


| Basic Information | |
|---|---|
| Family ID | F077618 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 42 residues |
| Representative Sequence | DDPKTFSKPWTFTTHPSLLRGELIEYICQENNKDVEHLVGK |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.71 % |
| % of genes near scaffold ends (potentially truncated) | 97.44 % |
| % of genes from short scaffolds (< 2000 bps) | 94.02 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.308 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (8.547 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.060 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.154 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.35% β-sheet: 26.09% Coil/Unstructured: 69.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF13620 | CarboxypepD_reg | 14.53 |
| PF07883 | Cupin_2 | 4.27 |
| PF05368 | NmrA | 2.56 |
| PF01436 | NHL | 2.56 |
| PF01594 | AI-2E_transport | 2.56 |
| PF00285 | Citrate_synt | 2.56 |
| PF13577 | SnoaL_4 | 2.56 |
| PF01475 | FUR | 1.71 |
| PF04075 | F420H2_quin_red | 1.71 |
| PF12796 | Ank_2 | 1.71 |
| PF00266 | Aminotran_5 | 1.71 |
| PF01571 | GCV_T | 1.71 |
| PF12543 | DUF3738 | 1.71 |
| PF00126 | HTH_1 | 1.71 |
| PF07729 | FCD | 0.85 |
| PF00501 | AMP-binding | 0.85 |
| PF00456 | Transketolase_N | 0.85 |
| PF13637 | Ank_4 | 0.85 |
| PF13857 | Ank_5 | 0.85 |
| PF15780 | ASH | 0.85 |
| PF00111 | Fer2 | 0.85 |
| PF08327 | AHSA1 | 0.85 |
| PF05163 | DinB | 0.85 |
| PF11453 | DUF2950 | 0.85 |
| PF09286 | Pro-kuma_activ | 0.85 |
| PF00529 | CusB_dom_1 | 0.85 |
| PF13487 | HD_5 | 0.85 |
| PF04253 | TFR_dimer | 0.85 |
| PF02641 | DUF190 | 0.85 |
| PF07519 | Tannase | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG0372 | Citrate synthase | Energy production and conversion [C] | 2.56 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 2.56 |
| COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 1.71 |
| COG0021 | Transketolase | Carbohydrate transport and metabolism [G] | 0.85 |
| COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.85 |
| COG1993 | PII-like signaling protein | Signal transduction mechanisms [T] | 0.85 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.85 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.85 |
| COG3959 | Transketolase, N-terminal subunit | Carbohydrate transport and metabolism [G] | 0.85 |
| COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.31 % |
| Unclassified | root | N/A | 7.69 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459006|GBPF9FW01EZNKL | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 2228664022|INPgaii200_c0737947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
| 3300000559|F14TC_100564420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1848 | Open in IMG/M |
| 3300004121|Ga0058882_1447254 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300005172|Ga0066683_10375743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 880 | Open in IMG/M |
| 3300005339|Ga0070660_101204086 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300005434|Ga0070709_10048530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2650 | Open in IMG/M |
| 3300005534|Ga0070735_10852270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300005536|Ga0070697_101681602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300005538|Ga0070731_10194513 | All Organisms → cellular organisms → Bacteria | 1346 | Open in IMG/M |
| 3300005541|Ga0070733_10447159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
| 3300005615|Ga0070702_100561676 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300005615|Ga0070702_100624246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300005764|Ga0066903_102734439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 957 | Open in IMG/M |
