


| Basic Information | |
|---|---|
| Family ID | F077641 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 40 residues |
| Representative Sequence | RAPAGISVIARVEDDRLILDLRTVFPEQEPLLIKTLAAALH |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.85 % |
| % of genes near scaffold ends (potentially truncated) | 99.15 % |
| % of genes from short scaffolds (< 2000 bps) | 85.47 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.889 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (39.316 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.026 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.299 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.09% β-sheet: 14.49% Coil/Unstructured: 59.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF08240 | ADH_N | 29.91 |
| PF12704 | MacB_PCD | 20.51 |
| PF00731 | AIRC | 4.27 |
| PF00069 | Pkinase | 4.27 |
| PF00450 | Peptidase_S10 | 1.71 |
| PF01402 | RHH_1 | 1.71 |
| PF07883 | Cupin_2 | 1.71 |
| PF04342 | DMT_6 | 1.71 |
| PF00266 | Aminotran_5 | 1.71 |
| PF02687 | FtsX | 0.85 |
| PF05711 | TylF | 0.85 |
| PF05231 | MASE1 | 0.85 |
| PF07642 | BBP2 | 0.85 |
| PF04055 | Radical_SAM | 0.85 |
| PF00482 | T2SSF | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 17.09 |
| COG2939 | Carboxypeptidase C (cathepsin A) | Amino acid transport and metabolism [E] | 1.71 |
| COG3169 | Uncharacterized membrane protein, DMT/DUF486 family | Function unknown [S] | 1.71 |
| COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.85 |
| COG3447 | Integral membrane sensor domain MASE1 | Signal transduction mechanisms [T] | 0.85 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.89 % |
| Unclassified | root | N/A | 11.11 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001545|JGI12630J15595_10002303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 4172 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100041381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 4153 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100992457 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300002917|JGI25616J43925_10247257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300005542|Ga0070732_10400014 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300005555|Ga0066692_10383179 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300005555|Ga0066692_10793705 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300005921|Ga0070766_10989859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 578 | Open in IMG/M |
| 3300006050|Ga0075028_100166490 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300006059|Ga0075017_101157861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 605 | Open in IMG/M |
| 3300006173|Ga0070716_101715215 | Not Available | 518 | Open in IMG/M |
| 3300006755|Ga0079222_10583599 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300006794|Ga0066658_10467621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 686 | Open in IMG/M |
| 3300006796|Ga0066665_10050922 | All Organisms → cellular organisms → Bacteria | 2852 | Open in IMG/M |
| 3300006954|Ga0079219_11414495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300007258|Ga0099793_10689749 | Not Available | 515 | Open in IMG/M |
| 3300007788|Ga0099795_10301033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300009012|Ga0066710_102085056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 835 | Open in IMG/M |
| 3300009038|Ga0099829_10242847 | All Organisms → cellular organisms → Bacteria | 1467 | Open in IMG/M |
