


| Basic Information | |
|---|---|
| Family ID | F077677 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 43 residues |
| Representative Sequence | GQPYVDEGAAAYEHRYRQQRIKSLTAKAKELGYELTAVNA |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.64 % |
| % of genes near scaffold ends (potentially truncated) | 87.18 % |
| % of genes from short scaffolds (< 2000 bps) | 70.94 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (76.923 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.367 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.915 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (66.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.29% β-sheet: 0.00% Coil/Unstructured: 64.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF02371 | Transposase_20 | 4.27 |
| PF01548 | DEDD_Tnp_IS110 | 3.42 |
| PF00078 | RVT_1 | 1.71 |
| PF13588 | HSDR_N_2 | 1.71 |
| PF12728 | HTH_17 | 1.71 |
| PF07592 | DDE_Tnp_ISAZ013 | 1.71 |
| PF00144 | Beta-lactamase | 1.71 |
| PF01381 | HTH_3 | 1.71 |
| PF07676 | PD40 | 1.71 |
| PF14200 | RicinB_lectin_2 | 1.71 |
| PF00092 | VWA | 0.85 |
| PF05635 | 23S_rRNA_IVP | 0.85 |
| PF13432 | TPR_16 | 0.85 |
| PF13349 | DUF4097 | 0.85 |
| PF03167 | UDG | 0.85 |
| PF04542 | Sigma70_r2 | 0.85 |
| PF00042 | Globin | 0.85 |
| PF13620 | CarboxypepD_reg | 0.85 |
| PF13701 | DDE_Tnp_1_4 | 0.85 |
| PF06750 | DiS_P_DiS | 0.85 |
| PF04191 | PEMT | 0.85 |
| PF02547 | Queuosine_synth | 0.85 |
| PF00872 | Transposase_mut | 0.85 |
| PF00589 | Phage_integrase | 0.85 |
| PF00005 | ABC_tran | 0.85 |
| PF03916 | NrfD | 0.85 |
| PF13650 | Asp_protease_2 | 0.85 |
| PF04909 | Amidohydro_2 | 0.85 |
| PF07494 | Reg_prop | 0.85 |
| PF13899 | Thioredoxin_7 | 0.85 |
| PF13751 | DDE_Tnp_1_6 | 0.85 |
| PF00082 | Peptidase_S8 | 0.85 |
| PF12681 | Glyoxalase_2 | 0.85 |
| PF13649 | Methyltransf_25 | 0.85 |
| PF16861 | Carbam_trans_C | 0.85 |
| PF00069 | Pkinase | 0.85 |
| PF07730 | HisKA_3 | 0.85 |
| PF09924 | LPG_synthase_C | 0.85 |
| PF12006 | DUF3500 | 0.85 |
| PF13601 | HTH_34 | 0.85 |
| PF04366 | Ysc84 | 0.85 |
| PF02899 | Phage_int_SAM_1 | 0.85 |
| PF09370 | PEP_hydrolase | 0.85 |
| PF00709 | Adenylsucc_synt | 0.85 |
| PF00326 | Peptidase_S9 | 0.85 |
| PF01380 | SIS | 0.85 |
| PF07798 | CCDC90-like | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 7.69 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.42 |
| COG1989 | Prepilin signal peptidase PulO (type II secretory pathway) or related peptidase | Cell motility [N] | 2.56 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.71 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.71 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.71 |
| COG0104 | Adenylosuccinate synthase | Nucleotide transport and metabolism [F] | 0.85 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.85 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.85 |
| COG0809 | S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine synthetase) | Translation, ribosomal structure and biogenesis [J] | 0.85 |
| COG1017 | Hemoglobin-like flavoprotein | Energy production and conversion [C] | 0.85 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.85 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.85 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.85 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.85 |
