


| Basic Information | |
|---|---|
| Family ID | F077559 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 44 residues |
| Representative Sequence | LKTLDQPVRELHKRQFRHMSAARLKILSDLLEEVRVRKPA |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.29 % |
| % of genes from short scaffolds (< 2000 bps) | 88.03 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.145 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.205 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (64.957 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.71% β-sheet: 0.00% Coil/Unstructured: 60.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF04264 | YceI | 76.07 |
| PF00881 | Nitroreductase | 11.11 |
| PF09335 | SNARE_assoc | 6.84 |
| PF00106 | adh_short | 0.85 |
| PF13620 | CarboxypepD_reg | 0.85 |
| PF01047 | MarR | 0.85 |
| PF00692 | dUTPase | 0.85 |
| PF00216 | Bac_DNA_binding | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 76.07 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 6.84 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 6.84 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 6.84 |
| COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 0.85 |
| COG0756 | dUTP pyrophosphatase (dUTPase) | Defense mechanisms [V] | 0.85 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.15 % |
| Unclassified | root | N/A | 0.85 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000655|AF_2010_repII_A100DRAFT_1027691 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300001661|JGI12053J15887_10114555 | All Organisms → cellular organisms → Bacteria | 1447 | Open in IMG/M |
| 3300001661|JGI12053J15887_10312879 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300002914|JGI25617J43924_10130530 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300003220|JGI26342J46808_1002517 | All Organisms → cellular organisms → Bacteria | 1584 | Open in IMG/M |
| 3300004080|Ga0062385_10532269 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300004100|Ga0058904_1202706 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300004100|Ga0058904_1348110 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300005167|Ga0066672_10134936 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1537 | Open in IMG/M |
| 3300005454|Ga0066687_10017707 | All Organisms → cellular organisms → Bacteria | 2928 | Open in IMG/M |
| 3300005533|Ga0070734_10116415 | All Organisms → cellular organisms → Bacteria | 1562 | Open in IMG/M |
| 3300005555|Ga0066692_10006904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 5139 | Open in IMG/M |
| 3300005556|Ga0066707_10083036 | All Organisms → cellular organisms → Bacteria | 1937 | Open in IMG/M |
| 3300005557|Ga0066704_10789884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300005576|Ga0066708_10654124 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300005610|Ga0070763_10491882 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300005640|Ga0075035_1414727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 930 | Open in IMG/M |
| 3300006050|Ga0075028_100297433 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300006052|Ga0075029_100081453 | All Organisms → cellular organisms → Bacteria | 1918 | Open in IMG/M |
| 3300006059|Ga0075017_100253090 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300006176|Ga0070765_100008390 | All Organisms → cellular organisms → Bacteria | 7060 | Open in IMG/M |
| 3300006797|Ga0066659_10070868 | All Organisms → cellular organisms → Bacteria | 2279 | Open in IMG/M |
