027909|Ga0209382_10038434 | All Organisms → cellular organisms → Bacteria | 5742 | Open in IMG/M |
| 3300027909|Ga0209382_10183867 | All Organisms → cellular organisms → Bacteria | 2403 | Open in IMG/M |
| 3300028814|Ga0307302_10406918 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300028884|Ga0307308_10497968 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1078928 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300031720|Ga0307469_11109248 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300032174|Ga0307470_10371056 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300032180|Ga0307471_100291381 | All Organisms → cellular organisms → Bacteria | 1713 | Open in IMG/M |
| 3300032180|Ga0307471_100709776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1170 | Open in IMG/M |
| 3300033419|Ga0316601_100549384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1116 | Open in IMG/M |
| 3300034165|Ga0364942_0234827 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300034177|Ga0364932_0183124 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300034354|Ga0364943_0143113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 858 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 13.68% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 7.69% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.69% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 7.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.27% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.42% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.42% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.42% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.56% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.56% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.56% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.56% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 1.71% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.71% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.85% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.85% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.85% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.85% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.85% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001372 | YB-Back-sed | Environmental | Open in IMG/M |
| 3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
| 3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004051 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005873 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 | Environmental | Open in IMG/M |
| 3300005875 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 | Environmental | Open in IMG/M |
| 3300005876 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 | Environmental | Open in IMG/M |