| COG3292 | Periplasmic ligand-binding sensor domain | Signal transduction mechanisms [T] | 0.85 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.85 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.85 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.85 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.85 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.85 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.85 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.85 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.85 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.92 % |
| Unclassified | root | N/A | 23.08 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_101449541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300002347|JGIcombinedJ26865_1000426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 8620 | Open in IMG/M |
| 3300004024|Ga0055436_10151937 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300005332|Ga0066388_103073839 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 853 | Open in IMG/M |
| 3300005332|Ga0066388_103177032 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300005332|Ga0066388_107341149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. CFII64 | 553 | Open in IMG/M |
| 3300005540|Ga0066697_10644846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300005540|Ga0066697_10718865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300005558|Ga0066698_10186161 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1416 | Open in IMG/M |
| 3300005617|Ga0068859_103170060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300005921|Ga0070766_10023472 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3299 | Open in IMG/M |
| 3300006173|Ga0070716_100566400 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300006176|Ga0070765_100025171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4528 | Open in IMG/M |
| 3300006642|Ga0075521_10123957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1199 | Open in IMG/M |
| 3300006642|Ga0075521_10572205 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 555 | Open in IMG/M |
| 3300006795|Ga0075520_1129669 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300006800|Ga0066660_10105993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2001 | Open in IMG/M |
| 3300009012|Ga0066710_100014504 | All Organisms → cellular organisms → Bacteria | 8308 | Open in IMG/M |
| 3300009038|Ga0099829_10499052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1010 | Open in IMG/M |
| 3300009137|Ga0066709_101088619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1174 | Open in IMG/M |
| 3300009162|Ga0075423_10129926 | All Organisms → cellular organisms → Bacteria | 2644 | Open in IMG/M |
| 3300009698|Ga0116216_10796403 | Not Available | 567 | Open in IMG/M |
| 3300010046|Ga0126384_11598421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300010046|Ga0126384_11989848 | Not Available | 555 | Open in IMG/M |
| 3300010047|Ga0126382_10024736 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3192 | Open in IMG/M |
| 3300010048|Ga0126373_10755965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1032 | Open in IMG/M |
| 3300010048|Ga0126373_11479369 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300010358|Ga0126370_11395190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 661 | Open in IMG/M |
| 3300010358|Ga0126370_11951361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300010361|Ga0126378_10105778 | All Organisms → cellular organisms → Bacteria | 2788 | Open in IMG/M |
