


| Basic Information | |
|---|---|
| Family ID | F077650 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 46 residues |
| Representative Sequence | DFPKELQSRAISLAMALGKQVDRQKFAIALLRKLDRTYRELFGKS |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.85 % |
| % of genes near scaffold ends (potentially truncated) | 96.58 % |
| % of genes from short scaffolds (< 2000 bps) | 93.16 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.436 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (39.316 % of family members) |
| Environment Ontology (ENVO) | Unclassified (51.282 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (64.103 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.95% β-sheet: 0.00% Coil/Unstructured: 52.05% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF03006 | HlyIII | 6.84 |
| PF02885 | Glycos_trans_3N | 3.42 |
| PF03099 | BPL_LplA_LipB | 2.56 |
| PF00591 | Glycos_transf_3 | 1.71 |
| PF04073 | tRNA_edit | 0.85 |
| PF03567 | Sulfotransfer_2 | 0.85 |
| PF13419 | HAD_2 | 0.85 |
| PF01729 | QRPTase_C | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG1272 | Predicted membrane channel-forming protein YqfA, hemolysin III family | Intracellular trafficking, secretion, and vesicular transport [U] | 6.84 |
| COG0095 | Lipoate-protein ligase A | Coenzyme transport and metabolism [H] | 2.56 |
| COG0321 | Lipoate-protein ligase B | Coenzyme transport and metabolism [H] | 2.56 |
| COG0340 | Biotin-protein ligase | Coenzyme transport and metabolism [H] | 2.56 |
| COG0157 | Nicotinate-nucleotide pyrophosphorylase | Coenzyme transport and metabolism [H] | 0.85 |
| COG1488 | Nicotinic acid phosphoribosyltransferase | Coenzyme transport and metabolism [H] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.44 % |
| Unclassified | root | N/A | 2.56 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459010|GIO7OMY02F7HWT | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 525 | Open in IMG/M |
| 3300000890|JGI11643J12802_12188777 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 640 | Open in IMG/M |
| 3300000955|JGI1027J12803_106702925 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300002899|JGIcombinedJ43975_10004705 | All Organisms → cellular organisms → Bacteria | 2205 | Open in IMG/M |
| 3300004463|Ga0063356_103238600 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 701 | Open in IMG/M |
| 3300005172|Ga0066683_10654024 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300005175|Ga0066673_10170507 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
| 3300005180|Ga0066685_10611134 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300005187|Ga0066675_10320837 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300005330|Ga0070690_100299330 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1153 | Open in IMG/M |
| 3300005445|Ga0070708_100543842 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1096 | Open in IMG/M |
| 3300005446|Ga0066686_10604465 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 745 | Open in IMG/M |