| 3300005764|Ga0066903_103865802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
| 3300005834|Ga0068851_11034861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella paludicola | 519 | Open in IMG/M |
| 3300006028|Ga0070717_11873490 | Not Available | 541 | Open in IMG/M |
| 3300006031|Ga0066651_10292557 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300006034|Ga0066656_11041658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300006174|Ga0075014_100887010 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300006797|Ga0066659_10227441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1382 | Open in IMG/M |
| 3300009012|Ga0066710_101805796 | Not Available | 923 | Open in IMG/M |
| 3300009093|Ga0105240_10787627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1031 | Open in IMG/M |
| 3300009148|Ga0105243_11642906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
| 3300009176|Ga0105242_10477375 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300009824|Ga0116219_10675263 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300010043|Ga0126380_11571834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Archangium → Archangium gephyra | 586 | Open in IMG/M |
| 3300010109|Ga0127497_1144777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300010362|Ga0126377_13070662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Archangium → Archangium gephyra | 539 | Open in IMG/M |
| 3300010376|Ga0126381_100159754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2970 | Open in IMG/M |
| 3300010376|Ga0126381_100527926 | All Organisms → cellular organisms → Bacteria | 1669 | Open in IMG/M |
| 3300010376|Ga0126381_104324332 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300010379|Ga0136449_101353464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1104 | Open in IMG/M |
| 3300010398|Ga0126383_10375040 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium BAC10-10 | 1452 | Open in IMG/M |
| 3300010398|Ga0126383_10403365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1405 | Open in IMG/M |
| 3300010398|Ga0126383_11047013 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium BAC10-10 | 905 | Open in IMG/M |
| 3300011120|Ga0150983_14382456 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300012198|Ga0137364_10497471 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300012202|Ga0137363_11397889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300012211|Ga0137377_10095786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2806 | Open in IMG/M |
| 3300012212|Ga0150985_113839327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
| 3300012398|Ga0134051_1119681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 805 | Open in IMG/M |
| 3300012469|Ga0150984_103231989 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300012469|Ga0150984_108286531 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300012469|Ga0150984_117008773 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300012685|Ga0137397_10193792 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium BAC10-10 | 1511 | Open in IMG/M |
| 3300012930|Ga0137407_12130430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300012944|Ga0137410_11477100 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300013102|Ga0157371_11010001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300013104|Ga0157370_10841925 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300013308|Ga0157375_12472940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300014150|Ga0134081_10153237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
| 3300014159|Ga0181530_10609070 | Not Available | 534 | Open in IMG/M |
| 3300014262|Ga0075301_1129383 | Not Available | 571 | Open in IMG/M |