| 3300010361|Ga0126378_10213224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2012 | Open in IMG/M |
| 3300010361|Ga0126378_11307930 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 820 | Open in IMG/M |
| 3300010361|Ga0126378_12030344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 655 | Open in IMG/M |
| 3300010361|Ga0126378_12714213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300010361|Ga0126378_12960120 | Not Available | 541 | Open in IMG/M |
| 3300010361|Ga0126378_13385201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300010366|Ga0126379_10626391 | Not Available | 1164 | Open in IMG/M |
| 3300010376|Ga0126381_100060026 | All Organisms → cellular organisms → Bacteria | 4694 | Open in IMG/M |
| 3300010376|Ga0126381_100173662 | All Organisms → cellular organisms → Bacteria | 2855 | Open in IMG/M |
| 3300010398|Ga0126383_12215465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300011271|Ga0137393_10512701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1029 | Open in IMG/M |
| 3300012189|Ga0137388_10952323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 793 | Open in IMG/M |
| 3300012199|Ga0137383_10382103 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300012231|Ga0137465_1040119 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
| 3300012357|Ga0137384_11559466 | Not Available | 510 | Open in IMG/M |
| 3300012360|Ga0137375_11178742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300012532|Ga0137373_10005413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 13809 | Open in IMG/M |
| 3300012532|Ga0137373_10084511 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2817 | Open in IMG/M |
| 3300012929|Ga0137404_11321332 | Not Available | 665 | Open in IMG/M |
| 3300014495|Ga0182015_10756906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300016270|Ga0182036_10690046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 825 | Open in IMG/M |
| 3300016294|Ga0182041_10121292 | All Organisms → cellular organisms → Bacteria | 1964 | Open in IMG/M |
| 3300016357|Ga0182032_11957581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300016371|Ga0182034_10481669 | Not Available | 1032 | Open in IMG/M |
| 3300016404|Ga0182037_10106250 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2032 | Open in IMG/M |
| 3300016404|Ga0182037_10391889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 1142 | Open in IMG/M |
| 3300016404|Ga0182037_11365693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300016422|Ga0182039_12218390 | Not Available | 507 | Open in IMG/M |
| 3300017943|Ga0187819_10039019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2808 | Open in IMG/M |
| 3300017948|Ga0187847_10819272 | Not Available | 528 | Open in IMG/M |
| 3300017970|Ga0187783_10682054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 742 | Open in IMG/M |
| 3300019275|Ga0187798_1717402 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300019487|Ga0187893_10367624 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300020580|Ga0210403_11416321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300021178|Ga0210408_10875676 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300021405|Ga0210387_11126775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300021407|Ga0210383_10922137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 744 | Open in IMG/M |
| 3300021420|Ga0210394_10197649 | Not Available | 1753 | Open in IMG/M |