| 3300005447|Ga0066689_10615865 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300005447|Ga0066689_10677278 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300005451|Ga0066681_10608111 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300005451|Ga0066681_10894469 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300005454|Ga0066687_10381440 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300005536|Ga0070697_100692386 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 899 | Open in IMG/M |
| 3300005540|Ga0066697_10744394 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300005552|Ga0066701_10061286 | All Organisms → cellular organisms → Bacteria | 2102 | Open in IMG/M |
| 3300005554|Ga0066661_10681104 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300005557|Ga0066704_10913619 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300005561|Ga0066699_10216220 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1341 | Open in IMG/M |
| 3300005569|Ga0066705_10160991 | All Organisms → cellular organisms → Bacteria | 1385 | Open in IMG/M |
| 3300005569|Ga0066705_10178808 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1318 | Open in IMG/M |
| 3300005574|Ga0066694_10375944 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300005575|Ga0066702_10279737 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300005576|Ga0066708_10749280 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300005598|Ga0066706_11403395 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 527 | Open in IMG/M |
| 3300005842|Ga0068858_102179006 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300005937|Ga0081455_10352422 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1038 | Open in IMG/M |
| 3300006028|Ga0070717_10996348 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 763 | Open in IMG/M |
| 3300006032|Ga0066696_10183732 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium | 1325 | Open in IMG/M |
| 3300006032|Ga0066696_10954468 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300006034|Ga0066656_10920265 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300006046|Ga0066652_100047453 | All Organisms → cellular organisms → Bacteria | 3211 | Open in IMG/M |
| 3300006173|Ga0070716_101295851 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 589 | Open in IMG/M |
| 3300009090|Ga0099827_11287958 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 636 | Open in IMG/M |
| 3300009137|Ga0066709_100312473 | All Organisms → cellular organisms → Bacteria | 2141 | Open in IMG/M |
| 3300010303|Ga0134082_10113361 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1079 | Open in IMG/M |
| 3300010303|Ga0134082_10171581 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 882 | Open in IMG/M |
| 3300010304|Ga0134088_10252741 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300010323|Ga0134086_10153575 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 841 | Open in IMG/M |
| 3300010329|Ga0134111_10190837 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 825 | Open in IMG/M |
| 3300010337|Ga0134062_10057317 | All Organisms → cellular organisms → Bacteria | 1600 | Open in IMG/M |
| 3300010362|Ga0126377_12789998 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 563 | Open in IMG/M |
| 3300010364|Ga0134066_10063655 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300010366|Ga0126379_13863467 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 502 | Open in IMG/M |