| 3300014325|Ga0163163_11453044 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300014489|Ga0182018_10401613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300014657|Ga0181522_11030425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalogenimonas → Dehalogenimonas alkenigignens | 510 | Open in IMG/M |
| 3300014838|Ga0182030_10082936 | All Organisms → cellular organisms → Bacteria | 4608 | Open in IMG/M |
| 3300014969|Ga0157376_10981398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 866 | Open in IMG/M |
| 3300015372|Ga0132256_102802811 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300016422|Ga0182039_10790635 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300016445|Ga0182038_11428052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300017659|Ga0134083_10024858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2146 | Open in IMG/M |
| 3300017659|Ga0134083_10137132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 984 | Open in IMG/M |
| 3300018003|Ga0187876_1216822 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300018022|Ga0187864_10016061 | All Organisms → cellular organisms → Bacteria | 4782 | Open in IMG/M |
| 3300021405|Ga0210387_11270326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 637 | Open in IMG/M |
| 3300021420|Ga0210394_11536101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300021477|Ga0210398_11493631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300021560|Ga0126371_12847228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300022498|Ga0242644_1033270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 562 | Open in IMG/M |
| 3300022722|Ga0242657_1160973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 598 | Open in IMG/M |
| 3300022724|Ga0242665_10314940 | Not Available | 551 | Open in IMG/M |
| 3300025899|Ga0207642_10715448 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300025906|Ga0207699_10280580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1157 | Open in IMG/M |
| 3300025906|Ga0207699_11246356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300025911|Ga0207654_11257361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300025912|Ga0207707_10393350 | Not Available | 1191 | Open in IMG/M |
| 3300025913|Ga0207695_10681729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 908 | Open in IMG/M |
| 3300025919|Ga0207657_10301901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1268 | Open in IMG/M |
| 3300025919|Ga0207657_11426330 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300025924|Ga0207694_11463224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300025928|Ga0207700_11946918 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300025941|Ga0207711_10615656 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300025942|Ga0207689_11738662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300026023|Ga0207677_11643931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300026035|Ga0207703_10679685 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300026142|Ga0207698_10188583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1834 | Open in IMG/M |
| 3300026550|Ga0209474_10375331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 766 | Open in IMG/M |
| 3300027641|Ga0208827_1131844 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300027648|Ga0209420_1167111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300027669|Ga0208981_1111385 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300027853|Ga0209274_10755719 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300027867|Ga0209167_10829012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300027879|Ga0209169_10005534 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7284 | Open in IMG/M |
| 3300027895|Ga0209624_10223104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1253 | Open in IMG/M |