| 3300021433|Ga0210391_11361598 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300021475|Ga0210392_10171901 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1495 | Open in IMG/M |
| 3300021559|Ga0210409_10496231 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300021560|Ga0126371_10385301 | All Organisms → cellular organisms → Bacteria | 1542 | Open in IMG/M |
| 3300022523|Ga0242663_1137667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Holosporales → Candidatus Paracaedibacteraceae → Candidatus Paracaedibacter → Candidatus Paracaedibacter symbiosus | 516 | Open in IMG/M |
| 3300025475|Ga0208478_1000006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 112924 | Open in IMG/M |
| 3300025494|Ga0207928_1027462 | Not Available | 1103 | Open in IMG/M |
| 3300025878|Ga0209584_10039799 | All Organisms → cellular organisms → Bacteria | 1645 | Open in IMG/M |
| 3300026486|Ga0256820_1041932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| 3300026532|Ga0209160_1103528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1437 | Open in IMG/M |
| 3300026538|Ga0209056_10403198 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 838 | Open in IMG/M |
| 3300027045|Ga0207726_1054673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300027895|Ga0209624_10051618 | All Organisms → cellular organisms → Bacteria | 2634 | Open in IMG/M |
| 3300028047|Ga0209526_10813823 | Not Available | 577 | Open in IMG/M |
| 3300029636|Ga0222749_10662500 | Not Available | 571 | Open in IMG/M |
| 3300029999|Ga0311339_10068411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 4602 | Open in IMG/M |
| 3300031236|Ga0302324_100573945 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1625 | Open in IMG/M |
| 3300031545|Ga0318541_10010164 | All Organisms → cellular organisms → Bacteria | 4200 | Open in IMG/M |
| 3300031572|Ga0318515_10134530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1312 | Open in IMG/M |
| 3300031573|Ga0310915_10747239 | Not Available | 689 | Open in IMG/M |
| 3300031640|Ga0318555_10483177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
| 3300031708|Ga0310686_112506666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2217 | Open in IMG/M |
| 3300031708|Ga0310686_113702383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2552 | Open in IMG/M |
| 3300031718|Ga0307474_11062238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 641 | Open in IMG/M |
| 3300031719|Ga0306917_10003271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8338 | Open in IMG/M |
| 3300031719|Ga0306917_10100278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2076 | Open in IMG/M |
| 3300031724|Ga0318500_10289507 | Not Available | 801 | Open in IMG/M |
| 3300031736|Ga0318501_10499469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300031764|Ga0318535_10425095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300031768|Ga0318509_10651911 | Not Available | 586 | Open in IMG/M |
| 3300031819|Ga0318568_10846263 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300031890|Ga0306925_10211060 | Not Available | 2095 | Open in IMG/M |
| 3300031890|Ga0306925_10814235 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300031910|Ga0306923_10040382 | All Organisms → cellular organisms → Bacteria | 5095 | Open in IMG/M |
| 3300031941|Ga0310912_10114837 | Not Available | 2000 | Open in IMG/M |
| 3300031941|Ga0310912_10790195 | Not Available | 733 | Open in IMG/M |
