


| Basic Information | |
|---|---|
| Family ID | F077673 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VPGKSGGLNGSTQHFLEVYSQESENLKFVVGVDLSAALLCSDPT |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 52.14 % |
| % of genes near scaffold ends (potentially truncated) | 98.29 % |
| % of genes from short scaffolds (< 2000 bps) | 79.49 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.034 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (19.658 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.641 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.556 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.28% β-sheet: 0.00% Coil/Unstructured: 59.72% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF01979 | Amidohydro_1 | 3.42 |
| PF01494 | FAD_binding_3 | 3.42 |
| PF07676 | PD40 | 3.42 |
| PF13620 | CarboxypepD_reg | 2.56 |
| PF00583 | Acetyltransf_1 | 1.71 |
| PF02371 | Transposase_20 | 1.71 |
| PF00589 | Phage_integrase | 1.71 |
| PF12704 | MacB_PCD | 1.71 |
| PF01047 | MarR | 1.71 |
| PF00072 | Response_reg | 0.85 |
| PF06877 | RraB | 0.85 |
| PF13564 | DoxX_2 | 0.85 |
| PF01152 | Bac_globin | 0.85 |
| PF03551 | PadR | 0.85 |
| PF08281 | Sigma70_r4_2 | 0.85 |
| PF07228 | SpoIIE | 0.85 |
| PF00903 | Glyoxalase | 0.85 |
| PF01041 | DegT_DnrJ_EryC1 | 0.85 |
| PF13646 | HEAT_2 | 0.85 |
| PF16576 | HlyD_D23 | 0.85 |
| PF13545 | HTH_Crp_2 | 0.85 |
| PF03544 | TonB_C | 0.85 |
| PF13302 | Acetyltransf_3 | 0.85 |
| PF04191 | PEMT | 0.85 |
| PF07238 | PilZ | 0.85 |
| PF00211 | Guanylate_cyc | 0.85 |
| PF08308 | PEGA | 0.85 |
| PF00654 | Voltage_CLC | 0.85 |
| PF13883 | Pyrid_oxidase_2 | 0.85 |
| PF00239 | Resolvase | 0.85 |
| PF01551 | Peptidase_M23 | 0.85 |
| PF13650 | Asp_protease_2 | 0.85 |
| PF01799 | Fer2_2 | 0.85 |
| PF07638 | Sigma70_ECF | 0.85 |
| PF01872 | RibD_C | 0.85 |
| PF00069 | Pkinase | 0.85 |
| PF01548 | DEDD_Tnp_IS110 | 0.85 |
| PF02861 | Clp_N | 0.85 |
| PF03162 | Y_phosphatase2 | 0.85 |
| PF13231 | PMT_2 | 0.85 |
| PF01527 | HTH_Tnp_1 | 0.85 |
| PF01910 | Thiamine_BP | 0.85 |
| PF12833 | HTH_18 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 6.84 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.42 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 3.42 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 3.42 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 3.42 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 2.56 |
| COG0011 | Thiamin-binding stress-response protein YqgV, UPF0045 family | Coenzyme transport and metabolism [H] | 0.85 |
| COG0038 | H+/Cl- antiporter ClcA | Inorganic ion transport and metabolism [P] | 0.85 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.85 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.85 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.85 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.85 |
| COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.85 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.85 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.85 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.85 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.85 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.85 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.85 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.85 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.85 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.85 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.85 |