| 3300005885 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401 | Environmental | Open in IMG/M |
| 3300005895 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011406 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2 | Environmental | Open in IMG/M |
| 3300011419 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2 | Environmental | Open in IMG/M |
| 3300011422 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2 | Environmental | Open in IMG/M |
| 3300011427 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2 | Environmental | Open in IMG/M |
| 3300011431 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2 | Environmental | Open in IMG/M |
| 3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
| 3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014271 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2 | Environmental | Open in IMG/M |
| 3300014301 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014866 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT890_16_10D | Environmental | Open in IMG/M |
| 3300014878 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10D | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300020186 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP6.IB-1 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
| 3300025792 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025992 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104 (SPAdes) | Environmental | Open in IMG/M |
| 3300025993 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 (SPAdes) | Environmental | Open in IMG/M |
| 3300026003 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 (SPAdes) | Environmental | Open in IMG/M |
| 3300026020 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 (SPAdes) | Environmental | Open in IMG/M |
| 3300026053 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027731 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1013521751 | 3300000364 | Soil | FHERFNPQGIKNRDAKPYLDPSFVQKAAERLKLDKK* |
| F14TC_1000865582 | 3300000559 | Soil | TGFHERFNPQGIKNRDASAALDASFVQKAAERLKFGKK* |
| AF_2010_repII_A1DRAFT_100019973 | 3300000597 | Forest Soil | MRFNPQGIRNRDAKLYLDPSFVQKAAERLKLDKK* |
| JGI1027J12803_1009457732 | 3300000955 | Soil | IEGMITGFHERFNPQGIKNRDAKPYLDPSFVQKAAERLKLDKK* |
| JGI1027J12803_1034473262 | 3300000955 | Soil | IEGMITGFHERFNPQGIKNRDARPYLDPSFVQKAAERLKLDKSRQ* |
| YBBDRAFT_10167301 | 3300001372 | Marine Estuarine | FHERFNPQGIKNRDASGSLDPSFVQKAAERLKLGKK* |
| Ga0055467_100287042 | 3300003996 | Natural And Restored Wetlands | VSTPWEAGFESMITGFYERFNPQGIKNRDAKPYLDPSFVQKALERLKLGKK* |
| Ga0055469_100217042 | 3300003999 | Natural And Restored Wetlands | VSTPWEAGFESMITGFHERFNPQGIKNRDAKPYLDPSFVQKALERLKLGKK* |
| Ga0055492_100106241 | 3300004051 | Natural And Restored Wetlands | LPWQAGIESMITGFHERFNPQGIKNRDASAALDAGFVQKAAERLKLGKK* |