| 3300011269|Ga0137392_10718744 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 827 | Open in IMG/M |
| 3300012198|Ga0137364_10043226 | All Organisms → cellular organisms → Bacteria | 2962 | Open in IMG/M |
| 3300012201|Ga0137365_10123205 | All Organisms → cellular organisms → Bacteria | 1949 | Open in IMG/M |
| 3300012208|Ga0137376_10793040 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 815 | Open in IMG/M |
| 3300012209|Ga0137379_10844221 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 820 | Open in IMG/M |
| 3300012353|Ga0137367_11142802 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 524 | Open in IMG/M |
| 3300012354|Ga0137366_10810185 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 664 | Open in IMG/M |
| 3300012357|Ga0137384_10233844 | All Organisms → cellular organisms → Bacteria | 1535 | Open in IMG/M |
| 3300012361|Ga0137360_11017429 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 715 | Open in IMG/M |
| 3300012582|Ga0137358_10593120 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 744 | Open in IMG/M |
| 3300012685|Ga0137397_10352919 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1096 | Open in IMG/M |
| 3300012927|Ga0137416_10189315 | All Organisms → cellular organisms → Bacteria | 1643 | Open in IMG/M |
| 3300012929|Ga0137404_11972201 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 544 | Open in IMG/M |
| 3300012948|Ga0126375_10832071 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300012975|Ga0134110_10220370 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 801 | Open in IMG/M |
| 3300012977|Ga0134087_10629662 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 559 | Open in IMG/M |
| 3300013296|Ga0157374_12631435 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 531 | Open in IMG/M |
| 3300013297|Ga0157378_10823475 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 955 | Open in IMG/M |
| 3300013308|Ga0157375_10278687 | All Organisms → cellular organisms → Bacteria | 1835 | Open in IMG/M |
| 3300014157|Ga0134078_10136171 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 954 | Open in IMG/M |
| 3300014166|Ga0134079_10364943 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 661 | Open in IMG/M |
| 3300014969|Ga0157376_10206873 | All Organisms → cellular organisms → Bacteria | 1809 | Open in IMG/M |
| 3300015373|Ga0132257_102683638 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 648 | Open in IMG/M |
| 3300017657|Ga0134074_1413096 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 501 | Open in IMG/M |
| 3300018431|Ga0066655_10110809 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
| 3300018431|Ga0066655_10847064 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 623 | Open in IMG/M |
| 3300019887|Ga0193729_1079419 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300020006|Ga0193735_1068140 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1032 | Open in IMG/M |
| 3300021363|Ga0193699_10050937 | Not Available | 1602 | Open in IMG/M |
| 3300025898|Ga0207692_10315174 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 956 | Open in IMG/M |
| 3300025922|Ga0207646_10408204 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1226 | Open in IMG/M |