| 3300031954|Ga0306926_12896790 | Not Available | 515 | Open in IMG/M |
| 3300032025|Ga0318507_10347394 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300032042|Ga0318545_10034340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1675 | Open in IMG/M |
| 3300032160|Ga0311301_11343293 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300032174|Ga0307470_11877700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300032261|Ga0306920_100096400 | All Organisms → cellular organisms → Bacteria | 4375 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.37% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 16.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.53% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.69% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 5.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.42% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.71% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.71% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.71% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.71% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.71% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.85% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.85% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.85% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.85% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.85% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.85% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.85% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.85% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002347 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (NGEE Surface samples 415 (1, 2, 3 deep-072012) AP id is 1030520, ASSEMBLY_DATE=20131219) | Environmental | Open in IMG/M |
| 3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012231 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2 | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025475 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025494 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300026486 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PR6 | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027045 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J11758_113959672 | 3300000789 | Soil | GQQYVDEGAEAYERRYQQLRILALTNQAEELGYQLVPTV* |
| JGIcombinedJ26739_1014495413 | 3300002245 | Forest Soil | LRWGQPYIDEGAKAYETRYRQQRIERLAGIAKALGYQLAPTNA* |
| JGIcombinedJ26865_10004261 | 3300002347 | Arctic Peat Soil | RWGQPYVDEGAAAYENRYLQQRIKSLTAKAKQLGYELTAVNA* |
| Ga0055436_101519372 | 3300004024 | Natural And Restored Wetlands | LVTLIYRLLRWGQPYVDEGVEAFERRYQETRLKNLKAKVKELGYELVPSH* |
| Ga0066388_1030738391 | 3300005332 | Tropical Forest Soil | LLRWGQPYVDEGEAAYENRYRQHRIGRLAATAKELGYQLTPVPA* |
| Ga0066388_1031770321 | 3300005332 | Tropical Forest Soil | LRWGQPYVDEGAAAFENRHRQHRIGRLAATAKELGYQLTPLAT* |
| Ga0066388_1073411491 | 3300005332 | Tropical Forest Soil | QPYVDEGAEAYENRYRQQRIGRLKLTAKQLGYQLAPVALDIT* |
| Ga0066697_106448461 | 3300005540 | Soil | KLAQWVYRVLRWGQPYVDEGAAVYEHRYRQARITRLAATAKDLGYALVSVEA* |
| Ga0066697_107188651 | 3300005540 | Soil | GQPYVDVGAAAYENRYRQARIQRLAAIVKDLGYQLTPNPSKA* |
| Ga0066698_101861611 | 3300005558 | Soil | YVDEGAAVYEHRYRQARITRLAATAKDLGYALVSVEA* |
| Ga0068859_1031700601 | 3300005617 | Switchgrass Rhizosphere | ARKLAALIYRLLRWGQPYVDEGVEAFERRYQETRLKNLKTKVKELGYELVPSH* |