| COG2365 | Protein tyrosine/serine phosphatase Oca4 | Signal transduction mechanisms [T] | 0.85 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.85 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.85 |
| COG3076 | Regulator of RNase E activity RraB | Translation, ribosomal structure and biogenesis [J] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.03 % |
| Unclassified | root | N/A | 11.97 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10058970 | All Organisms → cellular organisms → Bacteria | 2887 | Open in IMG/M |
| 3300001593|JGI12635J15846_10102966 | All Organisms → cellular organisms → Bacteria | 2044 | Open in IMG/M |
| 3300001593|JGI12635J15846_10428037 | Not Available | 793 | Open in IMG/M |
| 3300001593|JGI12635J15846_10448038 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300002914|JGI25617J43924_10097950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_57_6 | 1051 | Open in IMG/M |
| 3300004633|Ga0066395_10338096 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300005332|Ga0066388_106100960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300005434|Ga0070709_10369809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1063 | Open in IMG/M |
| 3300005591|Ga0070761_10421034 | Not Available | 817 | Open in IMG/M |
| 3300005610|Ga0070763_10532866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
| 3300005993|Ga0080027_10195854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 787 | Open in IMG/M |
| 3300006052|Ga0075029_100134706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1508 | Open in IMG/M |
| 3300006162|Ga0075030_100181811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1696 | Open in IMG/M |
| 3300006173|Ga0070716_100622794 | Not Available | 815 | Open in IMG/M |
| 3300006174|Ga0075014_100231688 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 945 | Open in IMG/M |
| 3300006176|Ga0070765_100266116 | All Organisms → cellular organisms → Bacteria | 1576 | Open in IMG/M |
| 3300006854|Ga0075425_100161909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 2567 | Open in IMG/M |
| 3300006893|Ga0073928_10156837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1829 | Open in IMG/M |
| 3300009524|Ga0116225_1109125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1279 | Open in IMG/M |
| 3300010341|Ga0074045_10285151 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1085 | Open in IMG/M |
| 3300010361|Ga0126378_12311525 | Not Available | 614 | Open in IMG/M |
| 3300010366|Ga0126379_11729706 | Not Available | 730 | Open in IMG/M |
| 3300010379|Ga0136449_100960280 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1382 | Open in IMG/M |
| 3300011269|Ga0137392_11643758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300011270|Ga0137391_10640144 | Not Available | 888 | Open in IMG/M |
| 3300012189|Ga0137388_10073394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2859 | Open in IMG/M |
| 3300012201|Ga0137365_10237966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1356 | Open in IMG/M |
| 3300012201|Ga0137365_10392164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1024 | Open in IMG/M |
| 3300012202|Ga0137363_11724172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300012203|Ga0137399_10371959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1189 | Open in IMG/M |
| 3300012207|Ga0137381_10192653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1766 | Open in IMG/M |
| 3300012209|Ga0137379_11258562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
| 3300012350|Ga0137372_10640299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 776 | Open in IMG/M |
