


| Basic Information | |
|---|---|
| Family ID | F077589 |
| Family Type | Metagenome |
| Number of Sequences | 117 |
| Average Sequence Length | 41 residues |
| Representative Sequence | FGTFFDPQSTVAVAIPNVLFDHRTVTPAQPLSVYVGMRAKL |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.15 % |
| % of genes from short scaffolds (< 2000 bps) | 92.31 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.581 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.949 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.624 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.410 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF13442 | Cytochrome_CBB3 | 29.06 |
| PF13570 | PQQ_3 | 5.13 |
| PF13505 | OMP_b-brl | 5.13 |
| PF00756 | Esterase | 2.56 |
| PF13557 | Phenol_MetA_deg | 2.56 |
| PF08238 | Sel1 | 0.85 |
| PF01011 | PQQ | 0.85 |
| PF13531 | SBP_bac_11 | 0.85 |
| PF04392 | ABC_sub_bind | 0.85 |
| PF12951 | PATR | 0.85 |
| PF13594 | Obsolete Pfam Family | 0.85 |
| PF00034 | Cytochrom_C | 0.85 |
| PF07687 | M20_dimer | 0.85 |
| PF03992 | ABM | 0.85 |
| PF00005 | ABC_tran | 0.85 |
| PF07110 | EthD | 0.85 |
| PF00528 | BPD_transp_1 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.58 % |
| Unclassified | root | N/A | 3.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352025|deepsgr__Contig_52477 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3134 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1027914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1049 | Open in IMG/M |
| 3300000787|JGI11643J11755_11643829 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 602 | Open in IMG/M |
| 3300000955|JGI1027J12803_103689582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris | 513 | Open in IMG/M |
| 3300000956|JGI10216J12902_116356527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300001867|JGI12627J18819_10138832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 993 | Open in IMG/M |
| 3300002911|JGI25390J43892_10071981 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 795 | Open in IMG/M |
| 3300005332|Ga0066388_102263597 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 982 | Open in IMG/M |
| 3300005332|Ga0066388_102796575 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 891 | Open in IMG/M |
| 3300005332|Ga0066388_105341111 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 651 | Open in IMG/M |
| 3300005436|Ga0070713_101120719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 761 | Open in IMG/M |
| 3300005437|Ga0070710_10011445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4382 | Open in IMG/M |
| 3300005468|Ga0070707_100224425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1829 | Open in IMG/M |
| 3300005468|Ga0070707_101643553 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 609 | Open in IMG/M |
| 3300005553|Ga0066695_10686498 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 602 | Open in IMG/M |
| 3300005555|Ga0066692_10633100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 668 | Open in IMG/M |
| 3300005764|Ga0066903_100485367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2085 | Open in IMG/M |
| 3300005764|Ga0066903_100823887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1664 | Open in IMG/M |
| 3300005764|Ga0066903_101539999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1257 | Open in IMG/M |
| 3300005764|Ga0066903_101703305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1200 | Open in IMG/M |
| 3300005764|Ga0066903_101997718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Azohydromonas → Azohydromonas australica | 1114 | Open in IMG/M |