| Ga0066395_102814931 | 3300004633 | Tropical Forest Soil | WEAGIESMITGFHERFNPQGIKNHDPKPFLDPSFVQKAVERLKLGKK* |
| Ga0066678_106872942 | 3300005181 | Soil | FPWQSGIEGMITGFHERFNPQGIKNRDAKPYLDPSFVQKAAERLKLDKK* |
| Ga0070676_113667461 | 3300005328 | Miscanthus Rhizosphere | GIEGMITGFHERFNPQGIKNRDARPYLDPYFVQKAAERLRLDKK* |
| Ga0066388_1033515502 | 3300005332 | Tropical Forest Soil | GIESMITGFHERFNPQGIKNHDPKPFLDPSFVQKAVERLKLGKK* |
| Ga0070659_1015953461 | 3300005366 | Corn Rhizosphere | EAGIESMITGFHERFNPQGIRNRDAKAFIDASFVQKAAERLKLGGTNRP* |
| Ga0070699_1004208841 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | EGMITGFHERFNPQGIRNRDAKPYLDPSFVQKAAERLKLDKK* |
| Ga0068861_1004256091 | 3300005719 | Switchgrass Rhizosphere | DAIGGIPIPWEAGIESMITGFHERFNPQGIKNRDAKPYLDPTFVQKAVERLKLGKK* |
| Ga0066903_1005129921 | 3300005764 | Tropical Forest Soil | ESMINGYHARFTPAVVKNRDARPFLDASFVQRAVERAGIGKKP* |
| Ga0066903_1054476022 | 3300005764 | Tropical Forest Soil | EAGIESMISGFHERFNPQGIKNHDPKPFLDPSFVQKAVERLKLGKK* |
| Ga0075287_10050762 | 3300005873 | Rice Paddy Soil | VSTPREAGFESMITGFYERFNPQGIKNRDAKPYLDPSFVQKALERLKLGKK* |
| Ga0075293_10174802 | 3300005875 | Rice Paddy Soil | VSTPREAGFESMITGFYERFNPQGIKNRDAEPYLDPSFVQKALERLKLGKK* |
| Ga0075300_10684371 | 3300005876 | Rice Paddy Soil | ESMITGFHERFNPQGIKNRDAKPYLDPSFVQKALERLKLGKK* |
| Ga0075284_10528091 | 3300005885 | Rice Paddy Soil | IDGLPYPWEAGIEQMITGFHRRFNPQIVKNTDVKPYLDSTFVRTAAERLGLSKK* |
| Ga0075277_10731602 | 3300005895 | Rice Paddy Soil | FYERFNPQGIKNRDAKPYLDPSFVQKALERLKLGKK* |
| Ga0081455_101721663 | 3300005937 | Tabebuia Heterophylla Rhizosphere | FHERFNPQGIKNHDATPFLDPSFVQKAVERLKLSKK* |
| Ga0070716_1005142632 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MITGFHERFNPQGIRNRDAKPYLDPSFVQKAAERLKLDKK* |
| Ga0075428_1018243642 | 3300006844 | Populus Rhizosphere | GIESMITGFHERFNPQGIKNHDAKPFLDPSFVQKAVERLKLGKK* |
| Ga0075421_1025158331 | 3300006845 | Populus Rhizosphere | MISGFHERFNPQGIKNRDARSYLDPSFVQKAAERLRLDKK* |
| Ga0075430_1015897902 | 3300006846 | Populus Rhizosphere | VRWEAGIESMITGFHERFNPQGIKNRDAKSFLDASFVQKAVERLKLGKK* |
| Ga0075425_1010405973 | 3300006854 | Populus Rhizosphere | HERFTPQGIRNRDAKAFIDASFVQKAAERLKLGGTNRP* |
| Ga0075434_1020730381 | 3300006871 | Populus Rhizosphere | GIEGMITGFHERFNPQGIKNRDARPYLDPSFVQKAAERLKLDKSRQ* |
| Ga0079215_100011775 | 3300006894 | Agricultural Soil | LPWQAGIESMITGFHERFNPQGIKNRDARPFLDPSFVQRAVERLKLGKK* |
| Ga0075424_1009025961 | 3300006904 | Populus Rhizosphere | WEAGIESMITGFHERFNPQGIRNRDAKGFVDPSFVQRAAERLKLGRSNRP* |
| Ga0075419_103135682 | 3300006969 | Populus Rhizosphere | EAGIESMITGFHERFNPQGIKNHDAKPFLDPSFVQKAVERLKLGKK* |
| Ga0079218_108408652 | 3300007004 | Agricultural Soil | MITGFRERFNPQGIKNRDARPFLDPSFVQKAAERLKLGKK* |
| Ga0075435_1009297581 | 3300007076 | Populus Rhizosphere | GFHERFNPQGIRNRDAKPYLDPSFVQKAAERLKLDKK* |