| 3300012361|Ga0137360_10493996 | Not Available | 1041 | Open in IMG/M |
| 3300012362|Ga0137361_11571528 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300012685|Ga0137397_10124020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1904 | Open in IMG/M |
| 3300012685|Ga0137397_10294301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1210 | Open in IMG/M |
| 3300012923|Ga0137359_10675574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 901 | Open in IMG/M |
| 3300012923|Ga0137359_10710081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella | 875 | Open in IMG/M |
| 3300012923|Ga0137359_10937697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 745 | Open in IMG/M |
| 3300012923|Ga0137359_11620646 | Not Available | 535 | Open in IMG/M |
| 3300012930|Ga0137407_10291893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1489 | Open in IMG/M |
| 3300012944|Ga0137410_10767163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 808 | Open in IMG/M |
| 3300012971|Ga0126369_10703891 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Aliifodinibius → Aliifodinibius roseus | 1087 | Open in IMG/M |
| 3300012971|Ga0126369_10782747 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300014489|Ga0182018_10085452 | All Organisms → cellular organisms → Bacteria | 1867 | Open in IMG/M |
| 3300014489|Ga0182018_10200427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → Micavibrio → Micavibrio aeruginosavorus | 1117 | Open in IMG/M |
| 3300014494|Ga0182017_10428801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 816 | Open in IMG/M |
| 3300014495|Ga0182015_10098980 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 2026 | Open in IMG/M |
| 3300014501|Ga0182024_10319680 | All Organisms → cellular organisms → Bacteria | 2042 | Open in IMG/M |
| 3300014501|Ga0182024_10410417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1749 | Open in IMG/M |
| 3300014501|Ga0182024_10738125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1209 | Open in IMG/M |
| 3300015051|Ga0137414_1006263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300015264|Ga0137403_10440279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1179 | Open in IMG/M |
| 3300015371|Ga0132258_10803491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2372 | Open in IMG/M |
| 3300017934|Ga0187803_10009368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3909 | Open in IMG/M |
| 3300017943|Ga0187819_10773837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300017961|Ga0187778_10940119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 59-55 | 596 | Open in IMG/M |
| 3300017970|Ga0187783_10490859 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 890 | Open in IMG/M |
| 3300018062|Ga0187784_10509241 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300018088|Ga0187771_10040880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3575 | Open in IMG/M |
| 3300018088|Ga0187771_10550709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 977 | Open in IMG/M |
| 3300019883|Ga0193725_1103787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300020022|Ga0193733_1101064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 805 | Open in IMG/M |
| 3300020140|Ga0179590_1089782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 822 | Open in IMG/M |
| 3300020580|Ga0210403_10005165 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 11131 | Open in IMG/M |
| 3300020580|Ga0210403_10007964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 8758 | Open in IMG/M |