| 3300009088|Ga0099830_10738422 | Not Available | 811 | Open in IMG/M |
| 3300009088|Ga0099830_11201670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300009089|Ga0099828_10358472 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| 3300009089|Ga0099828_11418038 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300009089|Ga0099828_11786370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300009090|Ga0099827_11855045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300009137|Ga0066709_103117935 | Not Available | 606 | Open in IMG/M |
| 3300009143|Ga0099792_10490062 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300009143|Ga0099792_10715397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
| 3300010335|Ga0134063_10033495 | All Organisms → cellular organisms → Bacteria | 2193 | Open in IMG/M |
| 3300010358|Ga0126370_11295677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
| 3300010364|Ga0134066_10286770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300010375|Ga0105239_13362488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300010376|Ga0126381_101735928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 901 | Open in IMG/M |
| 3300010376|Ga0126381_103199579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300010376|Ga0126381_104045677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300011269|Ga0137392_10431410 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300011269|Ga0137392_11513699 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300011271|Ga0137393_10150745 | All Organisms → cellular organisms → Bacteria | 1941 | Open in IMG/M |
| 3300011271|Ga0137393_10258366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1479 | Open in IMG/M |
| 3300012189|Ga0137388_10187650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1856 | Open in IMG/M |
| 3300012189|Ga0137388_10954108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
| 3300012198|Ga0137364_11127252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300012199|Ga0137383_10039160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3360 | Open in IMG/M |
| 3300012202|Ga0137363_11488065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300012205|Ga0137362_11530536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300012206|Ga0137380_10162775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2034 | Open in IMG/M |
| 3300012206|Ga0137380_11165596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300012207|Ga0137381_10300917 | All Organisms → cellular organisms → Bacteria | 1397 | Open in IMG/M |
| 3300012209|Ga0137379_10746867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 884 | Open in IMG/M |
| 3300012209|Ga0137379_11461557 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300012349|Ga0137387_10195233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1452 | Open in IMG/M |
| 3300012349|Ga0137387_10200150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1434 | Open in IMG/M |
| 3300012357|Ga0137384_10008036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8521 | Open in IMG/M |
| 3300012362|Ga0137361_10052649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3366 | Open in IMG/M |
| 3300012362|Ga0137361_10265663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1566 | Open in IMG/M |
| 3300012363|Ga0137390_11885040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300012363|Ga0137390_11933934 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 517 | Open in IMG/M |