| Ga0075435_1016166722 | 3300007076 | Populus Rhizosphere | GVPVRWEAGIESMITGFHERFNPQGIKNRDAKSFLDASFVQKAVERLKLGKK* |
| Ga0075418_117616001 | 3300009100 | Populus Rhizosphere | RFNPQGIRNRDAKGSIDASFVQRAAERLKLQKSKP* |
| Ga0075418_130587591 | 3300009100 | Populus Rhizosphere | IEGMITGFHERFNPQGIKNRDAKPFLDPSFVQKAAERLKLDKK* |
| Ga0114129_123133132 | 3300009147 | Populus Rhizosphere | MITGFHERFNPQGIKNRDAKSFLDASFVQKAVERLKLGKK* |
| Ga0111538_131093022 | 3300009156 | Populus Rhizosphere | MITGFHERFNPQGIKNREAKPYLDPSFVQKAVERLKLGKK* |
| Ga0105241_117382721 | 3300009174 | Corn Rhizosphere | ITGFHERFNPQGTRNRDAKAFIDASFVQKAAERLKLERTNRP* |
| Ga0126380_117329812 | 3300010043 | Tropical Forest Soil | ERFNPQGIKNHDPKPFLDPSFVQKAVERLKLGKK* |
| Ga0126372_108035732 | 3300010360 | Tropical Forest Soil | FHERFNPQGIKNHDPKPFLDPSFVQKAVERLKLGKK* |
| Ga0126372_115377882 | 3300010360 | Tropical Forest Soil | VCRFQEAGIESMITGFHERFNPQGIKNRNAKPFIDPSFVQRAAERLKLVKSDRS* |
| Ga0134124_129771531 | 3300010397 | Terrestrial Soil | WEAGIESMITGFHERFNPQGIRNRDAKAFIDASFVQKAAERLKLGGTNRP* |
| Ga0134122_109374241 | 3300010400 | Terrestrial Soil | AGIESMITGFHERFNPQGIKNRDARPYLDPSFVQKAAERLKLERK* |
| Ga0134123_108068322 | 3300010403 | Terrestrial Soil | FHERFNPQGIRNRDAKAFIDASFVQKAAERLKLGRTNRP* |
| Ga0137454_10737122 | 3300011406 | Soil | MLENEYGSLPWQAGIESMITGFHERFNPQGIKNRDASSSLDASFVQKAAERLKLGKK* |
| Ga0137446_11212242 | 3300011419 | Soil | GIEGMITGFHERFNPQGIKNRDARPFLDSSFVQKAAERLKLDKK* |
| Ga0137425_11304651 | 3300011422 | Soil | NGFHARFTPALIKNRDARPYLDPSFVQRAVERLGLVKK* |
| Ga0137448_10047891 | 3300011427 | Soil | GLPFPWQAGIEGMITGFHERFNPQGIKNRDARPFLDSSFVQKAAERLKLDKK* |
| Ga0137438_12532271 | 3300011431 | Soil | GGLPFPWQAGIEGMITGFHERFNPQGIKNHDAKPFLDPSFVQRAAERLKLDRK* |
| Ga0137458_11021641 | 3300011436 | Soil | GLPFPWQAGIEGMITGFHERFNPQGIKNRDARPYLDSSFVQKAAERLRLDKK* |
| Ga0137427_101762853 | 3300011445 | Soil | PWQAGIEGMITGFHERFNPQGIKNRDAKPYLDSSFVQKAAERLKLDKK* |
| Ga0137388_114314261 | 3300012189 | Vadose Zone Soil | GYHARFTPAVVKNRDARPFLDPSFVQRAVDRLGLSRKQ* |
| Ga0137365_111767382 | 3300012201 | Vadose Zone Soil | GGLPFPWQSVIEGMITGFHERFNPQGIKNRDARPYLDPSFVQKAAERLKLDKSRQ* |
| Ga0137366_110311012 | 3300012354 | Vadose Zone Soil | QSGIEGMITGFHERFNPQGIKNRDARPYLDPSFVQKAAERLKLDKSRQ* |
| Ga0137368_100629003 | 3300012358 | Vadose Zone Soil | WEAGIESMISGFHERFNPQGIKNHDAKPFLDPSFVQKAVERLKLGKK* |
| Ga0137397_100926441 | 3300012685 | Vadose Zone Soil | TGFHERFSPQGIKNRDAKPYLDPSFVQKAVERLKLGKK* |
| Ga0137394_109496462 | 3300012922 | Vadose Zone Soil | GGLPFPWQSGIEGMITGFHERFNPQGIKNRDARPYLDPSFVQKAAERLKLDKSRQ* |
| Ga0137407_113479741 | 3300012930 | Vadose Zone Soil | PWEAGIESMITGFHERFNPQGIKNRDAKPYLDPTFVQKAVERLKLGKK* |
| Ga0137410_109086422 | 3300012944 | Vadose Zone Soil | HERFNPQGIKNRDAKPYLDPSFVQKAVERLKLGKK* |
| Ga0137410_112210211 | 3300012944 | Vadose Zone Soil | EGIESMINGFHGRFSPTVVKNRDARPYLDPSFVQRAVERLGLAKK* |