| 3300020583|Ga0210401_10337870 | Not Available | 1367 | Open in IMG/M |
| 3300020583|Ga0210401_10895947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
| 3300021046|Ga0215015_10148558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300021171|Ga0210405_10264439 | Not Available | 1360 | Open in IMG/M |
| 3300021401|Ga0210393_10032798 | All Organisms → cellular organisms → Bacteria | 4061 | Open in IMG/M |
| 3300021403|Ga0210397_10015160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4679 | Open in IMG/M |
| 3300021405|Ga0210387_10863476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 797 | Open in IMG/M |
| 3300021406|Ga0210386_11065366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
| 3300021407|Ga0210383_10035460 | All Organisms → cellular organisms → Bacteria | 4165 | Open in IMG/M |
| 3300021407|Ga0210383_10090417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2571 | Open in IMG/M |
| 3300021407|Ga0210383_10179587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1806 | Open in IMG/M |
| 3300021432|Ga0210384_11866949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300021474|Ga0210390_10061190 | All Organisms → cellular organisms → Bacteria | 3103 | Open in IMG/M |
| 3300021478|Ga0210402_10289090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1516 | Open in IMG/M |
| 3300021479|Ga0210410_11081436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300021559|Ga0210409_10028149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5420 | Open in IMG/M |
| 3300021559|Ga0210409_10203072 | All Organisms → cellular organisms → Bacteria | 1804 | Open in IMG/M |
| 3300021559|Ga0210409_10206205 | All Organisms → cellular organisms → Bacteria | 1789 | Open in IMG/M |
| 3300021559|Ga0210409_11211460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
| 3300025906|Ga0207699_10514560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 865 | Open in IMG/M |
| 3300026341|Ga0257151_1008513 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300026551|Ga0209648_10410683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_57_6 | 878 | Open in IMG/M |
| 3300027070|Ga0208365_1038373 | Not Available | 637 | Open in IMG/M |
| 3300027590|Ga0209116_1001232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6357 | Open in IMG/M |
| 3300027645|Ga0209117_1002280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6675 | Open in IMG/M |
| 3300027676|Ga0209333_1060339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1043 | Open in IMG/M |
| 3300027701|Ga0209447_10090161 | Not Available | 842 | Open in IMG/M |
| 3300027874|Ga0209465_10061781 | All Organisms → cellular organisms → Bacteria | 1806 | Open in IMG/M |
| 3300027911|Ga0209698_10192454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1654 | Open in IMG/M |
| 3300028906|Ga0308309_10543660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia | 1006 | Open in IMG/M |
| 3300029636|Ga0222749_10006755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4671 | Open in IMG/M |
| 3300029943|Ga0311340_10355852 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
| 3300029943|Ga0311340_10745068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 833 | Open in IMG/M |
| 3300031231|Ga0170824_110509811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300031234|Ga0302325_10497004 | All Organisms → cellular organisms → Bacteria | 1845 | Open in IMG/M |
| 3300031573|Ga0310915_10125641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1755 | Open in IMG/M |
| 3300031708|Ga0310686_114741348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2801 | Open in IMG/M |