| 3300006797|Ga0066659_10778711 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300006954|Ga0079219_10423395 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300007255|Ga0099791_10276027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 799 | Open in IMG/M |
| 3300007258|Ga0099793_10460808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300009088|Ga0099830_10802136 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
| 3300009089|Ga0099828_10222572 | All Organisms → cellular organisms → Bacteria | 1687 | Open in IMG/M |
| 3300010335|Ga0134063_10459973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300010358|Ga0126370_10908061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
| 3300010362|Ga0126377_13408795 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300010366|Ga0126379_12828655 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300010398|Ga0126383_11270764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 826 | Open in IMG/M |
| 3300010860|Ga0126351_1026024 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300011120|Ga0150983_13213087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 906 | Open in IMG/M |
| 3300011269|Ga0137392_10092711 | All Organisms → cellular organisms → Bacteria | 2366 | Open in IMG/M |
| 3300011269|Ga0137392_11594619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300011271|Ga0137393_10270128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1445 | Open in IMG/M |
| 3300011271|Ga0137393_11121203 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300012096|Ga0137389_11095116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300012189|Ga0137388_10891533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
| 3300012206|Ga0137380_10343662 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
| 3300012209|Ga0137379_10769364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 868 | Open in IMG/M |
| 3300012361|Ga0137360_10081958 | All Organisms → cellular organisms → Bacteria | 2423 | Open in IMG/M |
| 3300012361|Ga0137360_10507595 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1027 | Open in IMG/M |
| 3300012362|Ga0137361_10280015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1524 | Open in IMG/M |
| 3300012362|Ga0137361_11045672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300012924|Ga0137413_10643984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
| 3300012977|Ga0134087_10314557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| 3300014154|Ga0134075_10194647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 871 | Open in IMG/M |
| 3300015051|Ga0137414_1023571 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300015054|Ga0137420_1082300 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
| 3300015264|Ga0137403_11483552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300015264|Ga0137403_11496221 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300017930|Ga0187825_10032391 | All Organisms → cellular organisms → Bacteria | 1763 | Open in IMG/M |
| 3300017943|Ga0187819_10678053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300017955|Ga0187817_10792088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300017959|Ga0187779_10831691 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300019789|Ga0137408_1343359 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4281 | Open in IMG/M |
| 3300020018|Ga0193721_1009208 | All Organisms → cellular organisms → Bacteria | 2588 | Open in IMG/M |
| 3300020579|Ga0210407_10232773 | All Organisms → cellular organisms → Bacteria | 1434 | Open in IMG/M |