| Ga0070766_100234721 | 3300005921 | Soil | WGQPYVDEGAKAYEARYRQQRIGRLAATAKQLGYQLAPINA* |
| Ga0070716_1005664001 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | DEGAAAFETRYRQHRIGRLAATAKELGYQLTPVPA* |
| Ga0070765_1000251711 | 3300006176 | Soil | MWTKEKAYENRYRQQRIGRLAATAKDLGYQLTPVNA* |
| Ga0075521_101239571 | 3300006642 | Arctic Peat Soil | VDEGAAAYENRYLQQRIKSLTAKAKQLGYELTAVNA* |
| Ga0075521_105722051 | 3300006642 | Arctic Peat Soil | LLRWGQPYVDEGAAAYENRYLQQRIKSLTAKAKQLGYELTAVNA* |
| Ga0075520_11296692 | 3300006795 | Arctic Peat Soil | RLLRWGQPYVDEGAAAYENRYLQQRIKSLTAKAKQLGYELTAVNA* |
| Ga0066660_101059934 | 3300006800 | Soil | LLRWGQPYVDEGVAAFEARYQQQRVGRLTVTAKELGYQLVPANA* |
| Ga0066710_1000145041 | 3300009012 | Grasslands Soil | WVYRVLRWGQPYVDEGAAVYEHRYRQARITRLAATAKDLGYPLVSVEA |
| Ga0099829_104990521 | 3300009038 | Vadose Zone Soil | HIYRVLRWGQPYVDEGAAAYDKRYQLARAKRLAATAKDLGYKLIPVEA* |
| Ga0066709_1010886193 | 3300009137 | Grasslands Soil | WVYRVLRWGQPYVDEGAAVYEHRYRQARITRLAATAKDLGYPLVSVEA* |
| Ga0075423_101299261 | 3300009162 | Populus Rhizosphere | QPYVDEGAAAYEKRYQQARIQRLVAMVKNLGYELTPNTSKP* |
| Ga0116216_107964031 | 3300009698 | Peatlands Soil | YRLLRWGQPSVDDGAEAYEKRHQESRINSLTARAKELGYQLTPITVMTRP* |
| Ga0126384_115984212 | 3300010046 | Tropical Forest Soil | RWGQPYVDEGAEAYENRYRQQRMSSLMAKAKDLGYELTPVSA* |
| Ga0126384_119898482 | 3300010046 | Tropical Forest Soil | FFRLLRWAQPYVDEGADAYENRYRQMRIARLHDTAKQLGYHLAPINA* |
| Ga0126382_100247363 | 3300010047 | Tropical Forest Soil | VDQGAAAYENRYRQQRIRSLMAKAKELGYQLAPASP* |
| Ga0126373_107559652 | 3300010048 | Tropical Forest Soil | MDEGVEAYEKRYRQQRVKSLVAKAKDLGYELTAVSA* |
| Ga0126373_114793692 | 3300010048 | Tropical Forest Soil | EGAQAYEGRYRKQRIQSLAAKANALGYQLAPVTA* |
| Ga0126370_113951902 | 3300010358 | Tropical Forest Soil | RLLRWGQSYVDEGAEAYEDRYRQMRIGRLKATAQQLGYELAYVCTFGR* |
| Ga0126370_119513611 | 3300010358 | Tropical Forest Soil | MDEGVEAYEKRYRQQRVKSLTAKAKDLGYELTAVNA* |
| Ga0126378_101057784 | 3300010361 | Tropical Forest Soil | VDQGAAAYENRYRQQRITSLMAKAKELGYQLTPASA* |
| Ga0126378_102132242 | 3300010361 | Tropical Forest Soil | IYRLLRWGQPYVDEGAEAFERRYQETRLKNLKAKAKDLGYQLVASN* |
| Ga0126378_113079301 | 3300010361 | Tropical Forest Soil | LIYRLLRWGQPYVDEGAEAFERRYQETRLKNLKAKAKELGYQLLASN* |
| Ga0126378_120303442 | 3300010361 | Tropical Forest Soil | WGQPYLDEGVEAYEKRYRQQRVKSLTAKAKDPGYELTPLNA* |
| Ga0126378_127142132 | 3300010361 | Tropical Forest Soil | TLIYRLLRWGQPYVDEGAAAFETRYRQHRIGRLAATAKELGYQLTPVPA* |
| Ga0126378_129601201 | 3300010361 | Tropical Forest Soil | MLRRGQTYVDEGTDAYENRYRQARVARLLATAKALGYQTTPTASVA* |
| Ga0126378_133852011 | 3300010361 | Tropical Forest Soil | DEGAAAYENRYRQHRIGRLAATAKQLGYQLTPVSA* |
| Ga0126379_106263911 | 3300010366 | Tropical Forest Soil | RLLRWGQPNVDEGAEAYEKRYQKQRLKILESKAKNLGYQLVPASA* |
| Ga0126381_1000600267 | 3300010376 | Tropical Forest Soil | VLRWGQPYVDEGAAAYEHHYLQQRIKSLTAKAKELGFELTVVNA* |
| Ga0126381_1001736623 | 3300010376 | Tropical Forest Soil | DQGAAAYENRYRQQRITSLMAKAKELGYQLTPASA* |
| Ga0126383_122154652 | 3300010398 | Tropical Forest Soil | RLEFHRNRERYQLLRWGQPYLDEGAAAYEHHYLQQRIKSLTAKAKELGYELTAVNA* |
| Ga0137393_105127011 | 3300011271 | Vadose Zone Soil | QWVYRLLRWGQPYVDEGAAVYEKRYRQARIKGLAASAKNLGYALVSVEA* |
| Ga0137388_109523233 | 3300012189 | Vadose Zone Soil | IYRLLRWGQPYVDEGEEAFEKRYQERRINTLKSKARELGYALVRKA* |