| 3300025939|Ga0207665_10692578 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 801 | Open in IMG/M |
| 3300025945|Ga0207679_12091656 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 514 | Open in IMG/M |
| 3300026035|Ga0207703_11147393 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 747 | Open in IMG/M |
| 3300026118|Ga0207675_101762279 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 639 | Open in IMG/M |
| 3300026306|Ga0209468_1177529 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 539 | Open in IMG/M |
| 3300026317|Ga0209154_1085961 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1351 | Open in IMG/M |
| 3300026330|Ga0209473_1001324 | All Organisms → cellular organisms → Bacteria | 13874 | Open in IMG/M |
| 3300026330|Ga0209473_1045334 | All Organisms → cellular organisms → Bacteria | 1935 | Open in IMG/M |
| 3300026330|Ga0209473_1168955 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 866 | Open in IMG/M |
| 3300026332|Ga0209803_1086031 | Not Available | 1307 | Open in IMG/M |
| 3300026332|Ga0209803_1234912 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 639 | Open in IMG/M |
| 3300026343|Ga0209159_1202683 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 634 | Open in IMG/M |
| 3300026343|Ga0209159_1231856 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 565 | Open in IMG/M |
| 3300026343|Ga0209159_1279946 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 509 | Open in IMG/M |
| 3300026354|Ga0257180_1024795 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 794 | Open in IMG/M |
| 3300026377|Ga0257171_1032733 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 890 | Open in IMG/M |
| 3300026508|Ga0257161_1020255 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
| 3300026523|Ga0209808_1018952 | All Organisms → cellular organisms → Bacteria | 3434 | Open in IMG/M |
| 3300026523|Ga0209808_1195361 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 683 | Open in IMG/M |
| 3300026529|Ga0209806_1342087 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 502 | Open in IMG/M |
| 3300026530|Ga0209807_1261289 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 584 | Open in IMG/M |
| 3300026530|Ga0209807_1267633 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 577 | Open in IMG/M |
| 3300026536|Ga0209058_1173115 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 964 | Open in IMG/M |
| 3300026542|Ga0209805_1452690 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 501 | Open in IMG/M |
| 3300026547|Ga0209156_10116164 | Not Available | 1317 | Open in IMG/M |
| 3300026550|Ga0209474_10524748 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 600 | Open in IMG/M |
| 3300026550|Ga0209474_10587583 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 569 | Open in IMG/M |
| 3300028047|Ga0209526_10409616 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 898 | Open in IMG/M |
| 3300028791|Ga0307290_10024851 | All Organisms → cellular organisms → Bacteria | 2106 | Open in IMG/M |
| 3300028824|Ga0307310_10370268 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 707 | Open in IMG/M |
| 3300028884|Ga0307308_10129384 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1207 | Open in IMG/M |