| 3300021088|Ga0210404_10765732 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300021168|Ga0210406_10052892 | All Organisms → cellular organisms → Bacteria | 3547 | Open in IMG/M |
| 3300021170|Ga0210400_10520861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 981 | Open in IMG/M |
| 3300021171|Ga0210405_11050718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300021181|Ga0210388_11813796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300021401|Ga0210393_10229659 | All Organisms → cellular organisms → Bacteria | 1503 | Open in IMG/M |
| 3300021402|Ga0210385_11495263 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300021405|Ga0210387_10240455 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
| 3300021407|Ga0210383_10013845 | All Organisms → cellular organisms → Bacteria | 6813 | Open in IMG/M |
| 3300021407|Ga0210383_10809806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
| 3300021407|Ga0210383_11094754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300021432|Ga0210384_11584981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300021478|Ga0210402_10489573 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1142 | Open in IMG/M |
| 3300022507|Ga0222729_1016828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 830 | Open in IMG/M |
| 3300022507|Ga0222729_1025220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
| 3300022508|Ga0222728_1015886 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1041 | Open in IMG/M |
| 3300022508|Ga0222728_1081662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300022510|Ga0242652_1030446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300022531|Ga0242660_1067111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
| 3300022532|Ga0242655_10058326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 971 | Open in IMG/M |
| 3300022533|Ga0242662_10022853 | All Organisms → cellular organisms → Bacteria | 1433 | Open in IMG/M |
| 3300022533|Ga0242662_10071161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 941 | Open in IMG/M |
| 3300022533|Ga0242662_10157545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| 3300022721|Ga0242666_1083457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300022721|Ga0242666_1143736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300022726|Ga0242654_10127769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 828 | Open in IMG/M |
| 3300025916|Ga0207663_11082907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300026296|Ga0209235_1112876 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1153 | Open in IMG/M |
| 3300026297|Ga0209237_1070090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1653 | Open in IMG/M |
| 3300026304|Ga0209240_1275493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300026333|Ga0209158_1143988 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 876 | Open in IMG/M |
| 3300026334|Ga0209377_1255978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300026508|Ga0257161_1005016 | All Organisms → cellular organisms → Bacteria | 2273 | Open in IMG/M |
| 3300026528|Ga0209378_1154680 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 903 | Open in IMG/M |
| 3300026538|Ga0209056_10727509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300026540|Ga0209376_1358019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300027674|Ga0209118_1205669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300027748|Ga0209689_1075190 | All Organisms → cellular organisms → Bacteria | 1804 | Open in IMG/M |