| 3300028381|Ga0268264_10308521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1492 | Open in IMG/M |
| 3300029951|Ga0311371_10645164 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300030805|Ga0265756_112892 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300031226|Ga0307497_10103408 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300031708|Ga0310686_101178158 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1177 | Open in IMG/M |
| 3300031712|Ga0265342_10186661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1133 | Open in IMG/M |
| 3300031820|Ga0307473_10244745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1096 | Open in IMG/M |
| 3300031820|Ga0307473_10585178 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
| 3300031823|Ga0307478_11319152 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300031912|Ga0306921_11837787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 650 | Open in IMG/M |
| 3300031912|Ga0306921_12470481 | Not Available | 540 | Open in IMG/M |
| 3300031938|Ga0308175_102025461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300031939|Ga0308174_11206402 | Not Available | 645 | Open in IMG/M |
| 3300031945|Ga0310913_11150956 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300031947|Ga0310909_10350008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus roseus | 1240 | Open in IMG/M |
| 3300031954|Ga0306926_12910397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300032039|Ga0318559_10353970 | Not Available | 683 | Open in IMG/M |
| 3300032066|Ga0318514_10791024 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300032160|Ga0311301_10990184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1114 | Open in IMG/M |
| 3300032829|Ga0335070_10241670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1775 | Open in IMG/M |
| 3300032955|Ga0335076_11217283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.84% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.13% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.27% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.27% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.42% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.56% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.56% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 2.56% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.71% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.71% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.85% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.85% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.85% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.85% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.85% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.85% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.85% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459006 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 0-10cm | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300004121 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF109 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010109 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012398 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014262 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022498 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030805 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| L01_02833490 | 2170459006 | Grass Soil | VHIIDDPKTFSRPWSFTTKPTLLRGELIEYICQENNKDVEHLVGK |
| INPgaii200_07379472 | 2228664022 | Soil | TIDDPKTFSKPWKFTTHPVLLRGELIEYICQENNKDVQHLVGK |
| F14TC_1005644201 | 3300000559 | Soil | IIDDPKTFSKPWTFTTQPSLLRGELIEYICQENNKDVEHLVGK* |
| Ga0058882_14472541 | 3300004121 | Forest Soil | PKAYTKPWKFTIHPMLLDGELMEYICQENNVDMKHLVGK* |