| 3300028884|Ga0307308_10394261 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 663 | Open in IMG/M |
| 3300030969|Ga0075394_11705208 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 761 | Open in IMG/M |
| 3300031231|Ga0170824_101276809 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300031469|Ga0170819_16088459 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 898 | Open in IMG/M |
| 3300031716|Ga0310813_11727576 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 586 | Open in IMG/M |
| 3300031962|Ga0307479_11956903 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 536 | Open in IMG/M |
| 3300031996|Ga0308176_10590825 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1140 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 39.32% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 10.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.56% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.85% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.85% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002899 | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030969 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F62_07466730 | 2170459010 | Grass Soil | QCRVRFPFELRDRAISLAMALGQQVDRQKFAVALLRNLDLTYQEKFSKAVAA |
| JGI11643J12802_121887772 | 3300000890 | Soil | GELQDRATSLAMALGRQVERQNFAVALLRNLDLTYREKFSKSSRIA* |
| JGI1027J12803_1067029251 | 3300000955 | Soil | SLEDFPKELQSRAISLAMALGRQVDRQKFAVAVLRKLDRTYAASFAS* |
| JGIcombinedJ43975_100047054 | 3300002899 | Soil | EDFPKELQSRAISLAIALGRQVDRQNFAIALLRCLDRSYRERFG* |
| Ga0063356_1032386001 | 3300004463 | Arabidopsis Thaliana Rhizosphere | SELQGRAISLAMALDRQVDRQKFAAAVLRSLDRTYRETFSP* |
| Ga0066683_106540242 | 3300005172 | Soil | QSREDFPKELQSRAISLAMALGKQVDRQKFAIALLRKLDRSYRELFGTS* |
| Ga0066673_101705072 | 3300005175 | Soil | SREDFPKELQSRAISLAMALGKQVDRQKFAIALLRKLDRSYRELFGTS* |
| Ga0066685_106111341 | 3300005180 | Soil | QDFPSELQGRAISLAMALDRQIDRQKFAAAVLRSLDRTYRETFFS* |
| Ga0066675_103208371 | 3300005187 | Soil | EKLRDRAISLSVALGRQVDRQKFAIVLLRNLDRSYRERFG* |
| Ga0070690_1002993301 | 3300005330 | Switchgrass Rhizosphere | LQSRAISLAITLGKQVDRQSFSVALLRKLDRTYREKFVSAGL* |
| Ga0070708_1005438421 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | SELQGRAISLAMALDRQVDRQGFAAAVLRSLDRTYRETFSP* |
| Ga0066686_106044652 | 3300005446 | Soil | LQSRAISLAMALGKQVDRQKFAIALLRKLDRTYRELFGKS* |
| Ga0066689_106158651 | 3300005447 | Soil | SLEDFPPELQDRAISLAMALHRPVDRQQFAVVVLQNLDRTYHARFAPKR* |
| Ga0066689_106772781 | 3300005447 | Soil | NVNQSSQDFPSELQGRAISLAMALDRQIDRQKFAAAVLRSLDRTYRETFFS* |
| Ga0066681_106081112 | 3300005451 | Soil | EDFPAELRSRAISLAIAMHQPVDRQKLAIAILQNLDRTYRARFVGSS* |
| Ga0066681_108944691 | 3300005451 | Soil | SREDFPKELQSRAISLAMALGKQVDRQKFAIALLRKLDRTYRELFGKS* |
| Ga0066687_103814402 | 3300005454 | Soil | RDFPGELQARAISLAMALGRHIDRQKFAATVLRSLDQTYREIFTP* |
| Ga0070697_1006923861 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | RAISLAMAIGKHIDRQSFAVALLRKLDRTYREKFVSAEL* |
| Ga0066697_107443941 | 3300005540 | Soil | QSREDFPKELQSRAISLAMALGKQVDRQKFAIALLRKLDRTYRELFGKS* |
| Ga0066701_100612864 | 3300005552 | Soil | ELQDRAISLAMALHRPVDRQQFAVVVLQNLDRTYHARFAPKR* |
| Ga0066661_106811042 | 3300005554 | Soil | NQSLEDFPRELQSRAISLAMALARQVNRQKFAIALLRNLDRSYRERFC* |