| 3300027846|Ga0209180_10366341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
| 3300027855|Ga0209693_10361703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300027857|Ga0209166_10628114 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300027875|Ga0209283_10062720 | All Organisms → cellular organisms → Bacteria | 2385 | Open in IMG/M |
| 3300027875|Ga0209283_10874059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300027879|Ga0209169_10396324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
| 3300027882|Ga0209590_10693398 | Not Available | 652 | Open in IMG/M |
| 3300027884|Ga0209275_10771096 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300028021|Ga0265352_1016654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300028906|Ga0308309_11647282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300030879|Ga0265765_1050144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300030991|Ga0073994_10054438 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1484 | Open in IMG/M |
| 3300031708|Ga0310686_112659666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2474 | Open in IMG/M |
| 3300031713|Ga0318496_10706223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300031748|Ga0318492_10526263 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300031781|Ga0318547_10176636 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
| 3300031880|Ga0318544_10013350 | All Organisms → cellular organisms → Bacteria | 2646 | Open in IMG/M |
| 3300031962|Ga0307479_10194464 | All Organisms → cellular organisms → Bacteria | 1997 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.21% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.97% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.13% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.42% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.56% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.56% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.71% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.85% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.85% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.85% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300003220 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004100 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF244 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005640 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_052 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010860 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028021 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A100DRAFT_10276911 | 3300000655 | Forest Soil | QPMRDLHKRQFRHMAGARLRTLYDLLEEIRTAKRE* |
| JGI12053J15887_101145551 | 3300001661 | Forest Soil | DQPIHDLHKRQFRHISTARLKTLFDLLEEVRVRKPA* |
| JGI12053J15887_103128792 | 3300001661 | Forest Soil | QALRLLKTLDQPVHELHKRQFRHMPATQLKILSRLLEEVRTRKLE* |
| JGI25617J43924_101305301 | 3300002914 | Grasslands Soil | DRRVVKTRITPQALSLLKTLDRPVYELHKRQFRHMSAARLKILSDLLEEVRPRKTA* |
| JGI26342J46808_10025171 | 3300003220 | Bog Forest Soil | KSLDQPVRELHKRQFLHMPAARLKSLARLLEEVRARGPE* |
| Ga0062385_105322692 | 3300004080 | Bog Forest Soil | LLKSLDQPVRELHKRQFHHLPAARLKALAELLEEVRSRGPE* |
| Ga0058904_12027062 | 3300004100 | Forest Soil | HITREGLEVLKPLDHPMRELHKRQFRHMAAGRLKTLSQLLEEIGIRKLE* |
| Ga0058904_13481102 | 3300004100 | Forest Soil | HGLDLLKTLDQPVRELHKRQFRHMSAARLKILARLLEELHPRRQE* |