| Ga0137383_103821032 | 3300012199 | Vadose Zone Soil | WGQPYVDEGAEAYEKRYQNGRIKSLTAKAKELGYKLTPINA* |
| Ga0137465_10401191 | 3300012231 | Soil | RLLRWGQPYVDEGVEAFEKRYREIRIGSLKAKAKELGYQLASM* |
| Ga0137384_115594662 | 3300012357 | Vadose Zone Soil | RWGQPYVDEGAAAAEKRYQEARIQRLAAQAKDLGFDLTPKVSTA* |
| Ga0137375_111787422 | 3300012360 | Vadose Zone Soil | KLAQYIYRLLRWGQPYVDEGAAAYETRYHQARVKRIAANAKQLGYALVSVNT* |
| Ga0137373_1000541310 | 3300012532 | Vadose Zone Soil | LLRWGQPYVDEGAAAYETRYHQARVKRIAANAKQLGYALVRVNT* |
| Ga0137373_100845111 | 3300012532 | Vadose Zone Soil | RLLRWGQPYVDEGAAAYETRYHQARVKRIAANAKQLGYALVSVNT* |
| Ga0137404_113213322 | 3300012929 | Vadose Zone Soil | YRLLRWGQPYVDEGAAVFEKRYQQAHLQRLAAKVKDLGYQLTPITR* |
| Ga0182015_107569062 | 3300014495 | Palsa | YVDEGAEAYEKRYRADRIKGLTAAAKALGLEITPKACES* |
| Ga0182036_106900462 | 3300016270 | Soil | YRLLRWGQPYVDEGAAAYEHRYLQQRIKSLTAKAKELGYELTAVNA |
| Ga0182041_101212922 | 3300016294 | Soil | DEGVEAYEKRYRQQRVKSLTAKAKDLGYELTALNT |
| Ga0182032_119575811 | 3300016357 | Soil | RWGQPYVDEGAEAFERRYQETRLKNLKAKAKDLGYQLVASN |
| Ga0182034_104816692 | 3300016371 | Soil | GQPYMDEGVEAYEKRYRQQRVKSLTAKAKDLGYELTALNT |
| Ga0182037_101062502 | 3300016404 | Soil | TLIYRLLRWGQPYVDEGVEAFERRYQETRLKNLKAKVKELGYELVPAIKAS |
| Ga0182037_103918892 | 3300016404 | Soil | LIYRLLRWGQPYVDEGAQAYENRYRQLRLQNLTARVNALGYQLTPINAGA |
| Ga0182037_113656931 | 3300016404 | Soil | LIYRLLRWGQPYVDEGAQAYENRYRQLRLQNLTARVNALG |
| Ga0182039_122183901 | 3300016422 | Soil | LLRWGQPYVDEGAEAFERRYQETRLKNLKAKAKELGYQLVASS |
| Ga0182038_104607071 | 3300016445 | Soil | PYVDEGAEAFERRYQETRLKNLKAKVKELGYELVASN |
| Ga0187819_100390191 | 3300017943 | Freshwater Sediment | NWLLLFTRLLRWGQPYLDEGAAAYKNRHRRHRIGRLSASAKELGYQLNPVSA |
| Ga0187847_108192722 | 3300017948 | Peatland | WGQPYVDEGAEAYEKRYQEARTRSLLATAKQLGYQLVPIIA |
| Ga0187783_106820541 | 3300017970 | Tropical Peatland | YVDEGAAAFENRYRQHRIGRLAVTAKEFGYQLTPIPA |
| Ga0187798_17174021 | 3300019275 | Peatland | RLLRWGQQYVDEGAEAYERRYQEARITALKAKARELGYELIAHA |
| Ga0187893_103676241 | 3300019487 | Microbial Mat On Rocks | WGHTYVDEGAAAYEYRYRQARLTRLAATAKDLGYAIVPVQV |
| Ga0210403_114163211 | 3300020580 | Soil | VTPWGQPYVDEGADAYENRYRQQRIGRLAATAKQLGFQLTPVSA |
| Ga0210408_108756761 | 3300021178 | Soil | LAQRVYRVLRWGQVYVDEGAALYEIRYRQARIRRLAATATNLGYALVSVEA |
| Ga0210387_111267751 | 3300021405 | Soil | RWGQPYVDEGAEAYERRNQEGRVKRLTATAKSLGFQLMPNTARA |
| Ga0210383_109221372 | 3300021407 | Soil | RWGQPYVDEGAKAYEARYRQQRIGRLAATAKQLGYQLAPINA |
| Ga0210394_101976491 | 3300021420 | Soil | VDEGAAAFENRYRQHRIGRLAATAKELGYQLTPVPA |
| Ga0210391_113615982 | 3300021433 | Soil | YVDEGAAAYENRYRQNRIAHLAATAKQLGYQLTPVTA |
| Ga0210392_101719013 | 3300021475 | Soil | YVDEGAAAYENRYRQHRIARLADTAKQLGYQLTPVTA |
| Ga0210409_104962311 | 3300021559 | Soil | TLIYRLLRWGQPYVDEGAKAYETRYRQQRIGRLAATAKALGYQLAPMLESA |
| Ga0126371_103853013 | 3300021560 | Tropical Forest Soil | MDEGVEAYEKRYRQQRVKSLVAKAKDLGYELTAVSA |
| Ga0242663_11376671 | 3300022523 | Soil | LIYRLLRWGQPYVDEGAQAYETRYRQQRIGRLAATAKALGYQLAPMLESA |
| Ga0208478_1000006103 | 3300025475 | Arctic Peat Soil | RLARWGQPYVDEGAAAYENRYLQQRIKSLTAKAKQLGYELTAVNA |
| Ga0207928_10274623 | 3300025494 | Arctic Peat Soil | YVDEGAAAYENRYLQQRIKSLTAKAKQLGYELTAVNA |
| Ga0209584_100397993 | 3300025878 | Arctic Peat Soil | QPYVDEGAAAYENRYLQQRIKSLTAKAKQLGYELTAVNA |
| Ga0256820_10419322 | 3300026486 | Sediment | LIYRLLQWGQPYVDEGAAAFEKRYLEVRIKSMRARARELGYELVQSAVTG |