| 3300005764|Ga0066903_102793003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 947 | Open in IMG/M |
| 3300005764|Ga0066903_103373429 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 862 | Open in IMG/M |
| 3300005764|Ga0066903_103828499 | Not Available | 808 | Open in IMG/M |
| 3300005764|Ga0066903_106378195 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300005764|Ga0066903_108890238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
| 3300006046|Ga0066652_100976499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 805 | Open in IMG/M |
| 3300006175|Ga0070712_100798924 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 809 | Open in IMG/M |
| 3300006177|Ga0075362_10688837 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300006845|Ga0075421_101203711 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 845 | Open in IMG/M |
| 3300006903|Ga0075426_11539956 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300006904|Ga0075424_100556080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1225 | Open in IMG/M |
| 3300006904|Ga0075424_102446160 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 547 | Open in IMG/M |
| 3300009081|Ga0105098_10614708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 568 | Open in IMG/M |
| 3300009143|Ga0099792_10070335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1763 | Open in IMG/M |
| 3300009147|Ga0114129_12762061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 584 | Open in IMG/M |
| 3300009162|Ga0075423_12725575 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300009162|Ga0075423_13048624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300009792|Ga0126374_10576993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 826 | Open in IMG/M |
| 3300009792|Ga0126374_11392702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. OHSU_II-uncloned | 571 | Open in IMG/M |
| 3300010360|Ga0126372_11600548 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300010375|Ga0105239_13551257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300010376|Ga0126381_101939226 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300010398|Ga0126383_10285999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1639 | Open in IMG/M |
| 3300010398|Ga0126383_11093062 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300010398|Ga0126383_11435867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 780 | Open in IMG/M |
| 3300012096|Ga0137389_10118897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2126 | Open in IMG/M |
| 3300012200|Ga0137382_10135332 | Not Available | 1659 | Open in IMG/M |
| 3300012202|Ga0137363_11629815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 537 | Open in IMG/M |
| 3300012357|Ga0137384_11456922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 533 | Open in IMG/M |
| 3300012469|Ga0150984_106849517 | Not Available | 554 | Open in IMG/M |
| 3300012929|Ga0137404_10424051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1177 | Open in IMG/M |
| 3300012951|Ga0164300_10479161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 706 | Open in IMG/M |
| 3300012960|Ga0164301_10618438 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300012971|Ga0126369_11446981 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300012985|Ga0164308_11253875 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300014745|Ga0157377_10059416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 2179 | Open in IMG/M |
| 3300015200|Ga0173480_11019242 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300016270|Ga0182036_10407367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1061 | Open in IMG/M |