| 3300031715|Ga0307476_11059717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300031719|Ga0306917_10696819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
| 3300031754|Ga0307475_10959016 | Not Available | 673 | Open in IMG/M |
| 3300032160|Ga0311301_10148328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4256 | Open in IMG/M |
| 3300032160|Ga0311301_12169492 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300032180|Ga0307471_100052513 | All Organisms → cellular organisms → Bacteria | 3374 | Open in IMG/M |
| 3300032180|Ga0307471_101942367 | Not Available | 737 | Open in IMG/M |
| 3300032180|Ga0307471_103107451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300032180|Ga0307471_103682297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300032782|Ga0335082_11190287 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300033829|Ga0334854_016819 | All Organisms → cellular organisms → Bacteria | 1771 | Open in IMG/M |
| 3300033982|Ga0371487_0000758 | All Organisms → cellular organisms → Bacteria | 47878 | Open in IMG/M |
| 3300034070|Ga0334822_093040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.66% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.84% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.13% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.27% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.42% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.42% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.42% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 2.56% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 2.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.56% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.56% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.71% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.71% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.85% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.85% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.85% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.85% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.85% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026341 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
| 3300033982 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fraction | Environmental | Open in IMG/M |
| 3300034070 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-3-M | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_100589706 | 3300001593 | Forest Soil | MSGSRGGLNGSTQHFLAVYSQESENLKFVVGVDLSA |
| JGI12635J15846_101029663 | 3300001593 | Forest Soil | VIRIRVPDKRGGLNGSTQHFLGVYSQESENLKFLVGVDLGA |
| JGI12635J15846_104280371 | 3300001593 | Forest Soil | MSDNPGGLNGSTQHFLEVYSQESENLKSLVGVDSS |
| JGI12635J15846_104480381 | 3300001593 | Forest Soil | MSGKAGGLNGSTQHFLGVYSQESENLKFLVGVDLSAALLCSDPTGNSRLGL |
| JGI25617J43924_100979501 | 3300002914 | Grasslands Soil | MTASTQMSDYLGGLNGWTQQLLEVYSRESENLRFFSGVDSSAVQ |
| Ga0066395_103380962 | 3300004633 | Tropical Forest Soil | MPGKSGGLSRSTQHFLEVYSQESENLEFVVGVDLSAALLCSDPTGN |
| Ga0066388_1061009602 | 3300005332 | Tropical Forest Soil | MSGNPGGLKGSPQHFVEVYSQESENPKFVVGVDLDAALLCSNPTGSSRL |
| Ga0070709_103698092 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VPDNSGGLNGSTQHFLEVYSQESENLKFVVGVDLSAALLCSDLTG |
| Ga0070761_104210341 | 3300005591 | Soil | MATLWLRPGKRGGLNGSKQHFLEVYSQESENLKFVVG |
| Ga0070763_105328662 | 3300005610 | Soil | VPDKSGGLNGSTQHFLGVCSQESENLKFLVDVDLSAALLCSDPTG |