| 3300012683|Ga0137398_10494526 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300012683|Ga0137398_10550555 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300012685|Ga0137397_10846131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300012918|Ga0137396_10854969 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300012922|Ga0137394_10739236 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300012923|Ga0137359_10351025 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300012925|Ga0137419_11057533 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300012929|Ga0137404_10064960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2844 | Open in IMG/M |
| 3300012930|Ga0137407_11239877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 708 | Open in IMG/M |
| 3300012931|Ga0153915_10023163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6151 | Open in IMG/M |
| 3300012944|Ga0137410_11819223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300012976|Ga0134076_10415996 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300014150|Ga0134081_10033365 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1498 | Open in IMG/M |
| 3300014154|Ga0134075_10019707 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2674 | Open in IMG/M |
| 3300015357|Ga0134072_10244935 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 643 | Open in IMG/M |
| 3300017928|Ga0187806_1076337 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300017940|Ga0187853_10384836 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300017943|Ga0187819_10116781 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1593 | Open in IMG/M |
| 3300020579|Ga0210407_10062321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2794 | Open in IMG/M |
| 3300020581|Ga0210399_10428400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1103 | Open in IMG/M |
| 3300021088|Ga0210404_10871341 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300021168|Ga0210406_10679546 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 795 | Open in IMG/M |
| 3300021168|Ga0210406_11011857 | Not Available | 618 | Open in IMG/M |
| 3300021170|Ga0210400_10011271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7179 | Open in IMG/M |
| 3300021178|Ga0210408_10510586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 955 | Open in IMG/M |
| 3300021178|Ga0210408_11109754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300021181|Ga0210388_10582671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 979 | Open in IMG/M |
| 3300021401|Ga0210393_11121810 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300021404|Ga0210389_10962833 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300021405|Ga0210387_10386548 | Not Available | 1239 | Open in IMG/M |
| 3300021475|Ga0210392_11296088 | Not Available | 545 | Open in IMG/M |
| 3300021479|Ga0210410_10823950 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300024290|Ga0247667_1007161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2325 | Open in IMG/M |
| 3300025932|Ga0207690_10319704 | Not Available | 1220 | Open in IMG/M |
| 3300025938|Ga0207704_10636812 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300026118|Ga0207675_102311644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300026296|Ga0209235_1213686 | Not Available | 637 | Open in IMG/M |
| 3300026304|Ga0209240_1106525 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300026482|Ga0257172_1093056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300027071|Ga0209214_1051494 | Not Available | 558 | Open in IMG/M |