| 3300016270|Ga0182036_11073460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 666 | Open in IMG/M |
| 3300016319|Ga0182033_10714265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 878 | Open in IMG/M |
| 3300016319|Ga0182033_11226295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 672 | Open in IMG/M |
| 3300016319|Ga0182033_11769823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 560 | Open in IMG/M |
| 3300016341|Ga0182035_10501703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1036 | Open in IMG/M |
| 3300016357|Ga0182032_10241545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris | 1399 | Open in IMG/M |
| 3300016371|Ga0182034_10469149 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1045 | Open in IMG/M |
| 3300016371|Ga0182034_10921960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 752 | Open in IMG/M |
| 3300016371|Ga0182034_11384952 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300016404|Ga0182037_10909111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 764 | Open in IMG/M |
| 3300016422|Ga0182039_10305286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1320 | Open in IMG/M |
| 3300016445|Ga0182038_12069563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300018482|Ga0066669_10065879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2369 | Open in IMG/M |
| 3300021168|Ga0210406_11286723 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300021178|Ga0210408_10769874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 755 | Open in IMG/M |
| 3300021560|Ga0126371_10625720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1225 | Open in IMG/M |
| 3300021560|Ga0126371_11892911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 716 | Open in IMG/M |
| 3300021560|Ga0126371_11908293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 713 | Open in IMG/M |
| 3300025906|Ga0207699_10517445 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300025922|Ga0207646_10350985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1333 | Open in IMG/M |
| 3300025922|Ga0207646_11689141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300025922|Ga0207646_11750040 | Not Available | 533 | Open in IMG/M |
| 3300025928|Ga0207700_10512479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1062 | Open in IMG/M |
| 3300025928|Ga0207700_11859849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300026309|Ga0209055_1187523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 636 | Open in IMG/M |
| 3300026550|Ga0209474_10277060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1011 | Open in IMG/M |
| 3300027875|Ga0209283_10810724 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300028047|Ga0209526_10414450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 892 | Open in IMG/M |
| 3300028715|Ga0307313_10297558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300028722|Ga0307319_10047850 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1340 | Open in IMG/M |
| 3300028784|Ga0307282_10377111 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300028787|Ga0307323_10313300 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300031544|Ga0318534_10006173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 5714 | Open in IMG/M |
| 3300031546|Ga0318538_10303419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 860 | Open in IMG/M |
| 3300031572|Ga0318515_10750487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300031668|Ga0318542_10139054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1199 | Open in IMG/M |