| Ga0080027_101958541 | 3300005993 | Prmafrost Soil | MSGNPGGLNGSTQHFVEVYSRESENLKSLVGVDLSVALLCSDPT |
| Ga0075029_1001347062 | 3300006052 | Watersheds | MSGKSGGLNGSTQHFLEVYSQESENLKFVVGVDSSA |
| Ga0075030_1001818112 | 3300006162 | Watersheds | MSGKSGGLNGSTQHFLEVYSQESENLKFVVGVDSSAALLCSDPT |
| Ga0070716_1006227942 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VLRHLPGFAGGLNGSTQHFLEVYSQESENLKFVVGV |
| Ga0075014_1002316881 | 3300006174 | Watersheds | MSGKSGGLNGSTQHFLEVYSQESENLKFVVGVDSSAALLCS |
| Ga0070765_1002661161 | 3300006176 | Soil | VNFNLPDKSGGLNGSTQHFLEVYSQESENLKFLAGVDLSAAPLCSD |
| Ga0075425_1001619095 | 3300006854 | Populus Rhizosphere | MCQRLVGSLNGSTQHFPEVYSQESENLKFVVGVDLSAALLCSDPTGN |
| Ga0073928_101568373 | 3300006893 | Iron-Sulfur Acid Spring | LLLPGKSGGLNGSTQHFLEVYSQESENLKFVVGVDLSAALLCSDPTG |
| Ga0116225_11091252 | 3300009524 | Peatlands Soil | MSDKAGGFNGSTQHLLEVYSQESESLRFFSGVDLSAVPLC |
| Ga0074045_102851513 | 3300010341 | Bog Forest Soil | MSGLPGGLNGSTQHFPEVYSLASENPKFVVGVDLSAALLCSD |
| Ga0126378_123115252 | 3300010361 | Tropical Forest Soil | LPDLRGGLNGSTQHFLEVYSQESENLKFVVGVDLSAALLCSDPTGN |
| Ga0126379_117297061 | 3300010366 | Tropical Forest Soil | MHTGLTDSWAKVPDLSGGLNGSTQHFPAVYSPASETPKFVVGVDLSAA |
| Ga0136449_1009602801 | 3300010379 | Peatlands Soil | MSGLRGGFNGSTQHLLEVYSQESESLRFFSGVDLSAVPLCPVPT |
| Ga0137392_116437582 | 3300011269 | Vadose Zone Soil | MSGNPGGFNGSTQQLHEVYSQESESLRFFSGVDLSAVPLCPDP |
| Ga0137391_106401441 | 3300011270 | Vadose Zone Soil | MSDNPGGLNGSTQHFPEVYSQESENLKFVVGVDLSATLLCSDPTGNSRLGLR |
| Ga0137388_100733941 | 3300012189 | Vadose Zone Soil | MILFHLPGKSGGLNGSTQHFLEVYSQEFEILKFFLGADLTAAPLYPD |
| Ga0137365_102379661 | 3300012201 | Vadose Zone Soil | MRPGMQVPGKSGGFNGSTQHWLEVYSQESESLRFFSGVDLSAALLCPDP |
| Ga0137365_103921643 | 3300012201 | Vadose Zone Soil | MAAPDGTRSSPDKSGGFNGSTQHWLEVYSQESESLRFFSGVDLSAALLCPDP |
| Ga0137363_117241722 | 3300012202 | Vadose Zone Soil | MSGYAGGFNGSTQHFLGVYSQESENLKFVVGVDLSAALLCSDPTGN |
| Ga0137399_103719593 | 3300012203 | Vadose Zone Soil | MSGKVGGLNGSTQHFLEVYSQESENLKSLAGVDLSAAPLCSDPTG |
| Ga0137381_101926531 | 3300012207 | Vadose Zone Soil | MGSVPDKRGGFNGSTQHWLEVYSQESESLRFFSGVDLSAALLCPDPTGH |
| Ga0137379_112585622 | 3300012209 | Vadose Zone Soil | MGSVPDKRGGFNGSTQHWLEVYSQESESLRFFSGVDLSAALLCPDP |
| Ga0137372_106402992 | 3300012350 | Vadose Zone Soil | MRPGMQVPGKSGGFNGSTQHWLEVYSQESESLRFFSGVDLSAALLCPDPTG |
| Ga0137360_104939961 | 3300012361 | Vadose Zone Soil | MSGYAGGLNGSTQHFPEVYSQESENLKFVVGVDLS |
| Ga0137361_115715282 | 3300012362 | Vadose Zone Soil | MSGNPGGLNGWTQHWLEVYSQESENLGFFSGVGLSAALLCRVPT |
| Ga0137397_101240204 | 3300012685 | Vadose Zone Soil | VLGPGKSGGLNGSTQHLLAVYSPESENLKSLAGVDLSAAPLYSDPTG |
| Ga0137397_102943011 | 3300012685 | Vadose Zone Soil | VLVLGKSGGLNGSTQHFLEVYSQESENLKFVVGVDLSAALLCSDPTGN |
| Ga0137359_106755741 | 3300012923 | Vadose Zone Soil | MGWTQQLLEVYSRESENLRFFLGVGSSAVPLCPDPTGYSRTG |
| Ga0137359_107100811 | 3300012923 | Vadose Zone Soil | MISKPWVLINAGGLNGSTQHFLGVYSQESENLKFVVGVDLSAALLCSDPT |
| Ga0137359_109376972 | 3300012923 | Vadose Zone Soil | VPGKSGGLNGSTQHFPEVYSQESENLKFVVGVDLSAALLCSDP |
| Ga0137359_116206461 | 3300012923 | Vadose Zone Soil | MSGKAGGLNGSTQHFLEVYSQESENLKSLAGVDLSAA |
| Ga0137407_102918931 | 3300012930 | Vadose Zone Soil | VLGPGKSGGLNGSTQHFPEVYSQESENLKFVVGVDLSAALLCSDPTGNSRLGLRSSGS |
| Ga0137410_107671632 | 3300012944 | Vadose Zone Soil | VESLIRHLSGFDGGLNGSTQHFLGVYSQESENLKFVVGVDLSAALLCSDPTG |
| Ga0126369_107038911 | 3300012971 | Tropical Forest Soil | RGGLNGSTQHFLEVYSQESENLEFVAGVDLSAALLCSDPT* |