| Ga0066672_101349361 | 3300005167 | Soil | AQGLSLLKTFDQPVHNLHKRQFRHMSATRLKILYDLLEEVRVRKPA* |
| Ga0066687_100177071 | 3300005454 | Soil | VVKTRITPRGLELLKPLDQPMRDLHKKQFRHMAGARLKTLYDLLEEVRAHEQQ* |
| Ga0070734_101164153 | 3300005533 | Surface Soil | LLKTLDQPVRELHKRQFRHMAASRLKTLAALLEEVRTRKPEQ* |
| Ga0066692_100069041 | 3300005555 | Soil | LEQPVHKLHKRQFGHLAASRLKALSELLGEVRNRAPE* |
| Ga0066707_100830364 | 3300005556 | Soil | LSLLKTFDQPVHNLHKRQFRHMSATRLKILYDLLEEVRVRKPA* |
| Ga0066704_107898842 | 3300005557 | Soil | SLLKTLDQPIHDLHKRQFRHMPAARLKILSELLEEVRACKPE* |
| Ga0066708_106541242 | 3300005576 | Soil | TPQGLSLLKTLDQPVRDLHKRQFLHMSAARLKILSDLLEEVRNRKPA* |
| Ga0070763_104918821 | 3300005610 | Soil | LLKSLDQPVRELHKRQFHHLPARSLKTLAQLLEEVRARERE* |
| Ga0075035_14147272 | 3300005640 | Permafrost Soil | LDQPIRELHKRQFRHIAPAQLKVFADLLDQALVREAEMKAS* |
| Ga0075028_1002974332 | 3300006050 | Watersheds | LKTLDQPVHELHKRQFRHMSATRLKNLSDLLGEVRVRKPA* |
| Ga0075029_1000814534 | 3300006052 | Watersheds | ITPQALSLLKTLDQPVRDLHKRQFRHMSSARLKILSDLLEEVRVRKPA* |
| Ga0075017_1002530903 | 3300006059 | Watersheds | KTRITPQALSLLKTLDQPVRDLHKRQFRHMSSARLKILSDLLEEVRVRKPA* |
| Ga0070765_1000083909 | 3300006176 | Soil | SLDQPVRELHKRQFRHLPSARLKTLAKLLEEVRARGPE* |
| Ga0066659_100708684 | 3300006797 | Soil | LDQPVYDLHKRQFRRMSAARLKILSDLLEEVRGRKPR* |
| Ga0066659_107787111 | 3300006797 | Soil | AQGLSLLKTFDQPVYDLHKRQFRHMSATRLKILYDLLEEVRVRKPA* |
| Ga0079219_104233953 | 3300006954 | Agricultural Soil | LKGLDQPVRELHKRQFRHMPAARLKTLAELLEEVRARESQ* |
| Ga0099791_102760272 | 3300007255 | Vadose Zone Soil | KTRITPQALSLLKTLDQPVHELHKRQFRHIPAARLKTLGQLLEEVRAHKPE* |
| Ga0099793_104608082 | 3300007258 | Vadose Zone Soil | KTLDQPVHELHKRQFRHIPAARLKILGQLLGEVRARKLE* |
| Ga0099830_108021361 | 3300009088 | Vadose Zone Soil | RRVVKTRIMPQALSLLKTLDRPIRELHKRQFRHMSAARLKILSDLLEEVRVRNPA* |
| Ga0099828_102225724 | 3300009089 | Vadose Zone Soil | YQPVHDLHRRQFRHMPAEQLKTLSELLEKVRARKPE* |
| Ga0134063_104599731 | 3300010335 | Grasslands Soil | LKTFDQPVYDLHKRQFRHMSATRLKILYDLLEEVRVRKPA* |
| Ga0126370_109080612 | 3300010358 | Tropical Forest Soil | QTRITQHGLALLKPLDQPMRDLHKRQFRHMASTRLKALFDLLEEISCTRQE* |
| Ga0126377_134087952 | 3300010362 | Tropical Forest Soil | VVRTRITPKGLELLKPLDQSIRDLHKRQFRHMPATRLKTLHSLLEAIRRDEPD* |
| Ga0126379_128286552 | 3300010366 | Tropical Forest Soil | DQPMRDLHKRQFRHMLGARLKTLYDLLEEIRAAKQE* |
| Ga0126383_112707642 | 3300010398 | Tropical Forest Soil | KPLDQPMRDLHKRQFRHMAGANLKTLFGLLEEIRCTKQE* |
| Ga0126351_10260242 | 3300010860 | Boreal Forest Soil | PIRELHKRQFHHLPAARLKTLTQLLEEVRARGPE* |
| Ga0150983_132130872 | 3300011120 | Forest Soil | PVRELHKRQFHHLPSSRLKTLAELLEEVRARGPE* |
| Ga0137392_100927111 | 3300011269 | Vadose Zone Soil | LKTLDQPVRELHKRQFRHMTAARLKTLAQLLEEACAPQTD* |
| Ga0137392_115946191 | 3300011269 | Vadose Zone Soil | GLRLLKTLDQPVHDLHKRQFRHLPAARLKTLSELLEEVRTRKPE* |
| Ga0137393_102701283 | 3300011271 | Vadose Zone Soil | LDQPVHDLHKRQFRHMSAARLKILFDLLEEVRVRKPA* |
| Ga0137393_111212032 | 3300011271 | Vadose Zone Soil | TRITAQGLSLLKTLDQPVHDLHKRQFRHLPAARLKTLSELLEEVRTRKPE* |
| Ga0137389_110951161 | 3300012096 | Vadose Zone Soil | KTLDQPVRDLHKRQFRHMSAARLKILFDLLEEARVRKPA* |
| Ga0137388_108915331 | 3300012189 | Vadose Zone Soil | LLKTLDQPVRELHKRQFRHMSATRLKILFDLLEEVRVRKPA* |
| Ga0137380_103436621 | 3300012206 | Vadose Zone Soil | TAQGLRLLKTLDQPVHDLHKRQFRHLPAARLKTLSELLEEVRTRKPE* |
| Ga0137379_107693642 | 3300012209 | Vadose Zone Soil | PVHDLHKRQFRHLPAARLKTLSELLEEVRTRKPE* |
| Ga0137360_100819584 | 3300012361 | Vadose Zone Soil | KARITPQALRLLKTLDQPVHELHKRQFRHMPAARLKILNRLLEEVRARKLE* |