| 3300031682|Ga0318560_10503444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 656 | Open in IMG/M |
| 3300031736|Ga0318501_10159609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1164 | Open in IMG/M |
| 3300031744|Ga0306918_10113945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1947 | Open in IMG/M |
| 3300031770|Ga0318521_10891759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 543 | Open in IMG/M |
| 3300031771|Ga0318546_10330653 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1058 | Open in IMG/M |
| 3300031782|Ga0318552_10103456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris | 1406 | Open in IMG/M |
| 3300031782|Ga0318552_10646752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 539 | Open in IMG/M |
| 3300031831|Ga0318564_10021361 | All Organisms → cellular organisms → Bacteria | 2688 | Open in IMG/M |
| 3300031879|Ga0306919_10699994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 780 | Open in IMG/M |
| 3300031941|Ga0310912_11015098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300031954|Ga0306926_11133050 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 923 | Open in IMG/M |
| 3300032025|Ga0318507_10028417 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2062 | Open in IMG/M |
| 3300032041|Ga0318549_10243132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 809 | Open in IMG/M |
| 3300032044|Ga0318558_10122373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1234 | Open in IMG/M |
| 3300032076|Ga0306924_11818120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 634 | Open in IMG/M |
| 3300032090|Ga0318518_10725011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 505 | Open in IMG/M |
| 3300032091|Ga0318577_10139590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1150 | Open in IMG/M |
| 3300032094|Ga0318540_10339886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 725 | Open in IMG/M |
| 3300032174|Ga0307470_10127915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1513 | Open in IMG/M |
| 3300032180|Ga0307471_103489954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300032261|Ga0306920_104045183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 531 | Open in IMG/M |
| 3300033289|Ga0310914_10787229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 849 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.38% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 11.11% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.40% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.84% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.98% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.71% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.71% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.71% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.85% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006177 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deepsgr_00589030 | 2199352025 | Soil | TYFDPQSVINAVANPPTDHRTVTPAQPLSVYVGLRAKL |
| AF_2010_repII_A100DRAFT_10279142 | 3300000655 | Forest Soil | TFFDPQSTVALAIPNVLFDHRMVTPAQPXSVYVGMRAKL* |
| JGI11643J11755_116438292 | 3300000787 | Soil | YFDPQSVINAVSNPPTDHRTVTPAQPLSVYVGLRAKL* |
| JGI1027J12803_1036895821 | 3300000955 | Soil | FGTFFDTQSTVAVAIPNVLTDPRMVTPAQPLSVYVGMRAKL* |
| JGI10216J12902_1163565272 | 3300000956 | Soil | FFDTQSTVAIAIPNVLTDPRMVTPAQPLSVYVGMRAKL* |
| JGI12627J18819_101388321 | 3300001867 | Forest Soil | DTQSTVAVAIPNVLNDPRTVTPAQPLSVYVGMRAKL* |
| JGI25390J43892_100719811 | 3300002911 | Grasslands Soil | ATFGTFFDPQSTVAVAIPNVLFDHRTVTPAQPLSVYVGMRAKL* |