| Ga0164304_104033232 | 3300012986 | Soil | GGIPIPWEAGIESMITGFHERFSPQGIKNRDAKPYLDPTFVQKAVERLKLGKK* |
| Ga0157378_107196881 | 3300013297 | Miscanthus Rhizosphere | RFNPQGTRNRDAKAFIDASFVQKAAERLKLGRTDRP* |
| Ga0075326_10371883 | 3300014271 | Natural And Restored Wetlands | ESMITGFHERFNPQGVKNRDAKPYLDPSFVQNAVERLKLNKK* |
| Ga0075323_10029062 | 3300014301 | Natural And Restored Wetlands | VSTPWEAGFESMITRFYERFNPQGIKNRDAKPYLDPSFVQKALERLKLGKK* |
| Ga0180090_11013622 | 3300014866 | Soil | PFPWQEGIESMINGFHARFTPALVKNRDARPYLDPSFVQRAVDRLGLAKK* |
| Ga0180065_11584032 | 3300014878 | Soil | MLENENGPLPWQAGIEGMITGLHERVNPQGIENRDASASLDGSFVQK |
| Ga0132257_1009142852 | 3300015373 | Arabidopsis Rhizosphere | IESMITGFHERFNPQGIKNREAKPYLDPSFVQKAVERLKLGRK* |
| Ga0132257_1046377341 | 3300015373 | Arabidopsis Rhizosphere | IESMITGFHERFNPQGIKNRDAKPYLDPSFVQKAVEQLKLGKK* |
| Ga0132255_1050712862 | 3300015374 | Arabidopsis Rhizosphere | GIPIPWEAGIESMITGFHERFNPQGIKNRDAKPYLDPSFVQKAVERLKLGKK* |
| Ga0182040_102319462 | 3300016387 | Soil | QSGIEGMITGFHERFNPQGIKNHDAKPYLDPSFVQRAAERLKLDKK |
| Ga0182037_110087572 | 3300016404 | Soil | FHERFNPQGIKNRDAKPYLDPSFVQKAAERLKLDKK |
| Ga0182039_119652732 | 3300016422 | Soil | GFHERFNPQGIKNRDAKPYLDPSFVQKAAERLKLDKK |
| Ga0184635_100643401 | 3300018072 | Groundwater Sediment | EGMITGFHERFNPQGIKNRDARPYLDPFFVQKAAERLKLNKSRQ |
| Ga0184635_102529471 | 3300018072 | Groundwater Sediment | FPWQSGIEGMITGFHERFNPQGIKNRDARPYLDPSFVQKAAERLKLDKGRQ |
| Ga0184640_100528242 | 3300018074 | Groundwater Sediment | MITGFHERFNPQGIKNRDARPYLDSSFVQKAAERLKLDKK |
| Ga0184639_102451022 | 3300018082 | Groundwater Sediment | FHERFNPQGIKNRDARAYLDSSFVQRAAERLKLDKK |
| Ga0190275_107336822 | 3300018432 | Soil | FGIESMITGFHERFNPQGIKNREAKAFVGPTFVQKATERLKLSGK |
| Ga0190264_110158751 | 3300019377 | Soil | MITGFHERFNPQGIKNRDAKPFLDPSFVQKAVERLKLKK |
| Ga0163153_100127682 | 3300020186 | Freshwater Microbial Mat | MITGFHERFNPHGIKNRDAWASLDASFVQKTAERLKLKK |
| Ga0163153_100571574 | 3300020186 | Freshwater Microbial Mat | MITGFHERFNPQGIKNRDASASLDASFVQKAAERLKLGKR |
| Ga0210379_102709982 | 3300021081 | Groundwater Sediment | PWQSGIEGMITGFHERFNPQGIKNRDARPYLDPSFVQKAAERLKLDKSRR |
| Ga0222622_100624401 | 3300022756 | Groundwater Sediment | ISGFHERFNPLGIKNRDAKPFLDPSFVQKAVERLKLSQK |
| Ga0222622_106626242 | 3300022756 | Groundwater Sediment | GLPFPWQSGIEGMITGFHERFNPQGIKNRDARPYLDPSFVQKAAERLKLDKSRQ |
| Ga0209619_100217381 | 3300025159 | Soil | ITGFHERFNPQGIKNRDAKPFLDSSFVQRAGERLKLSGK |
| Ga0210143_10729051 | 3300025792 | Natural And Restored Wetlands | VSTPWEAGFESMITGFHERFNPQGIKNRDAKPYLDPSFVQKALERLKLGKK |
| Ga0207645_109071612 | 3300025907 | Miscanthus Rhizosphere | GIEGMITGFHERFNPQGIKNRDARPYLDPYFVQKAAERLRLDKK |
| Ga0207660_102198353 | 3300025917 | Corn Rhizosphere | ERFNPQGIRNRDAKAFIDASFVQKAAERLKLGGTNRP |