| Ga0137360_105075953 | 3300012361 | Vadose Zone Soil | VVKTRITPRALSLLKTLDHPVHELHKRQFRHMPAGRLKILSRLLEEVRARKLE* |
| Ga0137361_102800151 | 3300012362 | Vadose Zone Soil | TPRALSLLRTLDQPVRELHKRQFRHMSAARLKILSDLLEEVRVCKPA* |
| Ga0137361_110456721 | 3300012362 | Vadose Zone Soil | QALRLLKTLDQPVHELHKRQFRHMPAARLKILSRLLEEVRARKLE* |
| Ga0137413_106439841 | 3300012924 | Vadose Zone Soil | RRVVKTRITPQGLSLLKTLDQPIHDLHKRQFRHISTARLKTLFDLLEEVRVRKPA* |
| Ga0134087_103145572 | 3300012977 | Grasslands Soil | RRVVKTRITAQGLSLLKTFDQPVHNLHKRQFRHMSATRLKILYDLLEEVRVRKPA* |
| Ga0134075_101946471 | 3300014154 | Grasslands Soil | LKTLDQPVRELHKRQFRHMSAARLKILSDLLEEVRVRKPA* |
| Ga0137414_10235712 | 3300015051 | Vadose Zone Soil | VKTRIMPQALSLLKTLDRPIRELHKRQFRHMSAARLKILSNLLEEVRVRKPA* |
| Ga0137420_10823003 | 3300015054 | Vadose Zone Soil | TLDQPIRDLHKRQFRHMSAARLKIFFDLLEEARVRKPA* |
| Ga0137403_114835522 | 3300015264 | Vadose Zone Soil | RRVVKTRITPQALSLLRTMDQPVRELHKRQFRHMSHTRLKVLSDLLEEVRVRKPA* |
| Ga0137403_114962211 | 3300015264 | Vadose Zone Soil | RRVVKARITPQALSLLKTLDHPVHELHKRQFRHIPAARLKILNRLLEEVRARQLE* |
| Ga0187825_100323911 | 3300017930 | Freshwater Sediment | LLKTLDQPVRDLHRRQFRHMAAARLKMLAQILEEVHPHKPG |
| Ga0187819_106780531 | 3300017943 | Freshwater Sediment | TRITPQGLELIKPLDQPLRDLHKRQFRHMAGARLKTLHVLLEEIRGSHDE |
| Ga0187817_107920882 | 3300017955 | Freshwater Sediment | IKTRITSEGLVLLKSLDQPVRELHKRQFHHLPAARLKILAQLLEEVRARGPE |
| Ga0187779_108316911 | 3300017959 | Tropical Peatland | LDRPMRELHKRQFRHMPATRVKNLVELLEEICGAKQQ |
| Ga0137408_13433597 | 3300019789 | Vadose Zone Soil | VKTRITPQALSLLKTLDSRLRIHKRQFRHMSAARLKSLSDLLEEVRARKPA |
| Ga0193721_10092081 | 3300020018 | Soil | ITPQALSLLKTLDQPVRDLHKRQFRHMSVARLKILSDLLEEVRVRKPA |
| Ga0210407_102327733 | 3300020579 | Soil | AGQALLKSLDQPVRELHKRQFHHLPAARLKTLAKLLEEVRARGPQQT |
| Ga0210404_107657321 | 3300021088 | Soil | SLLKTLDQPVRDLHKRQFRHMPAARLKVLSDLLEEVRVRKPA |
| Ga0210406_100528921 | 3300021168 | Soil | VIKTRISPAGLALLKSLDQPVRELHKRQFHHLPAARLKTLAKLLEEVRARGPQQT |
| Ga0210400_105208611 | 3300021170 | Soil | LLKSLDQPVRELHKRQFHHLPAARLKTLAELLEEVRARGPE |
| Ga0210405_110507181 | 3300021171 | Soil | LGLLKPLDQPVHDLHKRQFRHMSGARLKILFDLLEEVRVRKPA |
| Ga0210388_118137961 | 3300021181 | Soil | PAGLALLKSLDQPVRELHKRQFHHLPARSLKTLAQLLEEVRAREQE |
| Ga0210393_102296591 | 3300021401 | Soil | ELLKGLDQPVRELHKRQFRHMPAARLKALSDLLDQVLVVGEK |
| Ga0210385_114952632 | 3300021402 | Soil | GLDQPVRELHKRQFHHLPAARLKTLAELLEEVRARGPE |
| Ga0210387_102404551 | 3300021405 | Soil | GLELLKGLDQPVRELHKRQFRHMPAARLKALSDLLDQVLVVGEK |
| Ga0210383_100138451 | 3300021407 | Soil | QPVRELHKRQFHHIPAARLKTLAELLEEVRVRGPQ |
| Ga0210383_108098062 | 3300021407 | Soil | IKTRITPAGLVLLKSLDQPVRELHKRQFHHLPAARLKALAELLEEVRARGPE |
| Ga0210383_110947542 | 3300021407 | Soil | AGLTLLKGLDQPVRELHKRQFHHLPAARLKTLAELLEEVRARGPE |
| Ga0210384_115849812 | 3300021432 | Soil | DQPIHDLHKRQFVHISTARLKTLFGLLEEVRARKPA |
| Ga0210402_104895733 | 3300021478 | Soil | LLRTLDQPIHELHKRQFRHMSAARLKTLFDLVEEVRVRKPA |
| Ga0222729_10168283 | 3300022507 | Soil | LDQPVRELHKRQFHHLPAARLKTLAELLEEVRARGPE |
| Ga0222729_10252201 | 3300022507 | Soil | KTLDQPVHDLHKRQFRHMSPARLRILFDLLEEVRVRKPA |
| Ga0222728_10158861 | 3300022508 | Soil | TLDQPVHDLHKRQFRHIPATRLKSLGRLLEEVRARKQG |
| Ga0222728_10816621 | 3300022508 | Soil | DQPVRELHKRQFRHLPSSRLKTLAQLLEEVRARGPE |
| Ga0242652_10304462 | 3300022510 | Soil | QPMRDLHKRQFRHMRNSRLKTLGTLLEEVRAGKKG |
| Ga0242660_10671112 | 3300022531 | Soil | GLLKSLDQPIHDLHKRQFRHVSPARLRILFDLLEEVRVRKPA |