| Ga0126369_107827471 | 3300012971 | Tropical Forest Soil | MPGKSGGLSRSTQHFLEVYSQESENLEFVVGVDLSAALLCSDP |
| Ga0182018_100854522 | 3300014489 | Palsa | MSGNPGGLNGSTQHFLEVYSQESENLKFLVGVDLSAAPLCPDPTG |
| Ga0182018_102004271 | 3300014489 | Palsa | MPDKSGGLNGSTQHFLEVYSQESENLKFLVGVDLGAALLCSDPTGNSRLGL |
| Ga0182017_104288011 | 3300014494 | Fen | MGSTPGRRGGLNGSTQHFLEVYSQESENLKSFVGVDLSAALLCPDPT |
| Ga0182015_100989802 | 3300014495 | Palsa | MCIVSDLRGGLNGSMRHGLGLYSQESESLAFFSGADLDAVLLCPDVIG* |
| Ga0182024_103196803 | 3300014501 | Permafrost | MVRKMSGYPGGLNGSTQHFLEVYSQESENLKSLAGVDLSAAPLCS |
| Ga0182024_104104174 | 3300014501 | Permafrost | MPVSDKSGGLNGSTQHQLEVYLQESQKLKSFASVDSD* |
| Ga0182024_107381251 | 3300014501 | Permafrost | LSGGLNGSTQHFLEVYSQGSENLKFVVGVDLSAALL |
| Ga0137414_10062632 | 3300015051 | Vadose Zone Soil | MTRPETPTSSHMSGKPGGLNGSTQHFVEVYSQESENLKSLAGVDLSAAPLCSDPTGNSRIGR |
| Ga0137403_104402792 | 3300015264 | Vadose Zone Soil | MKSSRVPAKRGGLNGSTQHFLGVYSQESENLKFVVGVDLSAALL |
| Ga0132258_108034911 | 3300015371 | Arabidopsis Rhizosphere | MCLVNGGGLNGSTQHFLGVYSQESENLKFVVGVDLSAALLCSDPTGN |
| Ga0187803_100093683 | 3300017934 | Freshwater Sediment | MRFGGFNGSVQHSLEVYSQESRNLRFFSGVDLSAALLCRVQIENSRTGLFSWG |
| Ga0187819_107738373 | 3300017943 | Freshwater Sediment | VSGYGGGLNGSTQHFLEVYSQESENLKFVVGVDLGAAL |
| Ga0187778_109401192 | 3300017961 | Tropical Peatland | MSGYPGGLNGSTQHFLAVYSQGSENLKFVVGVDLSAALLCSDPTG |
| Ga0187783_104908592 | 3300017970 | Tropical Peatland | MPGKSGGFNGSTQHFLEVYSQESENLKFVVGVDLSA |
| Ga0187784_105092413 | 3300018062 | Tropical Peatland | MSGLPGGLNGSTQHFLEVYSRASENPKFVVGVDLGAAPLCSDPTG |
| Ga0187771_100408801 | 3300018088 | Tropical Peatland | MACKLEIIQVPDKSGGFNGSTQHFLEVYSQGSENLKFVVGVDLSAGLLCSDPTGN |
| Ga0187771_105507091 | 3300018088 | Tropical Peatland | MSGCPGGFNGSTQHFLEVYSQGSENLKFVVGVDLSAGLL |
| Ga0193725_11037872 | 3300019883 | Soil | MCRNLPDWSGGLNGSTQHFLEVYSQESENLKSLAGVDLSAALLCSDPTGNS |
| Ga0193733_11010642 | 3300020022 | Soil | MSGNAGGLNGSTQHFVEVYSQESENLKSLVGVDLSV |
| Ga0179590_10897822 | 3300020140 | Vadose Zone Soil | VGFSTKMSGFPGGLNGSTQHFLEVYSQESENLKSLAGVDLSAAPLCSDPTG |
| Ga0210403_100051651 | 3300020580 | Soil | MASASHVPDKSGGLNGSTQHFLEVYSQESENLKFVVGV |
| Ga0210403_100079641 | 3300020580 | Soil | MIQMSGKAGGLNGSTQHFLEVYSQESENLKFVVGVDLSA |
| Ga0210401_103378701 | 3300020583 | Soil | MSGKAGGLNGSTQHFLEVYSQESENLKFVVGVDLSAA |
| Ga0210401_108959471 | 3300020583 | Soil | MSGNAGGLNGSTQHFLGVYSQASENLKFLVGVDLSAALLCSD |
| Ga0215015_101485582 | 3300021046 | Soil | VPGKRGGLNGSTQHFPEVYSQESENLKFVVGVDLSAALLCSDPTGNSRLGLRSSGS |
| Ga0210405_102644393 | 3300021171 | Soil | MSGNPGGLNGSTQHFLEVYSQESENLKFVVDVDLSAA |
| Ga0210393_100327989 | 3300021401 | Soil | MREWSTPGLSGGLNGSTQHFPEVYSQASENPKFVVGVDLSAALL |
| Ga0210397_100151604 | 3300021403 | Soil | VPGKSGGLNGSTQHFLEVYSQESENLKFVVGVDLSAALLCSDPTG |
| Ga0210387_108634761 | 3300021405 | Soil | MSGNPGGLNGSTQHFLEVYSQESENLKFVVDVDLSAALLCSD |
| Ga0210386_110653661 | 3300021406 | Soil | MSKLSDFVGGLNGSTQHFLEVYSQESENLKSLAGVDLSAAPLCPVPTGN |
| Ga0210383_100354601 | 3300021407 | Soil | MSGYPGGLNGSTQHFLEVYSQESENLKFLVGVDLGAAPLC |
| Ga0210383_100904171 | 3300021407 | Soil | MSGQRGGLNGSTQHFLDVYSQESENLKFLVGVDLGAA |
| Ga0210383_101795874 | 3300021407 | Soil | VPDKSGGLNGSTQHFLEVYSQESENLKSLAGVDLSAAPLCP |
| Ga0210384_118669492 | 3300021432 | Soil | MARRLSTYQCPISSGGLNGSTQHFLEVYSQESENLKSLAGVDLSAAPLC |
| Ga0210390_100611905 | 3300021474 | Soil | VLVRDLSGSAGGLNGSTQHFLEVYSQESENLKFVVGVDLSAALLCSGPTGN |
| Ga0210402_102890904 | 3300021478 | Soil | MSGKRGGLNGSTQHFLEVYSPEFENLKFGVGVDLSAAPLCSG |