| Ga0066388_1022635973 | 3300005332 | Tropical Forest Soil | NRKFATFGTFFDPQSTVAIAIPNVLFDHRTVTPAQPLSVYVGMRAKL* |
| Ga0066388_1027965752 | 3300005332 | Tropical Forest Soil | MFNRKFATFGTFFNTQSTVAIAIPNVLTDPRMVTPAQPLSVYVGMRAN* |
| Ga0066388_1053411111 | 3300005332 | Tropical Forest Soil | FNRKFATFGTFFDPQSTVALAIPNVLFDHRMVTPAQPLSVYVGVRAKL* |
| Ga0070713_1011207193 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | RKFATFGTFFDPQSTVANALPGILNDHRTVTPAQPLSVYVGMRAKL* |
| Ga0070710_100114456 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | GTFFDTQSTVAVAIPNVLNDPRTVTPAQPLSVYVGMRAKL* |
| Ga0070707_1002244251 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | FGTFFDPQSTVAVAIPNVLFDHRTVTPAQPLSVYVGMRAKL* |
| Ga0070707_1016435532 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LFNRKFATFGTFFDPQSTVAVAIPNVLFDHRTVTPAQPLSVYVGMRAKL* |
| Ga0066695_106864982 | 3300005553 | Soil | TFGTFFDPQSTVANAIPNVLFDHRTVTPAQPLSVYVGMRAKL* |
| Ga0066692_106331002 | 3300005555 | Soil | FDPQSTVAIAIPNVLFDHRTVTPAQPLSVYVGLRAKL* |
| Ga0066903_1004853676 | 3300005764 | Tropical Forest Soil | TFFDTHSTVAIAIPNVLNDPRMVTPAQPLSVYVGMRAKL* |
| Ga0066903_1008238873 | 3300005764 | Tropical Forest Soil | TFFDTQSTVANAIPNALSDPRMVTPVQPLSVYVGLRVKL* |
| Ga0066903_1015399992 | 3300005764 | Tropical Forest Soil | ATFGTFFDTHSTVAIAIPNVLTDPRTVTPAQPLSVYVGMHARL* |
| Ga0066903_1017033053 | 3300005764 | Tropical Forest Soil | HSTVAIAIPNVLNDPRMVTPAQPLSVYVGMRAKL* |
| Ga0066903_1019977181 | 3300005764 | Tropical Forest Soil | GTFFDTQSTVAIAIPNVLTDPRMVTPAQPLSVYVGMRAKL* |
| Ga0066903_1027930032 | 3300005764 | Tropical Forest Soil | FATFGTFFDPQSTVALAIPNVLFDHRTITPAQPLSVYVGIHAKL* |
| Ga0066903_1033734293 | 3300005764 | Tropical Forest Soil | NNLFNRKFATFGTFFDPQSTVAIAIPNVLFDHRTVTPAQPFSVYVGMRAKL* |
| Ga0066903_1038284991 | 3300005764 | Tropical Forest Soil | TQSTVAVAIPNVLNDPRMVTPAQPLSVYLGMRAKL* |
| Ga0066903_1063781951 | 3300005764 | Tropical Forest Soil | FFDPQSTVALAIPNVLFDHRMVTPAQPLSVYVGVRAKL* |
| Ga0066903_1088902382 | 3300005764 | Tropical Forest Soil | FATFGTFFDPQSTVALAIPNVLFDHRTITPAQPLSVYVGMHAKL* |
| Ga0066652_1009764991 | 3300006046 | Soil | VYGTYFEPQSIVNAIANPPTDQRTQTPAQPLSVYAGLRYKLP* |
| Ga0070712_1007989244 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | TFFDTQSTVAVAIPNVLNDPRTVTPAQPLSVYVGMRAKL* |
| Ga0075362_106888372 | 3300006177 | Populus Endosphere | YFDAGSIANVLPNPPTDHRTITPAQPLSIYVGMRAKL* |
| Ga0075421_1012037111 | 3300006845 | Populus Rhizosphere | ATFGTYFDAGSIANVLPNPPTDPRTITPAQPLSVYVGMRAKL* |
| Ga0075426_115399562 | 3300006903 | Populus Rhizosphere | FFDTQSTVAVAIPNVLNDPRMVTPAQPLSVYVGMRAKL* |
| Ga0075424_1005560803 | 3300006904 | Populus Rhizosphere | TFGTFFDTQSTVAVAIPNVLNDPRTVTPAQPLSVYVGMRAKL* |
| Ga0075424_1024461601 | 3300006904 | Populus Rhizosphere | ATFGTFFDTQSTVAVAIPNVLNDPRTVTPAQPLSVYVGMRAKL* |
| Ga0105098_106147082 | 3300009081 | Freshwater Sediment | YFDPQSIVNAIPNPPTDHRTITPAQPLSVYVGMRAKL* |
| Ga0099792_100703354 | 3300009143 | Vadose Zone Soil | TFGTFFDPQSTVAVAIPNVLFDHRMVTPAQPLSVYLGLRAKL* |
| Ga0114129_127620612 | 3300009147 | Populus Rhizosphere | FFDPQSTVANALPGVLNDPRTVTPAQPLSVYVGMRAKL* |
| Ga0075423_127255752 | 3300009162 | Populus Rhizosphere | QSTVAVAIPNVLFDHRTVTPAQPLSVYVGMRAKL* |
| Ga0075423_130486241 | 3300009162 | Populus Rhizosphere | TFGTFFDTQSTVAIAIPNVLTDPRMVTPAQPLSVYVGMRAKL* |
| Ga0126374_105769931 | 3300009792 | Tropical Forest Soil | PQSTVALAIPNVLFDHRTVTPAQPLSIYVGLRAKL* |
| Ga0126374_113927021 | 3300009792 | Tropical Forest Soil | NNLFNRKFATFGTFFNPQSTVAIAIPNVLEDHRTVTPAQPLSVYVGMRAKF* |
| Ga0126372_116005481 | 3300010360 | Tropical Forest Soil | PQSTVAIAIPNVLFDHRTVTPAQPLSVYVGMRAKL* |