| Ga0066704_109136191 | 3300005557 | Soil | VNQSLEDFPPELHGRAISLAMALHRPVDRQNFAVAILQNLDRTYRARFTPEY* |
| Ga0066699_102162203 | 3300005561 | Soil | EELRARAISLAMALDRQVDRHQFAVALLKNLDRSYREAFPP* |
| Ga0066705_101609912 | 3300005569 | Soil | INVNQSLEDFPAALQGRGISLAMALGQQVDRQRFAVALLRKLDRTYRESFAS* |
| Ga0066705_101788083 | 3300005569 | Soil | RAISLAMALDRQVDRHQFAVALLKNLDRSYREAFPP* |
| Ga0066694_103759441 | 3300005574 | Soil | NQSSQDFPSELQGRAISLAMALDRQIDRQKFAAAVLRSLDRTYRETFFS* |
| Ga0066702_102797372 | 3300005575 | Soil | DFPEELQDKAISLAMVLSTQVDRQKFAIALLRELDRTYCEKFGSTGL* |
| Ga0066708_107492801 | 3300005576 | Soil | DFPKELQSRAISLAMALGKQVDRQKFAIALLRKLDRSYRELFGTS* |
| Ga0066706_114033952 | 3300005598 | Soil | INANQSLQDFPEKLRDRAISLSVALGRQVDRQKFATILLRNLDRSYRERFG* |
| Ga0068858_1021790061 | 3300005842 | Switchgrass Rhizosphere | DFPKELRTRAISLAIALGQQVDRQTFAIALLRSLDRSYRERFS* |
| Ga0081455_103524221 | 3300005937 | Tabebuia Heterophylla Rhizosphere | KAISLAMAVGKQVDRQSFAVALLRELDRTYRQKFTGAQP* |
| Ga0070717_109963482 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LQDKAISLAMAVGQQVPRQEFAVALLQKLDLTYREKFACSRGR* |
| Ga0066696_101837321 | 3300006032 | Soil | RAISLAMALDRQVNRHQFAVALLKNLDRSYREAFPP* |
| Ga0066696_109544681 | 3300006032 | Soil | NVNQSREDFPKELQSRAISLAMALGKQVDRQKFAIALLRKLDRTYRELFGKS* |
| Ga0066656_109202651 | 3300006034 | Soil | NQCRDDFPAELQDNAISMAMALGRQVDRQNFAVALLRNLDLTYREKFACSRGR* |
| Ga0066652_1000474536 | 3300006046 | Soil | ALQGRAISLAMALGQQVDRQRFAVALLRNLDRTYRESFAS* |
| Ga0070716_1012958512 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | AISLAMALGKQIDRQSFAVALLRKLDGTYREKFVSAGL* |
| Ga0099827_112879582 | 3300009090 | Vadose Zone Soil | SVEDFPPELQNRAISLAMALHRPVDRQNFAVALLQNLDRTYRARFVSADF* |
| Ga0066709_1003124733 | 3300009137 | Grasslands Soil | NVNQSREDFPKELQSRAISLAMALGKQVDRQKFAIALLRKLDRSYRELFGTS* |
| Ga0134082_101133612 | 3300010303 | Grasslands Soil | FPEKLRDRAISLAVALGRQVDRQKFAIAVLRNLDRTYRESFAS* |
| Ga0134082_101715811 | 3300010303 | Grasslands Soil | LQDFPRELQSRAISLAMALQQPVDRQKFAVAVLQNLDRTYQARFAPKC* |
| Ga0134088_102527413 | 3300010304 | Grasslands Soil | VNQSSQDFSGELQSRAISLAMALDRQVDRQKFAAAVLRSLDRTYRETFSP* |
| Ga0134086_101535752 | 3300010323 | Grasslands Soil | DDFPAGLQDRAISLAMALGRQVDRQNFAVALLRTLDLTYREKFSKAVRSR* |
| Ga0134111_101908371 | 3300010329 | Grasslands Soil | PKKLRARAISLAMALDRQVDRQKLAIALLRNLDRSYRERFG* |
| Ga0134062_100573171 | 3300010337 | Grasslands Soil | QCRDDFPAELQDNAISLAMALGREVTIQNFAVALLRKLDLTYREKFSKRA* |
| Ga0126377_127899981 | 3300010362 | Tropical Forest Soil | PAELQDRAISLAMALGRQVARQNFAVALLRNLDLTYRQKFSTAVSV* |
| Ga0134066_100636551 | 3300010364 | Grasslands Soil | VNQSHEDFPKELKSRAISLAMALGKPVDRQSFAIALLRELDRTYRARFRRNG* |
| Ga0126379_138634671 | 3300010366 | Tropical Forest Soil | VNQALEDFPRELQSRAISLAMALGRQVDRQGFAIALLRNLDRTYREKFPRAEL* |
| Ga0137392_107187441 | 3300011269 | Vadose Zone Soil | INVNQSVEDFPRELQSRAISLGMALGRQVDRQNFAIAVLRKLDRTYAESFVS* |
| Ga0137364_100432265 | 3300012198 | Vadose Zone Soil | PKELQGRAISLAMALDRQVDRRKFAVALLRNLDRSCRERFA* |
| Ga0137365_101232051 | 3300012201 | Vadose Zone Soil | DKAISLAMVLSTQVDRQKFAIALLRELDRTYREKFGSTGL* |
| Ga0137376_107930401 | 3300012208 | Vadose Zone Soil | ELQARAISLAMALGRHIDRQKFAATVLRSLDQTDREIFTP* |
| Ga0137379_108442211 | 3300012209 | Vadose Zone Soil | NVNQSAQDFPSELQGRAISLAIALDRQVDRQKFAAAVLRSLDRTYRETFFS* |