| 3300027370|Ga0209010_1033785 | Not Available | 874 | Open in IMG/M |
| 3300027591|Ga0209733_1070074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 910 | Open in IMG/M |
| 3300027591|Ga0209733_1091423 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300027645|Ga0209117_1019553 | Not Available | 2199 | Open in IMG/M |
| 3300027655|Ga0209388_1113961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
| 3300027660|Ga0209736_1024024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1851 | Open in IMG/M |
| 3300027684|Ga0209626_1075060 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300027737|Ga0209038_10259667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300027842|Ga0209580_10648702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300027846|Ga0209180_10360246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 828 | Open in IMG/M |
| 3300027875|Ga0209283_10135038 | All Organisms → cellular organisms → Bacteria | 1632 | Open in IMG/M |
| 3300027889|Ga0209380_10536565 | Not Available | 681 | Open in IMG/M |
| 3300030737|Ga0302310_10268401 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300031090|Ga0265760_10248488 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300031708|Ga0310686_119557918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1042 | Open in IMG/M |
| 3300031753|Ga0307477_10206661 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
| 3300031754|Ga0307475_10234384 | All Organisms → cellular organisms → Bacteria | 1470 | Open in IMG/M |
| 3300032059|Ga0318533_10076346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2278 | Open in IMG/M |
| 3300032180|Ga0307471_100000881 | All Organisms → cellular organisms → Bacteria | 15938 | Open in IMG/M |
| 3300032180|Ga0307471_100315143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1658 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 39.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.53% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.13% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.42% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.42% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.71% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.71% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.71% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.85% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.85% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.85% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027370 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12630J15595_100023036 | 3300001545 | Forest Soil | GISVIARVEDARLILDLRTVFPEQETALLKTLIASLH* |
| JGIcombinedJ26739_1000413816 | 3300002245 | Forest Soil | SVIARVEDARLILDLRTVFPEQETALLKTLIASLH* |
| JGIcombinedJ26739_1009924573 | 3300002245 | Forest Soil | APAGVSVIARVEEDRLILDLRTVFPEQEPALLKTLAAALH* |
| JGI25616J43925_102472573 | 3300002917 | Grasslands Soil | RAPAGISVIARVEEDRLILDLRTVFPEQEPALLKTLFAVLH* |
| Ga0070732_104000142 | 3300005542 | Surface Soil | PAGIPVIARVEDDRLVLDLRTVFPEQEQALITTLAAVLH* |
| Ga0066692_103831792 | 3300005555 | Soil | RLRRAPAGVSLIARVEDDRLILDLRTVLPEQEPLLIKTLAAALR* |
| Ga0066692_107937051 | 3300005555 | Soil | VIARVEDERLILDLRTVFPEQEPLLIKTIAAVLR* |
| Ga0070766_109898591 | 3300005921 | Soil | EQRLRRAPAGISVIARVESDRLLLDLRTVLPAQEPQLVQSIAAAFR* |
| Ga0075028_1001664901 | 3300006050 | Watersheds | AGISVIARVEDDRLILDLRTVFPEQEPQLRQTVAAALR* |