| Ga0066683_103757431 | 3300005172 | Soil | DDPKTFSKPWTFTTHPSLLRGELIEYICQENNKDVEHLVGK* |
| Ga0070660_1012040862 | 3300005339 | Corn Rhizosphere | QIEHTIDDPKTFSRPWSFTTHPSLLKGELIEYICQENNKDVEHLVGK* |
| Ga0070709_100485301 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | PKTFSKPWKFTTHPVLLRGELIEYICQENNRDVQHLVGK* |
| Ga0070735_108522701 | 3300005534 | Surface Soil | LTIVHTIDDPKTFSKPWSFTTHPSLLKGELIEYICQENNKDVQHLVGK* |
| Ga0070697_1016816022 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | PKTFSKPWTFTTHPSLLRGELIEYICQENNKDVEHLIGK* |
| Ga0070731_101945131 | 3300005538 | Surface Soil | KPWSFTTHPSLLKGELIEYICQENNRDVQHLVGK* |
| Ga0070733_104471593 | 3300005541 | Surface Soil | EHTIDDPKTFSKPWKFTTHPSMLKGELIEYICQENNRDVQHLVGK* |
| Ga0070702_1005616762 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | ERMTRTDLGHMEIVHIIEDPKTFSRTWTFTTKPTLLKGELIEYICQENNKDVEHLVGK* |
| Ga0070702_1006242462 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | IEHTIDDPKMFSKPWKFTTHPTLLRGELIEYICQENNKDVQHLVGK* |
| Ga0066903_1027344392 | 3300005764 | Tropical Forest Soil | KSYSKPRKFTTLPVMWRGELMEYIRQENNRDVERLVGKSK* |
| Ga0066903_1038658021 | 3300005764 | Tropical Forest Soil | IVHTIDDPKTFSRPWTFTTKPSMLKGELIEYICQENNKDVEHLIGK* |
| Ga0068851_110348611 | 3300005834 | Corn Rhizosphere | PKTFSKPWKFTTHPSLLRGELIEYICQENNKDVQHMVGK* |
| Ga0070717_118734902 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | IDDPKTFSKPWSFTTHPSLLKGELIEYICQENNRDVQHLVGPGK* |
| Ga0066651_102925573 | 3300006031 | Soil | KTFSRPWTFTTKPTLLKGELIEYICQENNKDVEHLVGK* |
| Ga0066656_110416581 | 3300006034 | Soil | IIDDPKTFSKPWTFTTHPSLLRGELIEYICQENNKDVEHLVGK* |
| Ga0075014_1008870102 | 3300006174 | Watersheds | HTVNDPGAYSKPWTFTTHPTLLNGELIEYICQENNRDVEHLKGK* |
| Ga0066659_102274411 | 3300006797 | Soil | EARIEDPKTFSRPWTFTTKPTLLKGELIEYICQENNKDVEHLVGK* |
| Ga0066710_1018057961 | 3300009012 | Grasslands Soil | IEDPKMFSRTWTFTTKPTLLKGELIEYICQENNKDVEHLVGK |
| Ga0105240_107876271 | 3300009093 | Corn Rhizosphere | HTIEDPKTFSKPWKFTTHPTLLRGELIEYICQENNKDVQHLVGK* |
| Ga0105243_116429061 | 3300009148 | Miscanthus Rhizosphere | KPWNFTIRPILLDGELMEYICQENNLDVKHLVGK* |
| Ga0105242_104773751 | 3300009176 | Miscanthus Rhizosphere | IIEDPKTFSRTWTFTTKPTLLKGELIEYICQENNKDVEHLVGK* |
| Ga0116219_106752631 | 3300009824 | Peatlands Soil | PKTFSKPWKFITHPSLLKGELIEYICQENNRDVQHLVGK* |
| Ga0126380_115718342 | 3300010043 | Tropical Forest Soil | FGHMEIVHIIDDPKTFSRQWTFTTHPTLLKGELIEYICQENNRDVEHLVGK* |
| Ga0127497_11447771 | 3300010109 | Grasslands Soil | HLEVVHIIDDPKTFSKLWTFTTHPSLLRGELIEYICQENNKDVEHLVGK* |
| Ga0126377_130706621 | 3300010362 | Tropical Forest Soil | DLGHMEIVHIIDDPKTFSRQWTFTTHPTLLKGELIEYICQENNKDVDHLVGK* |
| Ga0126381_1001597541 | 3300010376 | Tropical Forest Soil | IEHIIDDPKTFSKPWSFTTHPSLLKGELIEYICQENNRDVDHLVGK* |
| Ga0126381_1005279261 | 3300010376 | Tropical Forest Soil | IEHIIEDPKTFSKPWSFTTHPSLLKGELIEYICQENNKDVPHLVGK* |
| Ga0126381_1043243322 | 3300010376 | Tropical Forest Soil | GHLTIEHIINDPKTFSKPWSFTTHPSLLKGELIEYICQENNKDVQHLVGK* |
| Ga0136449_1013534642 | 3300010379 | Peatlands Soil | GAYTAPWNFTTHPRILRGEMIEYICQENNRDVEHLVGSGK* |
| Ga0126383_103750403 | 3300010398 | Tropical Forest Soil | FSRQWTFTTHPTLLKGELIEYICQENNRDVEHLVGK* |
| Ga0126383_104033651 | 3300010398 | Tropical Forest Soil | TKPWTFTTHPTLLKGELIEYICQENNRDVEHLFGK* |
| Ga0126383_110470132 | 3300010398 | Tropical Forest Soil | SRTWTFTTKPTLLKGELIEYICQENNKDVDHLVGK* |
| Ga0150983_143824562 | 3300011120 | Forest Soil | DDPKAFWKPWTFTPPPSFLKGELIEYICQEENKDVDHLVGK* |
| Ga0137364_104974711 | 3300012198 | Vadose Zone Soil | EDPKTFSRSWTFTTKPTLLKGELIEYICQENNKDVEHLVGK* |
| Ga0137363_113978892 | 3300012202 | Vadose Zone Soil | IFSKPWRFTTHPSLLKGELIEYICQENNKDVEHLIGK* |
| Ga0137377_100957861 | 3300012211 | Vadose Zone Soil | TFSKPWTFTTHPSLLRGELIEYICQENNKDVEHLVGK* |