| Ga0105239_135512571 | 3300010375 | Corn Rhizosphere | GTFFDPQSTVALAVPNVLFDHRMVTPAQPLSVYVGMRAKL* |
| Ga0126381_1019392261 | 3300010376 | Tropical Forest Soil | NNLFNRKFATFGTFFDPQSTVANAIPNVLFDHRMVTPAQPLSVYVGMRAKL* |
| Ga0126383_102859992 | 3300010398 | Tropical Forest Soil | ATIGTFFDTQSTVAIAIPNVLNDPRMVTPAQPLSVYVGMRAKL* |
| Ga0126383_110930623 | 3300010398 | Tropical Forest Soil | TFFDPQSTVALAIPNVLFDHRTITPAQPLSVYVGMRAKL* |
| Ga0126383_114358672 | 3300010398 | Tropical Forest Soil | KFATIGTFFDTQSTVAIAIPNVLNDPRMVTPAQPLSVYVGMRAKL* |
| Ga0137389_101188973 | 3300012096 | Vadose Zone Soil | FFDPQSTVAVAIPNVLFDHRTVTPAQPLSIYVGMRAKL* |
| Ga0137382_101353323 | 3300012200 | Vadose Zone Soil | TFFDTQSTVAVAIPNVLFDHRTVTPAQPLSIYVSLRAKL* |
| Ga0137363_116298152 | 3300012202 | Vadose Zone Soil | PQVIANAIPDPPSDHRMVTPAQPLSIYVGLRAKL* |
| Ga0137384_114569222 | 3300012357 | Vadose Zone Soil | DPRVIANAIPDPPTDHRMVTPAQPLSIYVGLRAKL* |
| Ga0150984_1068495171 | 3300012469 | Avena Fatua Rhizosphere | ESIVNAIASPPTDHRTQTPAQPLAVYAGLRYRLP* |
| Ga0137404_104240511 | 3300012929 | Vadose Zone Soil | YFDPQVIANAISNPPTDHRMVTPAQPLAVYVGLRAKL* |
| Ga0164300_104791612 | 3300012951 | Soil | FGKFSYSQSLCAVAIGNVLCVQRTITPAQPLSNYVGMHAKL* |
| Ga0164301_106184381 | 3300012960 | Soil | PQSVINAVSNPPTDHRTITPAQPLAVYVGLRAKL* |
| Ga0126369_114469813 | 3300012971 | Tropical Forest Soil | TSGTFFDPQSTVALAIPNVLNDHRMITPAQPLAIYVGLRAKL* |
| Ga0164308_112538751 | 3300012985 | Soil | PQSVINAVSNPPTDHRTITPAQPLAVYMGLRVKL* |
| Ga0157377_100594163 | 3300014745 | Miscanthus Rhizosphere | FDPQSVINAVSNPPTDHRTITPAQPLSVYMGLRVKL* |
| Ga0173480_110192421 | 3300015200 | Soil | TYFDPQSVINAVSNPPTDHRTITPAQPLAVYVCLRAKL* |
| Ga0182036_104073671 | 3300016270 | Soil | NNLFNRKFATFGTFFDPQSTVAIAIPNVLFDHRTVTPAQPLSVYVGMRAKL |
| Ga0182036_110734601 | 3300016270 | Soil | TFFNPQSTVAIAIPNVLEDHRTVTPAQPLSVYVGMRAKL |
| Ga0182033_107142651 | 3300016319 | Soil | KFATFGTFFDSQSTGALAIPNVVFDHRTVTPAQPLSVYVGMHAKL |
| Ga0182033_112262952 | 3300016319 | Soil | FATFGTFFDPQSTVALAIPNVLSDHRTITPAQPLSVYVGIHAKL |
| Ga0182033_117698231 | 3300016319 | Soil | TFGTFFDPQSTVALAIPNVLSDHRTITPAQPLSVYVGMHAKL |
| Ga0182035_105017031 | 3300016341 | Soil | FATFGTFFNPQSTVAIAIPNVLEDHRTVTPAQPLSVYVGMRAKF |
| Ga0182032_102415452 | 3300016357 | Soil | FNPQSTVAIAIPNVLEDHRTVTPAQPLSVYVGMRAKF |
| Ga0182034_104691491 | 3300016371 | Soil | TFFDPQSTVAIAIPNVLFDHRTVTPAQPLSVYVGMRAKL |
| Ga0182034_109219602 | 3300016371 | Soil | PQSTVAIAIPNTLFDHRTITPAQPLSVYVGMHAKL |
| Ga0182034_113849522 | 3300016371 | Soil | FDPQSTVAVAIPNVLFDHRTVTPAQPLSVYVGMRAKL |
| Ga0182037_109091112 | 3300016404 | Soil | FNRKFATFGTFFDPQSTVANAIPNVLFDHRTVTPAQPLSVYVGMRAKL |
| Ga0182039_103052861 | 3300016422 | Soil | RKFATFGTFFNPQSTVAIAIPNVLEDHRTVTPAQPLSVYVGMRAKL |
| Ga0182038_120695632 | 3300016445 | Soil | FDPQSTVALAIPNVLFDHRTVTPAQPLSVYVGMRAKL |
| Ga0066669_100658793 | 3300018482 | Grasslands Soil | NRKFASVGTFFDTQSTVAVAIPNVLTDPRMVTPAQPLSVYVGMRAKL |
| Ga0210406_112867232 | 3300021168 | Soil | FDPQSTVAVAIPNTLFDHRTVTPAQPLSVYVGMRAKL |
| Ga0210408_107698741 | 3300021178 | Soil | KFATFGTFFDPQSTVAIAIPNVLFDHRTVTPAQPLSVYVGMRAKL |
| Ga0126371_106257201 | 3300021560 | Tropical Forest Soil | NRKFATFGTFFNPQSTVAIAIPNVLEDHRMVTPAQPLSVYVGMRAKL |
| Ga0126371_118929111 | 3300021560 | Tropical Forest Soil | FGTFFDPQSTVAIAIPNVLFDHRTVTPAQPLSVYLGMRAKL |
| Ga0126371_119082933 | 3300021560 | Tropical Forest Soil | RKFATFGTFFNPQSTVALAIPNVLFDHRMVTPAQPLSVYVGMRAKL |
| Ga0207699_105174451 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | NRKFATVGTFFDTQSTVAVAIPNVLNDPRMVTPAQPLSVYLGMRAKL |
| Ga0207646_103509851 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | NRKFATFGTFFDPQSTVAVAIPNVLFDHRTVTPAQPLSVYVGMRAKL |