| Ga0210410_110814361 | 3300021479 | Soil | MVPEIGNISGNRGGLNGSTQHFPEVYSRASENPKFVVGVDLSAARLCSDPT |
| Ga0210409_100281491 | 3300021559 | Soil | VPGKSGGLNGSTQHFPEVYSQESENLKFVVGVDLSAALLCSDPTGN |
| Ga0210409_102030723 | 3300021559 | Soil | VESIARLAGQMSGKAGGLNGSTQHFPEVYSQESENLKFVVGVDLSAALLCSDPTGN |
| Ga0210409_102062054 | 3300021559 | Soil | MSSKAGGLNGSTQHFLEVYSQESENLKFVVGVDLSA |
| Ga0210409_112114601 | 3300021559 | Soil | MSGGLNGSTQHFPEVYSQESENLKFVVGVDLSAALLCSDLTGN |
| Ga0207699_105145602 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VPDNSGGLNGSTQHFLEVYSQESENLKFVVGVDLSAALLCSDLTGNS |
| Ga0257151_10085131 | 3300026341 | Soil | MWIQVSDYAGGLNGSTQHFLEVYSQESENLKFVVGVDLSAALLCSDPTGN |
| Ga0209648_104106832 | 3300026551 | Grasslands Soil | MSDYLGGLNGWTQQLLEVYSRESENLRFFSGVDSSAVQLCPVPTGYSR |
| Ga0208365_10383731 | 3300027070 | Forest Soil | VNTEFLLVRHLSGNPGGLNGSTQHFLEVYSQESENLKFVVDVDLSAAL |
| Ga0209116_100123212 | 3300027590 | Forest Soil | MSDYAGGLNGSTQHFLEVYSQESENLKFLVGVDLSA |
| Ga0209117_10022808 | 3300027645 | Forest Soil | MSDNPGGLNGSTQHFLEVYSQESENLKSLVGVDSSAA |
| Ga0209333_10603393 | 3300027676 | Forest Soil | MSDYAGGLNGSTQHFLEVYSQESENLKFLVGVDLSAALLCSD |
| Ga0209447_100901611 | 3300027701 | Bog Forest Soil | MSGKGGGLNGSTQHFLEVYSQESENLKFVVGVDLIAA |
| Ga0209465_100617811 | 3300027874 | Tropical Forest Soil | MPGKSGGLSRSTQHFLEVYSQESENLEFVVGVDLSAALLCS |
| Ga0209698_101924541 | 3300027911 | Watersheds | MSGKSGGLNGSTQHFLEVYSQESENLKFVVGVDSSAA |
| Ga0308309_105436601 | 3300028906 | Soil | MPDKSGGLNGSTQHFLEVYSQESENLKFVAGVDLSAA |
| Ga0222749_100067551 | 3300029636 | Soil | VPGKSGGLNGSTQHFLEVYSQESENLKFVVGVDLSAALLCSDPT |
| Ga0311340_103558522 | 3300029943 | Palsa | MSGNPGGLNGSTQHFLEVYSQESENLKFLVGVDLSAAPL |
| Ga0311340_107450681 | 3300029943 | Palsa | MSGNAGGLNGSTQHFLGVYSQESENLKFLVGVDLGAALL |
| Ga0170824_1105098112 | 3300031231 | Forest Soil | MLPPGKSGGLNRSTQHFVAVYSQESENLKFVVGVDLSAALLCSGPIG |
| Ga0302325_104970041 | 3300031234 | Palsa | MSGNPGGLNGSTQHFLEVYSQESENLKFLVGVDLSAAPLCPDPTGY |
| Ga0310915_101256414 | 3300031573 | Soil | MSDYPGGLNGSTQHFLEVYSQESENLKFVVGVDLSAALLCSDPTGNSRLGLCS |
| Ga0310686_1147413484 | 3300031708 | Soil | LSGNPGGLNGSTQHFLEVYSQESENLKFVVGVDLSAALLCSDPTGN |
| Ga0307476_110597171 | 3300031715 | Hardwood Forest Soil | MSGYPGGLNGSTQHFLEVYSQESENLKFVVGVDLSAALLCSDPTGNSRLGLRSSG |
| Ga0306917_106968192 | 3300031719 | Soil | MSDYPGGLNGSTQHFLEVYSQESENLKFVVGVDLSAALLCSDP |
| Ga0307475_109590162 | 3300031754 | Hardwood Forest Soil | MFSALDAFQVPGKSCQLNRSTQHFLEVYSQEFEILKFFLDADLSAAPL |
| Ga0311301_101483289 | 3300032160 | Peatlands Soil | MILIASGGLSPDKSGGFNGSTQHLLEVYSQESESLRFFSGVDLSAVPLCPVPTG |
| Ga0311301_121694921 | 3300032160 | Peatlands Soil | SDYRGGLRGSMQHFVGVYSQESESLRFFSGVDLGAALLCPDPLGRSQTGQFP |
| Ga0307471_1000525131 | 3300032180 | Hardwood Forest Soil | MPDKRGGLNGSTQHFPEVYSQESENPKFVVGVDLSAALLCP |
| Ga0307471_1019423671 | 3300032180 | Hardwood Forest Soil | MGTETDLSGFPGGLNGSTQHFPEVYSQESENLKFV |
| Ga0307471_1031074512 | 3300032180 | Hardwood Forest Soil | MSGNPGGLNGSTQHFPEVYSQESENLKFVVGVDLSAAL |
| Ga0307471_1036822971 | 3300032180 | Hardwood Forest Soil | MDFDFSDYPGGLNGSTQHFLEVYSQESENLKSLVGVDLSAAPLCSDPTGNSRSGLFSF |
| Ga0335082_111902871 | 3300032782 | Soil | MSGFAGGLNGSTQHFPEVYSQESENLKSLAGVDLSAGLLCSDP |
| Ga0334854_016819_1663_1770 | 3300033829 | Soil | MSGNPGGLNGSTQHFLEVYSQESENLKFLVGVDLSA |
| Ga0371487_0000758_47761_47877 | 3300033982 | Peat Soil | MPDWRGGLNGSPQHFLEVYTQESENLKSFVGVGLSAALL |
| Ga0334822_093040_2_151 | 3300034070 | Soil | MGSTPGRRGGLNGSTQHFLEVYSQESENLKSFVGVDLSAALLCPDPTGNS |
| ⦗Top⦘ |