| Ga0242655_100583261 | 3300022532 | Soil | ITPAGLALLKSLDQPVRELHKRQFQHLPARRLKTLAQLLEEVRARARE |
| Ga0242662_100228531 | 3300022533 | Soil | EMLKTLDQPIHDLHKRQFRHIPMAHLKALAELLEELRRRGVAE |
| Ga0242662_100711613 | 3300022533 | Soil | DQPVRELHKRQFHHLPSSRLKTLAELLEEVRARGPE |
| Ga0242662_101575451 | 3300022533 | Soil | VKTRITPQGLSLLKTLDQPMHDLHKRQFRHMRNSRLKTLDTLLEEVRDGKKG |
| Ga0242666_10834571 | 3300022721 | Soil | LLKSLDQPVRELHKRQFHHLPARSLKTLAQLLEEVRAREQE |
| Ga0242666_11437362 | 3300022721 | Soil | LDQPVRELHKRQFHHLPAARLKTLAQLLEEVRARGPE |
| Ga0242654_101277691 | 3300022726 | Soil | VTTAGLALLKSLDQPVRELHKRQFHHLPAARLKTLAELLEEVRARGPE |
| Ga0207663_110829072 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | PHGLALLKPLDQPMRDLHRRQFRHMAAGRLKTLCDLLEEIRCTMQE |
| Ga0209235_11128763 | 3300026296 | Grasslands Soil | RITPQALSLLKTLDQPVRELHKRQFRHMSAARLKILSDLLEEVRVRKPA |
| Ga0209237_10700901 | 3300026297 | Grasslands Soil | LELLKLLEQPVHKLHKRQFGHLAASRLKALSELLGEVRNRAPE |
| Ga0209240_12754932 | 3300026304 | Grasslands Soil | SLLKPLDQPIHDLHKRQFRHISTARLKTLSDLLEEVRVRKPA |
| Ga0209158_11439882 | 3300026333 | Soil | PRALSLLKTLDQPVHDLHKRQFRHMSVARLKILFDLLEEARVRKPA |
| Ga0209377_12559781 | 3300026334 | Soil | LRLLKTLDQPVHDLHKRQFRHLPAARLKTLSELLEEVGTRKPE |
| Ga0257161_10050161 | 3300026508 | Soil | LKTLDQPIHDLHKRQFRHISTARLKTLFDLLEEVRVRKPA |
| Ga0209378_11546802 | 3300026528 | Soil | LSLLKTFDQPVHNLHKRQFRHMSATRLKILYDLLEEVRVRKPA |
| Ga0209056_107275091 | 3300026538 | Soil | LKNLDQPVHDLHKRQFRHMSVARLKILSDLLEEVRVRKSA |
| Ga0209376_13580192 | 3300026540 | Soil | VVKTRISAQGLSLLKTLDQPVRDLHKRQFRHMSAPRLKILSDLLEEVRVCKPA |
| Ga0209118_12056691 | 3300027674 | Forest Soil | SLLKTLDQPVRDLHKRQFRHLSAARLKILFDLLEEVRVRKPA |
| Ga0209689_10751901 | 3300027748 | Soil | RVVKARMTARGLELLKPLDQPMRNLHKRQFRHMAGGRLKALYDLLEQIRPAKRE |
| Ga0209180_103663411 | 3300027846 | Vadose Zone Soil | LSLLKTLDQPVRELHKHQFRHMSATRLKILFDLLEEVRVRKPA |
| Ga0209693_103617032 | 3300027855 | Soil | VHELHKRQFRHLAAARLKTLAELLEKVRARGPEQTQ |
| Ga0209166_106281141 | 3300027857 | Surface Soil | LALLKPLDQPMRDLHKRQFRHMAAARLKTLCDLLEEIRCTKQE |
| Ga0209283_100627201 | 3300027875 | Vadose Zone Soil | LKALDQPVRDLHRRQFRHMAAARLKMLAEILQEVRPHEPG |
| Ga0209283_108740591 | 3300027875 | Vadose Zone Soil | LRLLKTLDRPIRELHKRQFRHMSAARLKILSDLLEEVRVRKPA |
| Ga0209169_103963242 | 3300027879 | Soil | LDQPVRELHKRQFRHMPAARLKALSDLLDQVLVVRDK |
| Ga0209590_106933981 | 3300027882 | Vadose Zone Soil | LDQPVHDLHKRQFRHLPAARLKTLSELLEEVRARKPE |
| Ga0209275_107710962 | 3300027884 | Soil | GLALLKSLDQPVRELHKRQFHHLPSARLKTLAELLEEVRARGPE |
| Ga0265352_10166541 | 3300028021 | Soil | LALLKSLDQPVRELHKRQFHHLPAARLKALAELLEEVRARGPQQT |
| Ga0308309_116472822 | 3300028906 | Soil | DQPVRELHKRQFGHLPAARLKTLAELLEEVRARGPE |
| Ga0265765_10501442 | 3300030879 | Soil | KSLDQPVRELHKRQFHHLPAARLKALAELLEEVRARGPQQT |
| Ga0073994_100544383 | 3300030991 | Soil | RVVKTRITPQGLSLLKTLDQPIHDLHKRQFRHISAARLKTLFDLLEEIRVRKPA |
| Ga0310686_1126596664 | 3300031708 | Soil | LKSLDQPVRELHKRQFHHLPAARLKTLAKLLEEVRARGPQQT |
| Ga0318496_107062231 | 3300031713 | Soil | LELLKPLDQPMRDLHKRQFRHMAGARLKTLYDLLEEIRTAKRE |
| Ga0318492_105262631 | 3300031748 | Soil | LLKPLDQPMRDLHKRQFRHMAGARLKTLYDLLEEIRTAKRE |
| Ga0318547_101766363 | 3300031781 | Soil | RGLELLKPLDQPMRDLHKRQFRHMAGARLKTLYDLLEEIRTAKRE |
| Ga0318544_100133501 | 3300031880 | Soil | VKARITGRGLELLKPLDQPMRDLHKRQFRHMAGARLKTLYDLLEEIRTAKRE |
| Ga0307479_101944644 | 3300031962 | Hardwood Forest Soil | RVVKARITPKGLGLLKSLDQPVHDVHKRQFRHMFPARLRILFDLLEEVRVRKPA |
| ⦗Top⦘ |