| Ga0137367_111428022 | 3300012353 | Vadose Zone Soil | KELQSRAISLAIALDRQVDRQNFAIALLRNLDRSYRERFR* |
| Ga0137366_108101851 | 3300012354 | Vadose Zone Soil | TSLAMALDRQVDRHQFAVALLKNLDRSYREAFPP* |
| Ga0137384_102338443 | 3300012357 | Vadose Zone Soil | VDLQGRAISLAMALGQGVDRQKFAVALLRNLDRTYRVRLASKC* |
| Ga0137360_110174292 | 3300012361 | Vadose Zone Soil | GINVNQSPQDFPAKLRDRAISLAVALGRQVDRQKFAIALMRNLDRSYRERFG* |
| Ga0137358_105931201 | 3300012582 | Vadose Zone Soil | DFPEKLRDRAISLAMALGRQVDRQKFAIVLLRNLDRSYRERFG* |
| Ga0137397_103529191 | 3300012685 | Vadose Zone Soil | SEDFPEELQSRAISLASALGRQVDRQNFAIALLRGLDRSYRERFG* |
| Ga0137416_101893151 | 3300012927 | Vadose Zone Soil | NVNQSREDFPTVLQSRAISLAMSLRKQVDRQKFAIALLRKLDRAYRELFGKS* |
| Ga0137404_119722012 | 3300012929 | Vadose Zone Soil | NQSLEDFPKELQGRAISLAMALDRQVDRRKFAIALLRNLDRSYRERFA* |
| Ga0126375_108320711 | 3300012948 | Tropical Forest Soil | LQDEAISIAMALGRQVDRQKFARALLRKLDLTYREKFSNSYSRAR* |
| Ga0134110_102203701 | 3300012975 | Grasslands Soil | VNQCRDDFPAELQDNPISLAMALGREVALQNFAVALLRKLDLTYREKFSKRA* |
| Ga0134087_106296621 | 3300012977 | Grasslands Soil | RAISLAMALGKQVDRQKFAIALLRKLDRTYRELFGKS* |
| Ga0157374_126314352 | 3300013296 | Miscanthus Rhizosphere | DDFPAELQDKAISLAMALSPQVERQNLAVALLRNLDLTYREQSSCSRGR* |
| Ga0157378_108234751 | 3300013297 | Miscanthus Rhizosphere | EDFPKELQSRAISLAITLGKQVDRQSFSVALLRKLDRTYREKFMSAGL* |
| Ga0157375_102786873 | 3300013308 | Miscanthus Rhizosphere | FPAELQDRAISLAMTLGRQVDRQKFAVALLRNLDLTYREEFSKPVPSF* |
| Ga0134078_101361711 | 3300014157 | Grasslands Soil | DDFPAELQDNAISMAMALGRQVDRQNFAVALLRNLDLTYREKFACSRGR* |
| Ga0134079_103649432 | 3300014166 | Grasslands Soil | REDFPVKLQDEAISMAMAVGRQVDRQNFAVALLRNLDLTYREKFACSRGR* |
| Ga0157376_102068731 | 3300014969 | Miscanthus Rhizosphere | CRDDFPAELQDRAISLAMSLGRQVDRQNLVLALLQNLDLTYREKFCCSRGR* |
| Ga0132257_1026836381 | 3300015373 | Arabidopsis Rhizosphere | VNQSRDDFPAELQDGAISLAMALGRRVDRQNFALALLRKLDVTYRQKFLDRAAVPEGADVG* |
| Ga0134074_14130961 | 3300017657 | Grasslands Soil | REDFPKELQSRAISLAMALGKQVDRQKFAIALLRKLDRTYRELFGKS |
| Ga0066655_101108091 | 3300018431 | Grasslands Soil | QSREDFPKELQSRAISLAMALGKQVDRQKFAIALLRKLDRSYRELFGTS |
| Ga0066655_108470641 | 3300018431 | Grasslands Soil | QSREDFPKELQSRAISLAMALGKQVDRQKFAIALLRKLDRTYRELFGKS |
| Ga0193729_10794191 | 3300019887 | Soil | INVSQSSQDFPEKLRDRAISLAVALGRQVDRQKFAIAVLRNLDRTYREKFAP |
| Ga0193735_10681401 | 3300020006 | Soil | QSSQDFPSELQGRAISLAMALDRQVDRQKFAAAVLRSLDRTYRETFSP |
| Ga0193699_100509371 | 3300021363 | Soil | VNQSREDFPKELQSRAISLAMALGKQIDRQSFAVALLRKLDRTYREKFVSAGL |
| Ga0207692_103151741 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LAMARGKQVDRQKFAIALLRNLDRTYRELFGKSQRLQS |
| Ga0207646_104082042 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | SHAISLAMALHRQVDRQKFALALLRKLDSTYRDLFGP |
| Ga0207665_106925781 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VNMNQSREDFPKELQSRAISLAIALGKQVNRQSFSVALLRKLDRTYREKFMSAGL |
| Ga0207679_120916561 | 3300025945 | Corn Rhizosphere | MNQCRDDFAAELQDKAISLAMAVGQQVPRQEFAVALLQKLDLTYREKFACSRGR |
| Ga0207703_111473931 | 3300026035 | Switchgrass Rhizosphere | NQTLEDFPKELRTRAISLAIALGQQVDRQTFAIALLRSLDRSYRERFS |