| Ga0075017_1011578611 | 3300006059 | Watersheds | SVIARVEDERLILDLRTVFPEQEPLLIKTLANALH* |
| Ga0070716_1017152152 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | SVIACVEDDRLILDLRTVFTEQEPLLLKTLAAAMR* |
| Ga0079222_105835991 | 3300006755 | Agricultural Soil | EQRLRKAPAGISVIARVEDDRLIIDLRTVSVEEEPLLLKTLAATLR* |
| Ga0066658_104676211 | 3300006794 | Soil | EQRLRGAPAGISVIARVEDERLILDVRTVFPEQETLLAKTLAAVLR* |
| Ga0066665_100509223 | 3300006796 | Soil | VIARVEDERLILDVRTVFPEQETLLAKTLAAVLH* |
| Ga0079219_114144951 | 3300006954 | Agricultural Soil | IPIIARVEKNRVILDLRTVFPDQETVLIDSLVAVMTS* |
| Ga0099793_106897491 | 3300007258 | Vadose Zone Soil | RLRRAPTGISVIARVEDDRLILDLRTVFPEQESLLLKTLAATLR* |
| Ga0099795_103010333 | 3300007788 | Vadose Zone Soil | EQRLRKAPAGISVIARVEDNRLIIDLRTVSAEEEPLLLKTLAATLR* |
| Ga0066710_1020850561 | 3300009012 | Grasslands Soil | APPVVARVADGRLVLDLRTVHPEDEQALRRSLARILSGA |
| Ga0099829_102428474 | 3300009038 | Vadose Zone Soil | RLRRAPAGISVIARVEEDRLILDLRTVFPEQEPLLLKTLSAALH* |
| Ga0099830_107384222 | 3300009088 | Vadose Zone Soil | RAPAGISVIARVEDDRLILDLRTVFPEQEALLVKSVASALH* |
| Ga0099830_112016701 | 3300009088 | Vadose Zone Soil | SPSGVSVIARVEDDHLILDLRTVFPGQETLLISSLAAALR* |
| Ga0099828_103584721 | 3300009089 | Vadose Zone Soil | GISVITRVEEERLVIDLRTVFPEQEAALAASLAAALH* |
| Ga0099828_114180381 | 3300009089 | Vadose Zone Soil | RRAPSGISVIARVEDDRLILDLRTVFPEQEPLLRETLSSALR* |
| Ga0099828_117863702 | 3300009089 | Vadose Zone Soil | GPAGVSVIARVEDERLILDLRTVFPEQEPLLIKTLSAALH* |
| Ga0099827_118550451 | 3300009090 | Vadose Zone Soil | PAGVSVIARVEDDRLILDLRTVFPEQELLLINTLGAALH* |
| Ga0066709_1031179351 | 3300009137 | Grasslands Soil | RAPAGVSVIARVEDDRLILDLRTVFPEQEPVLLKTLAAALH* |
| Ga0099792_104900621 | 3300009143 | Vadose Zone Soil | RRAPAGVSVIARVEDDRLILDLRTVFPEQEPVLLKTLAAALH* |
| Ga0099792_107153971 | 3300009143 | Vadose Zone Soil | GVSVIARVEDNRLILDLRTVFPEQEPLLIKTLAGALH* |
| Ga0134063_100334951 | 3300010335 | Grasslands Soil | RLRCAPAGVSVIARVEDDRLILDLRTVFPEQEPVLVKTLAAALH* |
| Ga0126370_112956772 | 3300010358 | Tropical Forest Soil | RRAPAGISVIARVEEDRLVLDLRTVFPKQEPLLIKTLAAVLH* |
| Ga0134066_102867702 | 3300010364 | Grasslands Soil | LRRAPAWISVIARVEEDRLLLDLRTVFPEQEPLLVKTLAAALH* |
| Ga0105239_133624881 | 3300010375 | Corn Rhizosphere | ARVSVIARVESDRLILDVRTVLPAQEPQLVQSIAAALR* |
| Ga0126381_1017359281 | 3300010376 | Tropical Forest Soil | LRRSPAVPVIARIEDHRLLIDLRTVFPEQEPLLLKSLSAALH* |
| Ga0126381_1031995792 | 3300010376 | Tropical Forest Soil | SVIARVEDDRLILDLRTVFPEQEPLLAKTLAAALH* |
| Ga0126381_1040456771 | 3300010376 | Tropical Forest Soil | GISVIARVEEDRLVLDLRTVFPEQEPLLVKTLAAALH* |
| Ga0137392_104314104 | 3300011269 | Vadose Zone Soil | RAPAGISVIARVEDDRLILDLRTVFPEQEPLLIKTLAAALH* |
| Ga0137392_115136992 | 3300011269 | Vadose Zone Soil | RLRRAPADISVIARVEDARLILDLRTVFPEQEPALLKTLSAALH* |
| Ga0137393_101507451 | 3300011271 | Vadose Zone Soil | QRLRRAPAGVSVIARVEDERLILDLRTVFPEQEPLLVKTLAATLR* |
| Ga0137393_102583661 | 3300011271 | Vadose Zone Soil | GVSVIARVEDERLILDLRTVFPEQEPLLIKTLSAALH* |
| Ga0137388_101876501 | 3300012189 | Vadose Zone Soil | RRAPAGVSVIARVEDDRLILDLRTVFPEQEPLLLKTLASVLH* |
| Ga0137388_109541082 | 3300012189 | Vadose Zone Soil | VIARVEDERLILDLRTVFPEQEPLLIKTLASALH* |
| Ga0137364_111272521 | 3300012198 | Vadose Zone Soil | LRCAPAGVSVIARVEDDHLILDLRTVFPEQEPLLVNTLVSALH* |
| Ga0137383_100391601 | 3300012199 | Vadose Zone Soil | ATKLEQRLRGAPAGISVIARVEDDRLILDLRTVFREQEVLLAKTLAAVLH* |
| Ga0137363_114880653 | 3300012202 | Vadose Zone Soil | EQRLRKAPAGISVIARVEESRLILDIRTVFPEQEPLLLKTLAATFR* |