| Ga0150985_1138393272 | 3300012212 | Avena Fatua Rhizosphere | SKTFSKPWSFTTHPSLLQGELIEYICQENNKDIEHLIGK* |
| Ga0134051_11196813 | 3300012398 | Grasslands Soil | SKLWTFTTHPSLLRGELIEYICQENNKDVEHLVGK* |
| Ga0150984_1032319891 | 3300012469 | Avena Fatua Rhizosphere | IVHIIEDPKTFSRPWTFTTKPTLLKGELIEYICQENNKDVEHLVGK* |
| Ga0150984_1082865312 | 3300012469 | Avena Fatua Rhizosphere | VHIIEDPKTFSRPWTFTTKPTLLKGELIEYICQENNKDVEHLVGK* |
| Ga0150984_1170087731 | 3300012469 | Avena Fatua Rhizosphere | PKTFSRPWTFTTKPTLLKGELIEYICQENNKDVEHLVGK* |
| Ga0137397_101937922 | 3300012685 | Vadose Zone Soil | IEDPKMFSRTWTFTTKPTLLKGELIEYICQENNKDVEHLVGK* |
| Ga0137407_121304301 | 3300012930 | Vadose Zone Soil | DPKTFSKPWKFTTHPTLLRGELIEYICQENNKDVQHLVGK* |
| Ga0137410_114771002 | 3300012944 | Vadose Zone Soil | EIEHTIDDPKTFSRTWSFTTKPSLLQGELIEYICQENNKDIEHLVGK* |
| Ga0157371_110100011 | 3300013102 | Corn Rhizosphere | EHTIDDPKMFSKPWKFTTHPTLLRGELIEYICQENNKDVQHLVGK* |
| Ga0157370_108419251 | 3300013104 | Corn Rhizosphere | IEHTIDDPKTFSRPWSFTTHPSLLKGELIEYICQENNKDVEHLVGK* |
| Ga0157375_124729401 | 3300013308 | Miscanthus Rhizosphere | TFSKPWKFTTHPVLLRGELIEYICQENNKDVQHLVGK* |
| Ga0134081_101532371 | 3300014150 | Grasslands Soil | SKPWTFTTRPSLLRGELIEYICQENNKDVEHLIGK* |
| Ga0181530_106090701 | 3300014159 | Bog | MGHLEIEHTIDDPGAYSKPWTFGELIEYICQENNRDIQ* |
| Ga0075301_11293831 | 3300014262 | Natural And Restored Wetlands | IEHIIDDPKTFSKSWSFTTRPVMLRGELIEYICQENNKDIPHIVGK* |
| Ga0163163_114530442 | 3300014325 | Switchgrass Rhizosphere | HMEIVHMIDDPKTFSRPWTFTTKPTLLKGELIEYICQENNKDVEHLVGK* |
| Ga0182018_104016132 | 3300014489 | Palsa | YTKPWSFTTHPVMLKGELMEYICQENNRDVEHLVGK* |
| Ga0181522_110304252 | 3300014657 | Bog | MEIEHIVEDPQTFSKPWKFTTHPTLLKGELIEYICQENNRDVEHLFGK* |
| Ga0182030_100829361 | 3300014838 | Bog | GAYTAPWKFTTHPIVLKGELMEYICQENNRDLEHLVGASK* |
| Ga0157376_109813981 | 3300014969 | Miscanthus Rhizosphere | LEIEHTIDDPKTFSKPWEFTTHPVLLRGELIEYICQENNKDVQHLVGK* |
| Ga0132256_1028028111 | 3300015372 | Arabidopsis Rhizosphere | IEHTIDDPKTFSRPWSFTTHPSLLQGALIEYICQENNKDVEHLVGK* |
| Ga0182039_107906351 | 3300016422 | Soil | TIDDPKTFSRPWSFTTHPSLLKGELIEYICQENNRDVQHLVGK |
| Ga0182038_114280522 | 3300016445 | Soil | EHIIDDPKTFSKPWTFTTHPSMLKGELIEYICQENNKDVQHLVGK |
| Ga0134083_100248581 | 3300017659 | Grasslands Soil | IIDDPKTFSKPWTFTTHPSLLRGELIEYICQENNKDVEHLVGK |
| Ga0134083_101371323 | 3300017659 | Grasslands Soil | HLEVVHIIDDPKTFSKPWTFTTHPSLLRGELIEYICQENNKDVEHLVGK |
| Ga0187876_12168221 | 3300018003 | Peatland | KAYTKPWSFTTHPIMLKGELMEYICQENNRDVEHLVGK |
| Ga0187864_100160611 | 3300018022 | Peatland | IEHTINDPGAYSKPWTFTTHPVLLKGELIEYICQENNRDVQHLVGK |
| Ga0210387_112703262 | 3300021405 | Soil | TFSKPWRFTTHPTLLKGELIEYICQENNRDVQHLVGQ |
| Ga0210394_115361011 | 3300021420 | Soil | EHTIDDPKTFSRPWSFTTRPSLLRGELIEYICQENNKDVEHLVGK |
| Ga0210398_114936311 | 3300021477 | Soil | PKTFSKPWKFTTHPTLLNGELIEYICQENNRDVDHLLGK |
| Ga0126371_128472281 | 3300021560 | Tropical Forest Soil | TIDDPKTFSKPWSFTTHPSLLKGELIEYICQENNRDVQHLVGK |
| Ga0242644_10332701 | 3300022498 | Soil | DPGAYTEQWKFTTHPTQLKGELMEYICQENNRDVDHLSGPAK |
| Ga0242657_11609732 | 3300022722 | Soil | EIEHIVEDPGTFTKPWKFTTHPTLLKGELIEYICQENNRDVEHLFGK |
| Ga0242665_103149401 | 3300022724 | Soil | PKTFSRPWTFTTKPTLLKGELIEYICQENNKDVEHLVGK |
| Ga0207642_107154481 | 3300025899 | Miscanthus Rhizosphere | KTFSKPWKFTTHPVLLRGELIEYICQENNKDVQHLVGK |
| Ga0207699_102805801 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | PKTFSKPWKFTTHPVLLRGELIEYICQENNKDVQHLVGK |
| Ga0207699_112463562 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | PKTFSKPWSFTTHPSLLRGELIEYICQENNKDVQHMVGK |
| Ga0207654_112573611 | 3300025911 | Corn Rhizosphere | HIIDDPKTFSRQWTFTTKPTLLRGELIEYICQENNKDVDHLVGK |
| Ga0207707_103933501 | 3300025912 | Corn Rhizosphere | EIEHTIDDPKVFSRPWTFTTKPTLLRGELIEYICQENNKDIDHLVGK |