| Ga0207675_1017622792 | 3300026118 | Switchgrass Rhizosphere | QTLEDFPKELRTRAISLAIALGRQVDRQTFAIVLLRSLDRSYRERFG |
| Ga0209468_11775292 | 3300026306 | Soil | AGLQDRAISLAMALGRQVDRQNFAVALLRTLDLTYREKFSKAVRSR |
| Ga0209154_10859611 | 3300026317 | Soil | PAELQDNAISMAMALGRQVDRQNFAVALLRNLDLTYREKFACSRGR |
| Ga0209473_100132412 | 3300026330 | Soil | VNQSREDFPKELQSRAISLAMALGKQVDRQKFAIALLRKLDRSYRELFGTS |
| Ga0209473_10453341 | 3300026330 | Soil | VNQSREDFPKELQSRAISLAMALGKQVDRQKFAIALLRKLDRTYRELFGKS |
| Ga0209473_11689551 | 3300026330 | Soil | LAMVLGTQVDRQKFAIALLRELDRTYREKFGSTGL |
| Ga0209803_10860312 | 3300026332 | Soil | LQSRAISLAMALARQVNRQKFAIALLRNLDRSYRERFC |
| Ga0209803_12349122 | 3300026332 | Soil | NVNQSSQDFPSELQGRAISLAMALDRQIDRQKFAAAVLRSLDRTYRETFFS |
| Ga0209159_12026832 | 3300026343 | Soil | LRGQAISLAMALNRQVDRQKFAVAVLRNLGKTYREAFGS |
| Ga0209159_12318561 | 3300026343 | Soil | NVNQSMEDFPPELQDSAISLAMALHRPVDRRQFAVAVLRYLDRTYRERFTDEALQS |
| Ga0209159_12799461 | 3300026343 | Soil | LQGRAISLAMALGQQVDRQRFAVALLRNLDRTYRESFAS |
| Ga0257180_10247951 | 3300026354 | Soil | NQSLEDFPKELQSRAISLAMALGRQVDRQKFAVAILRNLDRTYAKRFAS |
| Ga0257171_10327331 | 3300026377 | Soil | PKELQSRAISLAMVLGRQVDRQKFATALLRNLDRSYREIFGA |
| Ga0257161_10202551 | 3300026508 | Soil | QSREDFPTELQSRAISLAMALGEQVDRQKFAIALLRKLDRTYRELFGKS |
| Ga0209808_10189521 | 3300026523 | Soil | DFPKELQSRAISLAMALGKQVDRQKFAIALLRKLDRSYRELFGTS |
| Ga0209808_11953611 | 3300026523 | Soil | NQSLEDFPAELQSRAISLAIAMHQPVDRQKLAIAILQNLDRTYRARFAGNS |
| Ga0209806_13420871 | 3300026529 | Soil | DFPKELQSRAISLAMALGKQVDRQKFAIALLRKLDRTYRELFGKS |
| Ga0209807_12612891 | 3300026530 | Soil | ELQSRAISLAMALGKQVDRQKFAIALLRKLDRSYRELFGTS |
| Ga0209807_12676332 | 3300026530 | Soil | ELQSRAISLAMALGKQVDRQKFAIALLRKLDRTYRELFGKS |
| Ga0209058_11731151 | 3300026536 | Soil | SELQGRAISLAIALDRQVDRQKFAAAVLRSLDRTYRETFFS |
| Ga0209805_14526901 | 3300026542 | Soil | INVNQSSRDFPGELQARAISLAMALGRHIDRQKFAATVLRSLDQTYREIFTP |
| Ga0209156_101161641 | 3300026547 | Soil | QSRAISLAMALGKQVDRQKFAIALLRKLDRTYRELFGKS |
| Ga0209474_105247482 | 3300026550 | Soil | NQSLQDFPEKLRDRAISLAVALGRQVDRQKFAIAVLRNLDRTYRESFAS |
| Ga0209474_105875832 | 3300026550 | Soil | NVNQSSQDFPSELQGRAISLAMALGRQVDRQKFAAAVLRSLDRTYRETSFS |
| Ga0209526_104096162 | 3300028047 | Forest Soil | DFPTELQSRAISLAMALGEQVDRQKFAIALLRKLDRTYRELFGKS |
| Ga0307290_100248514 | 3300028791 | Soil | RAISLAMVLGRQVNRQKFAIALLRKLDRAYRELFGKS |
| Ga0307310_103702681 | 3300028824 | Soil | QSRAISLAMVLGRQVNRQKFAIALLRKLDRAYRELFGKS |
| Ga0307308_101293842 | 3300028884 | Soil | FPKELQSRAISLAMALGRQVDRQKFAVAVLRKLDRTYAKSFAS |
| Ga0307308_103942612 | 3300028884 | Soil | NVNQSSQDFPSELQGRAISLAMALDRQVDRQKFAAAVLRSLDRTYRETFSP |
| Ga0075394_117052081 | 3300030969 | Soil | REDFPKKLQSRVISLAMALGKQVDRRKFAAALLRKLDRTYRELFGKGKRLQS |
| Ga0170824_1012768091 | 3300031231 | Forest Soil | REDFPKELQSRAVSLAMALGKQVDRRKFAIALLRKLDRTYRELFGKGKRLQS |
| Ga0170819_160884592 | 3300031469 | Forest Soil | FPPELQSRAMSLAMALGRPVDRQKLAAAVLRYLDRTYRERFTDEALQS |
| Ga0310813_117275761 | 3300031716 | Soil | PKELQSRAISLAMALGKQVDRQKFAIALLRKLDRTYRELFGKS |
| Ga0307479_119569031 | 3300031962 | Hardwood Forest Soil | RAISLAMALGKEVDRQKFAIALLRKLDRTYRELFGKRLQS |
| Ga0308176_105908251 | 3300031996 | Soil | ELQDKATSLAMASGRQVDRQHFVIALLRNLDLTYREKFSKNRRSL |
| ⦗Top⦘ |