| Ga0137362_115305361 | 3300012205 | Vadose Zone Soil | SVIARVEDDRLILDLRTVFPEQEPLLIKTLSAALH* |
| Ga0137380_101627751 | 3300012206 | Vadose Zone Soil | PAGVSVIARVEDDRLILDLRTVFPEQELLLVKTLGAALH* |
| Ga0137380_111655961 | 3300012206 | Vadose Zone Soil | SVIARVEDERLILDVRTVFPEQETLLAKTLAAVLH* |
| Ga0137381_103009171 | 3300012207 | Vadose Zone Soil | RAPAGIAVIARVEDERLILDLRTVFPEQEPLLIKTLAAALH* |
| Ga0137379_107468672 | 3300012209 | Vadose Zone Soil | AGISVIARVEEDRLVLDLRTVFPDQEPLLVKTLAAALH* |
| Ga0137379_114615572 | 3300012209 | Vadose Zone Soil | RAPAGIAVIARVEDERLILDLRTVFPEQEPLLIKTLAAVLH* |
| Ga0137387_101952331 | 3300012349 | Vadose Zone Soil | QRLRRAPAGVSVIARVEADRLILDLRTVFPEQEPLLIKTLAAALH* |
| Ga0137387_102001501 | 3300012349 | Vadose Zone Soil | RYSATKLERGLRGPPAGIAVIAGVEVERLILDLRTVFPEQEPLLITTLAAVLH* |
| Ga0137384_100080367 | 3300012357 | Vadose Zone Soil | RRAPAGTSVIARVEDDRLALDLRTVFPEQEPLLVKTLAAALH* |
| Ga0137361_100526495 | 3300012362 | Vadose Zone Soil | QRLRRAPAGVSVIARVEDERLILDLRTVFPEQESLLVKTVAAALH* |
| Ga0137361_102656632 | 3300012362 | Vadose Zone Soil | APAGVSVIARVEDDRLILDLRTVFPEQEPLLLKTLASVLH* |
| Ga0137390_118850402 | 3300012363 | Vadose Zone Soil | ERRLRRAPAGVSVIACVEDDRLILDLRTVFPEQEPLLIKTLAAVLH* |
| Ga0137390_119339342 | 3300012363 | Vadose Zone Soil | LRRAPAGISVIARVEDDRLILDLRTVFPEQEVLLVKSVASVLR* |
| Ga0137398_104945261 | 3300012683 | Vadose Zone Soil | RRAPAGISVIARVEDDRLVLDLRTVFPEQESALLKTLSAALH* |
| Ga0137398_105505551 | 3300012683 | Vadose Zone Soil | RAPAGISVIARVEDDRLILDLRTVFPEQESLLRKTIAATLH* |
| Ga0137397_108461312 | 3300012685 | Vadose Zone Soil | AGVSVIARVEDDRLILDLRTVFPEQEPLLLKTLASVLH* |
| Ga0137396_108549691 | 3300012918 | Vadose Zone Soil | PAGVSVIARVEEDRLILDLRTVFPEQEPLLIKTLAAALH* |
| Ga0137394_107392362 | 3300012922 | Vadose Zone Soil | PAGMSVIARVEDDRLILDLRTVFPEQEPLLIKILGAALH* |
| Ga0137359_103510253 | 3300012923 | Vadose Zone Soil | PAGISVIARVEDDRLTIDLRTVFPEQEPLLLKTLAAALH* |
| Ga0137419_110575331 | 3300012925 | Vadose Zone Soil | RRAPAGISVIARVEDDRLILDLRTVFPEQEPLLLKTIAATLH* |
| Ga0137404_100649604 | 3300012929 | Vadose Zone Soil | PAGFSVIARVEDDRLILDLRTVFPEQEPLLLKTLAAALH* |
| Ga0137407_112398772 | 3300012930 | Vadose Zone Soil | VIARVEDDRLILDLRTVFPEQETLLVKTLAAVLH* |
| Ga0153915_100231631 | 3300012931 | Freshwater Wetlands | VIARVEDDRLVLDLRTVFPEQEPLLIKTLAAALH* |
| Ga0137410_118192231 | 3300012944 | Vadose Zone Soil | RAPAGVSVIARVEDDRLILDLRTIFPEQEPLLIKTLAAVLH* |
| Ga0134076_104159961 | 3300012976 | Grasslands Soil | SVIARVEDDRLILDLRTVFSEQEPLLIKTLSSALH* |
| Ga0134081_100333652 | 3300014150 | Grasslands Soil | ISVIARVEEDRLLLDLRTVFPEQEPLLVKTLAAALH* |
| Ga0134075_100197072 | 3300014154 | Grasslands Soil | VIARVEDDRLILDLRTVFPEQESLLIKTLSAALH* |
| Ga0134072_102449351 | 3300015357 | Grasslands Soil | RLRRAPAGTSVIARVEDDRLALDLRTVFPEQEPLLVKTLAAALH* |
| Ga0187806_10763372 | 3300017928 | Freshwater Sediment | ESRLRKGPAGISVIARIEDDCLLLDLRTVFPEQEAPLAESILAALS |
| Ga0187853_103848362 | 3300017940 | Peatland | RQAPAGIAVIARIEDDRLLLDLRTVFPDQETALLNSLLAALL |
| Ga0187819_101167811 | 3300017943 | Freshwater Sediment | LRRAPAGISVIARVEDDRLVLDLRTVSPEQEPLLLKTLAAVLH |
| Ga0210407_100623211 | 3300020579 | Soil | IPVIARVEDDRLVLDLRTVFPEQEPFLLKTLAAALH |
| Ga0210399_104284001 | 3300020581 | Soil | RGPAGIPVIARVGDDRLVLDLRTVFPEQEPFLLKTLAAALH |
| Ga0210404_108713412 | 3300021088 | Soil | AGVSVIARVEDDRLTLDLRTVFPEQEPLLIKTLVAVLH |
| Ga0210406_106795461 | 3300021168 | Soil | PAGVSVIARVEDARLIVDLRTVFPEQEPALLKTLVTVLH |
| Ga0210406_110118571 | 3300021168 | Soil | LRRAPTGISVIARIEEDRLVLDLRTVFPEQEPLLVKTLAAALR |