| Ga0207657_100236071 | 3300025919 | Corn Rhizosphere | AGIESMITGFHERFNPQGIRNRDAKAFIDASFVQKAAERLKLGGTNRP |
| Ga0207646_118114821 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | TGFHERFNPQGIKNRDARPYLDPSFVQKAAERLRIDKK |
| Ga0207681_110904071 | 3300025923 | Switchgrass Rhizosphere | ITGFHGRFNPQGIRNRDAKAFIDASFVQKAAERLKLGGTNRP |
| Ga0207665_115747161 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MITGFHERFNPQGIRNRDAKPYLDPSFVQKAAERLKLDKK |
| Ga0208775_10010732 | 3300025992 | Rice Paddy Soil | VSTPWEAGFESMITGFYERFNPQGIKNRDAKPYLDPSFVQKALERLKLGKK |
| Ga0208415_10058982 | 3300025993 | Rice Paddy Soil | MITGFYERFNPQGIKNRDAKPYLDPSFVQKALERLKLGKK |
| Ga0208284_10253822 | 3300026003 | Rice Paddy Soil | VSTPREAGFESMITGFYERFNPQGIKNRDAKPYLDPSFVQKALERLKLGKK |
| Ga0208531_10145281 | 3300026020 | Rice Paddy Soil | IGGVSTPWEAGFESMITGFYERFNPQGIKNRDAKPYLDPSFVQKALERLKLGKK |
| Ga0208422_10469411 | 3300026053 | Natural And Restored Wetlands | GFHERFNPQGIRNHDAKPFLDPSFVQKAVERLKLGKK |
| Ga0207676_125639902 | 3300026095 | Switchgrass Rhizosphere | GFHERFNPQGIRNRDAKAFIDASFVQKAAERLKLGGTNRP |
| Ga0209731_10563151 | 3300027326 | Forest Soil | GFHERFNPQGIKNRDAKPYLDPSFVQKAVERLKLGKK |
| Ga0209818_10517381 | 3300027637 | Agricultural Soil | AGIESMITGFHERFNPQGIKNRDAKAFLDPSFVQKAAERLKLGKK |
| Ga0209592_12132252 | 3300027731 | Freshwater Sediment | MITGCHERFNPQGIKNRDASASLDSSFVQKAAERLKLGKM |
| Ga0207428_106607231 | 3300027907 | Populus Rhizosphere | GVPIPWEAGIESMITGFHERFNPQGIKNRDVKPYLDPSFVQKAVERLKLGKK |
| Ga0209382_100384341 | 3300027909 | Populus Rhizosphere | GIESMITGFHERFNPQGIKNRDVKPYLDPSFVQKAVERLKLGKK |
| Ga0209382_101838671 | 3300027909 | Populus Rhizosphere | MISGFHERFNPQGIKNRDARSYLDPSFVQKAAERLRLDKK |
| Ga0307302_104069182 | 3300028814 | Soil | IESMITGFHERFNPLGIKNRDAKPFLDPSFVQKAVERLKLSQK |
| Ga0307308_104979682 | 3300028884 | Soil | IGGVPLPWEAGIESMITGFHERFNPQGIKNRDAKPFIDPSFVQKAVERLKLGKK |
| (restricted) Ga0255311_10789282 | 3300031150 | Sandy Soil | TGFHERFNPQGIKNRDARPYLDSSFVQKAAERLKLERK |
| Ga0307469_111092481 | 3300031720 | Hardwood Forest Soil | ESMITGFHERFNPQGIKNRDAKPYLDPSFVQKAVERLKLGKK |
| Ga0307470_103710561 | 3300032174 | Hardwood Forest Soil | GLPFPWQSGIEGMITGFHERFNPQGIRNRDAKPYLDPSFVQKAAERLKLDKK |
| Ga0307471_1002913813 | 3300032180 | Hardwood Forest Soil | FPWQSGIEGMITGFHERFNPQGIKNRDAKPYLDPSFVQKAAERLKLDKK |
| Ga0307471_1007097761 | 3300032180 | Hardwood Forest Soil | MINGYHARFTPAVVKNRDARPFLDPSFVQRAVERLGIGKKQ |
| Ga0316601_1005493842 | 3300033419 | Soil | MITGFHERFNPQGIKNRDASAALDPSFVQKAAERLKLGKK |
| Ga0364942_0234827_422_598 | 3300034165 | Sediment | QYDAINGLPFPWQAGIEGMITGFHERFNPQGIKNRDAKPYLDSSFVQKAAERLKLDKK |
| Ga0364932_0183124_2_139 | 3300034177 | Sediment | AGIEGMITDFHERFNPQGIKNRDAKPYLDSSFVQKAAERLKLDKK |
| Ga0364943_0143113_746_856 | 3300034354 | Sediment | FHARFNPQGIKNHDAKPFLDPSFVQKAVERLKLGKK |
| ⦗Top⦘ |