| Ga0209160_11035282 | 3300026532 | Soil | QPYVDEGAAVYEHRYRQARITRLAATAKDLGYALVSVEA |
| Ga0209056_104031982 | 3300026538 | Soil | ARKLAQWVYRVLRWGQPYVDEGAAVYEHRYRQARITRLAATAKDLGYALVSVEA |
| Ga0207726_10546731 | 3300027045 | Tropical Forest Soil | RLLRWGQPYVDEGAEVYEKRYQEMRIKALKSTAKQLGYGLVSNA |
| Ga0209624_100516181 | 3300027895 | Forest Soil | RLLRWGQPYVDEGAESYEKRYTAQRLQRLKASANNLGYQLTPKTA |
| Ga0209526_108138232 | 3300028047 | Forest Soil | LAQFIYRLLRWGQPYVDEGATAYEKRYQLARVNRLATTAKDLGFKLVSIEA |
| Ga0222749_106625001 | 3300029636 | Soil | QPFVDEGAAAYEKRYRVERIKGLTAAAKALGLEVTPKACQA |
| Ga0311339_100684116 | 3300029999 | Palsa | QPYVDEGAAAYEKRYREARIKSLTATAKSLGFQLTPKASDLDPA |
| Ga0302324_1005739452 | 3300031236 | Palsa | LRWGQPYVDEGAAAYEKRYQEARIRSLTTAAKSLGFQLTPKASDLDPA |
| Ga0302140_105251261 | 3300031261 | Bog | LLRWGQAYVDEGAEAYERRYQQNRLLALKSRAKQLGYESVQTA |
| Ga0318541_100101648 | 3300031545 | Soil | YMDEGVEAYEKRYRQQRVKSLTAKAKDLGYELTALNT |
| Ga0318515_101345301 | 3300031572 | Soil | DEGIEAYEKRYRQQRVKSLTAKAKDLGYELTAVNA |
| Ga0310915_107472391 | 3300031573 | Soil | GQPYMDEGIEAYEKRYRQQRVKSLTAKAKDLGYELTAVNA |
| Ga0318555_104831772 | 3300031640 | Soil | RWGQPYMDEGIEAYEKRYRQQRVKSLTAKAKDLGYELTAVNA |
| Ga0318560_104513521 | 3300031682 | Soil | PYVDEGAEAYERRYRQFRITALKAKARELGYELVQHA |
| Ga0310686_1125066661 | 3300031708 | Soil | RLLRWGQPYVDEGAAAFENRYRQHRIGRLAATAKELGYQLTPVAA |
| Ga0310686_1137023831 | 3300031708 | Soil | RLLRWGQPYVDEGAAAFENRYRQHRIGRLAATAKELGYQLTPIAA |
| Ga0307474_110622382 | 3300031718 | Hardwood Forest Soil | TLIYRLLRWGQPYVDEGAEAYEKRYRQQRIGRLAATAKDLGYQLTPVNA |
| Ga0306917_100032711 | 3300031719 | Soil | QPYMDEGVEAYEKRYRQQRVKSLTAKAKDLGYELTALNT |
| Ga0306917_101002786 | 3300031719 | Soil | QPYMDEGIQAYEKRYRQQRVKSLTAKAKDLGYELTAVNA |
| Ga0318500_102895071 | 3300031724 | Soil | PYMDEGIEAYEKRYRQQRVKSLTAKAKDLGYELTAVNA |
| Ga0318501_104994693 | 3300031736 | Soil | LAQYIYRLLRWGHPYVDEGAAAYDKRYRLARAKRLAVTAKALGYTLISAEA |
| Ga0318535_104250952 | 3300031764 | Soil | YRLLRWGQPYVDEGAEAFETRYQEMRITVLKAKAKQLGYELVQNHPAPSTEEEVTD |
| Ga0318509_106519112 | 3300031768 | Soil | DEHVEAYEKRYRQQRVKSLTAKAKDLGYELTALNA |
| Ga0302319_100171031 | 3300031788 | Bog | AYVDEGAEAYERRYQQNRLLALKSRAKQLGYESVQTA |
| Ga0318568_108462631 | 3300031819 | Soil | PYVDEGAAAYEHRYRQQRIKSLTAKAKELGYELTAVNA |
| Ga0306919_112040131 | 3300031879 | Soil | PYVDEGAEAYERRYQQFRITALKAKARELGYELVQHA |
| Ga0306925_102110604 | 3300031890 | Soil | YMDEGIQAYEKRYRQQRVKSLTAKAKDLGYELTAVNA |
| Ga0306925_108142352 | 3300031890 | Soil | YVDEGAAAYENRYRQHRIHRLATTAKELGYQLTPVSA |
| Ga0306923_100403825 | 3300031910 | Soil | GQPYVDEGAAAYEHRYRQQRIKSLTAKAKELGYELTAVNA |
| Ga0310912_101148373 | 3300031941 | Soil | YIDEGVEAYEKRYRQQRVKSLTAKAKDLGYELTAVNA |
| Ga0310912_107901952 | 3300031941 | Soil | MDEGIEAYEKRYRQQRVKSLTAKAKDLGYELTAVNA |
| Ga0310910_115083653 | 3300031946 | Soil | IVRWGQPYVDEGAEAYERRYQQFRITALKARELGYELPAR |
| Ga0306926_128967902 | 3300031954 | Soil | RWGQPYVDVGAEAYENHYRQQRIGRLKLTAKQLGYQLAPVALDIT |
| Ga0318507_103473942 | 3300032025 | Soil | LLRWGQRYVDEGAAAYENRYRQHRIHRLATTAKELGYQLTPVSA |
| Ga0318545_100343402 | 3300032042 | Soil | AQYIYRLLRWGHPYVDEGAAAYDKRYRLARAKRLAVTAKALGYTLISAEA |
| Ga0311301_113432932 | 3300032160 | Peatlands Soil | PPGNRLLRWGQPYVDEGAEAYENRYKQQRVKRLAAKAKSPGYQLTAATG |
| Ga0307470_118777001 | 3300032174 | Hardwood Forest Soil | RWGQPYVDEGVEAFERRYQETRLKNLKAKVKELGYELVASN |
| Ga0306920_1000964006 | 3300032261 | Soil | PYMDEGIQAYEKRYRQQRVKSLTAKAKDLGYELTAVNA |
| ⦗Top⦘ |