| Ga0207646_116891411 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | TFFDPQSTVAVAIPNVLFDHRTVTPAQPLSVYVGMRAKL |
| Ga0207646_117500402 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | TYFDPQSVINAVSNPPTDHRTITPAQPLSVYMGLRVKL |
| Ga0207700_105124793 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | KFATFGTFFDTQSTVAVAIPNVLNDPRTVTPAQPLSVYVGMRAKL |
| Ga0207700_118598491 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | NRKFATFGTFFDPQSTVANALPNVLFDHRTVTPAQPLSVYVGMRAKL |
| Ga0209055_11875231 | 3300026309 | Soil | FNRKFATFGTFFDPQSTVAVAIPNVLFDHRTVTPAQPLSVYVGMRAKL |
| Ga0209474_102770601 | 3300026550 | Soil | TQSTVAIAIPNVLTDPRMVTPAQPLSVYVGMRAKL |
| Ga0209283_108107241 | 3300027875 | Vadose Zone Soil | DPQSTVAVAIPNVLFDHRTVTPAQPLSIYVGMRAKL |
| Ga0209526_104144501 | 3300028047 | Forest Soil | LFNRKFATFGTFFDPQSTVAVAIPNTLFDHRTVTPAQPLSVYVGMRAKL |
| Ga0307313_102975581 | 3300028715 | Soil | VGTFFDTQSTVAVAIPNVLNDPRMVTPAQPLSVYVGMRAKL |
| Ga0307319_100478501 | 3300028722 | Soil | FDPQSVINAVSNPPTDHRTVTPAQPLSVYVGLRAKL |
| Ga0307282_103771113 | 3300028784 | Soil | KFATFGTFFDTQSTVAVAIPNVLTDPRMVTPAQPLSVYVGMRAKL |
| Ga0307323_103133002 | 3300028787 | Soil | TFGTFFDTQSTVAVAIPNVLTDPRMVTPAQPLSVYVGMRAKL |
| Ga0318534_100061737 | 3300031544 | Soil | DPQSTVANAIPNVLFDHRTVTPAQPLSVYVGMRAKL |
| Ga0318538_103034191 | 3300031546 | Soil | NPQSTVAIAIPNVLEDHRTVTPAQPLSVYVGMRAKF |
| Ga0318515_107504871 | 3300031572 | Soil | FGTFFNPQSTVAIAIPNVLEDHRTVTPAQPLSVYVGMRAKF |
| Ga0318542_101390541 | 3300031668 | Soil | TFGTFFDPQSTVALAIPNVLSDHRTITPAQPLSVYVGIHAKL |
| Ga0318560_105034441 | 3300031682 | Soil | FNPQVIANAIPDPPTDHRMVTPTQPLSIYVGLRAKL |
| Ga0318501_101596091 | 3300031736 | Soil | RKFATFGTFFDPQSTVAIAIPNVLFDHRMVTPAQPLSVYVGMRAKL |
| Ga0306918_101139453 | 3300031744 | Soil | KFATFGTFFNPQSTVAIAIPNVLEDHRTVTPAQPLSVYVGMRAKF |
| Ga0318521_108917592 | 3300031770 | Soil | ATFGTFFNPQSTVAIAIPNVLEDHRTVTPAQPLSVYVGMRAKL |
| Ga0318546_103306531 | 3300031771 | Soil | FDTQSTVAIAIPNVLTNPRMVTPAQPLSVYVGMRAKL |
| Ga0318552_101034562 | 3300031782 | Soil | TFFNPQSTVAIAIPNVLEDHRTVTPAQPLSVYVGMRAKF |
| Ga0318552_106467522 | 3300031782 | Soil | FGTFFNPQSTVAIAIPNVLEDHRTVTPAQPLSVYVGMRAKL |
| Ga0318564_100213614 | 3300031831 | Soil | FDPQSTVANAIPNVLFDHRTVTPAQPLSVYVGMRAKL |
| Ga0306919_106999941 | 3300031879 | Soil | NNLFNRKFATFGTFFNPQSTVAIAIPNVLEDHRMVTPAQPLSVYVGIHAKL |
| Ga0310912_110150982 | 3300031941 | Soil | FFDTHSTVAIAIPNVLTDPRMVTPAQPLSVYVGMRAKL |
| Ga0306926_111330503 | 3300031954 | Soil | TFFDPQSTVAVAIPNTLFDHRTVTPAQPLSIYIGMRAKL |
| Ga0318507_100284173 | 3300032025 | Soil | FFDPQSTVANAIPNVLFDHRTVTPAQPLSVYVGMRAKL |
| Ga0318549_102431321 | 3300032041 | Soil | KFATFGTFFDPQSTVAVAIPNVLFDHRTVTPAQPLSVYVGMRAKL |
| Ga0318558_101223731 | 3300032044 | Soil | NLFNRKFATFGTFFDPQSTVAIAIPNVLFDHRMVTPAQPLSVYVGMRAKL |
| Ga0306924_118181201 | 3300032076 | Soil | TFGTFFNPQSTVAIAIPNVLEDHRMVTPAQPLSVYVGIHAKL |
| Ga0318518_107250112 | 3300032090 | Soil | FATFGTFFNPQSTVAIAIPNVLEDHRTVTPAQPLSVYVGMRAKL |
| Ga0318577_101395902 | 3300032091 | Soil | FDPQSTVAVAIPNVLFDHRTITPAQPLSVYVGMHAKL |
| Ga0318540_103398861 | 3300032094 | Soil | FNRKFATFGTFFDPQSTVALAIPNVLFDHRTITPAQPLSVYVGMHAKL |
| Ga0307470_101279151 | 3300032174 | Hardwood Forest Soil | TFGTFFDTQSTVAVAIPNVLNDPRTVTPAQPLSVYVGMRAKL |
| Ga0307471_1034899541 | 3300032180 | Hardwood Forest Soil | KFATFGTFYDTQSTIAVAIPNVLNDPRTVTPAQPLSVYVGMRAKL |
| Ga0306920_1040451831 | 3300032261 | Soil | KFATFGTFFNPQSTVAIAIPNVLEDHRTVTPAQPLSVYVGMRAKL |
| Ga0310914_107872291 | 3300033289 | Soil | KFATFGTFFDTHSTVAIAIPNVLTDPRMVTPAQPLSVYVGMRAKL |
| ⦗Top⦘ |