| Ga0207695_106817292 | 3300025913 | Corn Rhizosphere | HTIEDPKTFSKPWKFTTHPTLLRGELIEYICQENNKDVQHLVGK |
| Ga0207657_103019012 | 3300025919 | Corn Rhizosphere | MFSKPWKFTTHPTLLRGELIEYICQENNKDVQHLVGK |
| Ga0207657_114263302 | 3300025919 | Corn Rhizosphere | QIEHTIDDPKTFSRPWSFTTHPSLLKGELIEYICQENNKDVEHLVGK |
| Ga0207694_114632241 | 3300025924 | Corn Rhizosphere | TIDDPKTFSRPWSFTTHPSLLQGELIEYICQENNKDVEHLVGK |
| Ga0207700_119469182 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | DPKAYTKPWTFTTHPRMLKGELIEYICQENNRDVEHLIGK |
| Ga0207711_106156563 | 3300025941 | Switchgrass Rhizosphere | PKTFSKLWSFTTHPSLLQGELIEYICQENNRDVEHLVGK |
| Ga0207689_117386621 | 3300025942 | Miscanthus Rhizosphere | TIDDPKTFSRPWSFTTHPSLLRGELIEYICQENNKDVEHLVGK |
| Ga0207677_116439312 | 3300026023 | Miscanthus Rhizosphere | DPKTFSKPWKFTTHPVLLRGELIEYICQENNKDVQHLVGK |
| Ga0207703_106796852 | 3300026035 | Switchgrass Rhizosphere | PKTFSKPWSFTTHPSLLQGELIEYICQENNKDVEHLVGK |
| Ga0207698_101885831 | 3300026142 | Corn Rhizosphere | IEHPIDDPKTFSKPWKFTTHPVLLRGELIEYICQENNKDVQHLVGK |
| Ga0209474_103753312 | 3300026550 | Soil | GHLEIVHIIDDPKTFSKPWTFTTRPSLLRGELIEYICQENNKDVEHLIGK |
| Ga0208827_11318441 | 3300027641 | Peatlands Soil | LDIEHTINDPGAYSKPWTFTTHPTLLKGELIEYICQENNRDVQHLIGK |
| Ga0209420_11671111 | 3300027648 | Forest Soil | PKAYTKPWSFTTHPVMLKGELMEYICQENNRDVEHLVGK |
| Ga0208981_11113851 | 3300027669 | Forest Soil | EIEHTIDDPKTFSKPWSFTTRPSLLRGELIEYICQENNKDVEHLVGK |
| Ga0209274_107557191 | 3300027853 | Soil | SKPWGFTTHPTLLKGELIEYICQENNRDVQHLVGK |
| Ga0209167_108290121 | 3300027867 | Surface Soil | EHTIDDPKTFSKPWKFTTHPSMLKGELIEYICQENNRDVQHLVGK |
| Ga0209169_100055347 | 3300027879 | Soil | KAYTKPWTFTTHPVMLKGELMEYICQENNRDVEHLVGK |
| Ga0209624_102231042 | 3300027895 | Forest Soil | TKPWSFTTHPVMLKGELMEYICQENNRDVEHLVGK |
| Ga0268264_103085211 | 3300028381 | Switchgrass Rhizosphere | DDPKTFSKPWKFTTHPVLLRGELIEYICQENNKDVQHLVGK |
| Ga0311371_106451643 | 3300029951 | Palsa | KAYTKPWSFTTHPVMLKGELMEYICQENNRDVQHLVGK |
| Ga0265756_1128921 | 3300030805 | Soil | AYSKPWTFTTHPRMLTGELIEYICQENNRDVQHLVGK |
| Ga0307497_101034081 | 3300031226 | Soil | PKTFSKAWTFTTKPTLLKGELIEYICQVNNKDVEHLVGK |
| Ga0310686_1011781582 | 3300031708 | Soil | VIDDPGAYSTPWTFTTHPVLLKGGLIEYICQENNRDLQHLTGE |
| Ga0265342_101866611 | 3300031712 | Rhizosphere | DDPKTFSRPWTFTTHPSLLQGELIEYICQENNKDIEHLVGK |
| Ga0307473_102447451 | 3300031820 | Hardwood Forest Soil | EIVHIIYDPKTFSKPWTFTTRPSLLRGELIEYICQENNKDVEHLIGK |
| Ga0307473_105851781 | 3300031820 | Hardwood Forest Soil | VHIIDDPKTFSKPWTFTTKPSLLRGELIEYICQENNKDVEHLVGK |
| Ga0307478_113191522 | 3300031823 | Hardwood Forest Soil | PKTYTKPWSFTTHPVMLKGELMEYICQENNRDVEHLVGK |
| Ga0306921_118377871 | 3300031912 | Soil | FTKPWTFTTHPTLLKGELIEYICQENNRDVEHLFGK |
| Ga0306921_124704811 | 3300031912 | Soil | EDPKTFSRTWTFTTKPTLLRGELIEYICQENNKDVEHLVGK |
| Ga0308175_1020254612 | 3300031938 | Soil | TFSKPWSFTTHPSLLRGELIEYICQENNKDVQHMVGK |
| Ga0308174_112064021 | 3300031939 | Soil | VVEPWSFTTHPTLLKGELIEYICQENNRDVEHLIGK |
| Ga0310913_111509562 | 3300031945 | Soil | AYTRPWKFTTHPLMLRGELIEYICQENNRDVEHLVGK |
| Ga0310909_103500083 | 3300031947 | Soil | YTKPWTVTTHPVLLKGELMEYICQENNKDVPHLVGK |
| Ga0306926_129103972 | 3300031954 | Soil | TDFGHLEIVHIIDDPKTFSKSWSFTTHPSLLRGELIEYICQENNKDVEHLVGK |
| Ga0318559_103539702 | 3300032039 | Soil | HMEIVHIIEDPKTFSRTWTFTTKPTLLRGELIEYICQENNKDVEHLVGK |
| Ga0318514_107910242 | 3300032066 | Soil | DPKMFSRPWTFTTKPSMLKGELIEYICQENNKDVEHLIGK |
| Ga0311301_109901842 | 3300032160 | Peatlands Soil | DDPGAYTAPWKFTTHPRILRGEMIEYICQENNRDVEHLVGSGK |
| Ga0335070_102416701 | 3300032829 | Soil | YSKPWSFTTHPYMLKGELMEYICQENNKDVEHLVGSGK |
| Ga0335076_112172831 | 3300032955 | Soil | EIENIIDDPKAYAHTWSFTTHPYMLKGDLMEYICQENNKDVQHLVGNEHRDGK |
| ⦗Top⦘ |