| Ga0210400_100112711 | 3300021170 | Soil | PAGISVIARVEDDRVILDLRTVFQEQEVALLKTVAAALH |
| Ga0210408_105105862 | 3300021178 | Soil | GISVIARVEDDRLTLDLRTVFPEQEPLLIKTLAAVLR |
| Ga0210408_111097541 | 3300021178 | Soil | PAGVSVIARVEDDRLVLDLRTVFPEQEPLLLKTLAAVLH |
| Ga0210388_105826711 | 3300021181 | Soil | APGGISVIARVENDRLILDLRTVFPEQEPLLIKTLGAVLH |
| Ga0210393_111218102 | 3300021401 | Soil | GISVIARVESDRLLLDLRPVLPAQEPQLVQSIAAAFR |
| Ga0210389_109628332 | 3300021404 | Soil | LRRAPAGISVIARVESDRLLLDLRTVLPAQEPQLVQSIAAAFR |
| Ga0210387_103865482 | 3300021405 | Soil | GISVIARIEDNRLVLDLRTVFPEQEPQLVRALAAALR |
| Ga0210392_112960882 | 3300021475 | Soil | APAGISVIARVENDRLILDLRTVFPEQEPLLIKTLAAVLH |
| Ga0210410_108239502 | 3300021479 | Soil | RAPAGISVIARVENDRLILDLRTVFPEQEPLLVKTLGAALH |
| Ga0247667_10071613 | 3300024290 | Soil | ISVIARVENDRLMLDLRTVFPEQEPLLVKTLAAALH |
| Ga0207690_103197041 | 3300025932 | Corn Rhizosphere | APARISVIARVEENRLVLDLRTVFQEQEAPLLKMLVAALR |
| Ga0207704_106368121 | 3300025938 | Miscanthus Rhizosphere | SVIARVEENRLVLDLRTVFQEQEAPLLKMLVAALR |
| Ga0207675_1023116441 | 3300026118 | Switchgrass Rhizosphere | LPARISVIARVEENRLVLDLRTVFQEQEAPLLKMLVAALRWMNRRGA |
| Ga0209235_12136862 | 3300026296 | Grasslands Soil | PAGVSVIARVEDDRLILDLRTVFPEQEPVLLKTLAAALH |
| Ga0209240_11065254 | 3300026304 | Grasslands Soil | LRRAPAGTSVIARVEDDRLILDLRTVFPEQEALLIRTLAAVLH |
| Ga0257172_10930562 | 3300026482 | Soil | RGAPAGISVIARVEDDRLILDLRTVFPEQETLLVKTLAAVLH |
| Ga0209214_10514941 | 3300027071 | Forest Soil | RRAPAGTSVIARVEDDRLTLDLRTVFPEQEPLLVKTLAAALQ |
| Ga0209010_10337851 | 3300027370 | Forest Soil | PRHSAAQLEQRLRRRAGISVIARVESDCLILDLRTVLPAQESQLVQSIAAAFR |
| Ga0209733_10700741 | 3300027591 | Forest Soil | RLRRAPAGVSVITRVEDDRLILDLRTVFPEQEPLLIKTLAGALH |
| Ga0209733_10914232 | 3300027591 | Forest Soil | RLRLAPAGVSVIARVEDDRLILDLRTVFPEQESLLLKTLSSVLH |
| Ga0209117_10195531 | 3300027645 | Forest Soil | RAPAGTSVIARVEDDRLIVDLRTVFPEQEALLIKTLAAVLH |
| Ga0209388_11139611 | 3300027655 | Vadose Zone Soil | AGVSVIARVEDDRLILDLRTVFPEQEPALLKTLFAVLH |
| Ga0209736_10240243 | 3300027660 | Forest Soil | GVSVIARVEEDRVILDLRTVFPEQEPRLAESLAAALG |
| Ga0209626_10750601 | 3300027684 | Forest Soil | RPASGVSVIARVEEDRVILDLRTVFPEQEPQLVASLAVALR |
| Ga0209038_102596672 | 3300027737 | Bog Forest Soil | PAGISVIARVEDDRLVIDLRTVFPEQEPLLLKTLAAALH |
| Ga0209580_106487021 | 3300027842 | Surface Soil | PAGVSVIARVEEDRLVLDLRTVFREQEPALIATLAAVLH |
| Ga0209180_103602464 | 3300027846 | Vadose Zone Soil | VSVIARVEDDRLLLDLRTVLPEQEPLLIKTLAATLQ |
| Ga0209283_101350381 | 3300027875 | Vadose Zone Soil | GVSVIARVEDDRLILDLRTVFPEQEPLLIQTVAAALH |
| Ga0209380_105365652 | 3300027889 | Soil | RAPAGISVIARVENDRLVLDLRTVFAEQEPLLIKTLSAALH |
| Ga0302310_102684012 | 3300030737 | Palsa | HLRKAPGGTSVIARVEDARLVLDLRTVFPDQEGVLHQALVAGLH |
| Ga0265760_102484881 | 3300031090 | Soil | LEQRLRRRAGISVIARVESDCLILDLRTVLPVQESQLVQSIAAALR |
| Ga0310686_1195579181 | 3300031708 | Soil | ISVIARVEDDRLVLDLRTVFPEQEPLLGKTLSAALH |
| Ga0307477_102066611 | 3300031753 | Hardwood Forest Soil | AGISVIARVEEDRLVLDLRTVFPEQEPLLVKTLAAALH |
| Ga0307475_102343841 | 3300031754 | Hardwood Forest Soil | AHGPSVIARVEENRVILDLRTVFPEQQQQLAESLAAALR |
| Ga0318533_100763461 | 3300032059 | Soil | RRAPAGTSVIARVEDDRLTLDLRTVFPEQEPLLVKTLAAALR |
| Ga0307471_1000008811 | 3300032180 | Hardwood Forest Soil | AGTSVIARVEDDRLALDLRTVFPEQEPLLVKTLAAALH |
| Ga0307471_1003151431 | 3300032180 | Hardwood Forest Soil | TGVSVIARIEKDRLVLDLRTVFPEQDAALRESLVAALR |
| ⦗Top⦘ |