


| Basic Information | |
|---|---|
| Family ID | F077537 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 40 residues |
| Representative Sequence | TVPQTWRLVLFIRHLPQITPEELNEMKGWDPKSEADPAHF |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.85 % |
| % of genes near scaffold ends (potentially truncated) | 99.15 % |
| % of genes from short scaffolds (< 2000 bps) | 83.76 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.778 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (24.786 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.479 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.974 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.82% β-sheet: 0.00% Coil/Unstructured: 66.18% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF06441 | EHN | 29.91 |
| PF00378 | ECH_1 | 8.55 |
| PF00106 | adh_short | 3.42 |
| PF13561 | adh_short_C2 | 2.56 |
| PF01042 | Ribonuc_L-PSP | 2.56 |
| PF00058 | Ldl_recept_b | 1.71 |
| PF13450 | NAD_binding_8 | 1.71 |
| PF00202 | Aminotran_3 | 1.71 |
| PF12697 | Abhydrolase_6 | 1.71 |
| PF16694 | Cytochrome_P460 | 1.71 |
| PF00072 | Response_reg | 0.85 |
| PF02844 | GARS_N | 0.85 |
| PF00456 | Transketolase_N | 0.85 |
| PF01520 | Amidase_3 | 0.85 |
| PF13426 | PAS_9 | 0.85 |
| PF08281 | Sigma70_r4_2 | 0.85 |
| PF01116 | F_bP_aldolase | 0.85 |
| PF00903 | Glyoxalase | 0.85 |
| PF04542 | Sigma70_r2 | 0.85 |
| PF13305 | TetR_C_33 | 0.85 |
| PF07238 | PilZ | 0.85 |
| PF02954 | HTH_8 | 0.85 |
| PF12848 | ABC_tran_Xtn | 0.85 |
| PF05694 | SBP56 | 0.85 |
| PF03169 | OPT | 0.85 |
| PF13673 | Acetyltransf_10 | 0.85 |
| PF04551 | GcpE | 0.85 |
| PF02779 | Transket_pyr | 0.85 |
| PF14329 | DUF4386 | 0.85 |
| PF03547 | Mem_trans | 0.85 |
| PF00857 | Isochorismatase | 0.85 |
| PF01527 | HTH_Tnp_1 | 0.85 |
| PF11755 | DUF3311 | 0.85 |
| PF13473 | Cupredoxin_1 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 29.91 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 2.56 |
| COG0021 | Transketolase | Carbohydrate transport and metabolism [G] | 0.85 |
| COG0151 | Phosphoribosylamine-glycine ligase | Nucleotide transport and metabolism [F] | 0.85 |
| COG0191 | Fructose/tagatose bisphosphate aldolase | Carbohydrate transport and metabolism [G] | 0.85 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.85 |
| COG0679 | Predicted permease, AEC (auxin efflux carrier) family | General function prediction only [R] | 0.85 |
| COG0821 | 4-hydroxy-3-methylbut-2-enyl diphosphate synthase IspG/GcpE | Lipid transport and metabolism [I] | 0.85 |
| COG0860 | N-acetylmuramoyl-L-alanine amidase | Cell wall/membrane/envelope biogenesis [M] | 0.85 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.85 |
| COG1297 | Predicted oligopeptide transporter, OPT family | General function prediction only [R] | 0.85 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.85 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.85 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.85 |
| COG3959 | Transketolase, N-terminal subunit | Carbohydrate transport and metabolism [G] | 0.85 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.78 % |
| Unclassified | root | N/A | 22.22 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10219132 | Not Available | 1244 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101867060 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 503 | Open in IMG/M |
| 3300005538|Ga0070731_11117996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 521 | Open in IMG/M |
| 3300005602|Ga0070762_10007175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5468 | Open in IMG/M |
| 3300005712|Ga0070764_10643249 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300005712|Ga0070764_10696596 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300006176|Ga0070765_100402711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1277 | Open in IMG/M |
| 3300006176|Ga0070765_100792544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 895 | Open in IMG/M |
| 3300009628|Ga0116125_1167836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300009632|Ga0116102_1157564 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300009638|Ga0116113_1121694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300009643|Ga0116110_1080186 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300009672|Ga0116215_1090863 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300009698|Ga0116216_10620025 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300010339|Ga0074046_10093196 | All Organisms → cellular organisms → Bacteria | 1948 | Open in IMG/M |
| 3300011120|Ga0150983_14992017 | Not Available | 699 | Open in IMG/M |
| 3300014164|Ga0181532_10387046 | Not Available | 778 | Open in IMG/M |
| 3300014165|Ga0181523_10393532 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300014167|Ga0181528_10220922 | Not Available | 1023 | Open in IMG/M |
| 3300014168|Ga0181534_10666189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21 | 605 | Open in IMG/M |
| 3300014169|Ga0181531_10319239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 951 | Open in IMG/M |
| 3300014169|Ga0181531_10513119 | Not Available | 740 | Open in IMG/M |
| 3300014169|Ga0181531_10595511 | Not Available | 685 | Open in IMG/M |
| 3300014169|Ga0181531_10771839 | Not Available | 599 | Open in IMG/M |
| 3300014200|Ga0181526_10608193 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300014201|Ga0181537_10884905 | Not Available | 605 | Open in IMG/M |
| 3300014201|Ga0181537_10925695 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300014489|Ga0182018_10483915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. PDC80 | 656 | Open in IMG/M |
| 3300014501|Ga0182024_10309036 | Not Available | 2085 | Open in IMG/M |
| 3300014654|Ga0181525_10308479 | Not Available | 864 | Open in IMG/M |
| 3300014654|Ga0181525_10666908 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300014657|Ga0181522_10608888 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300016750|Ga0181505_10840098 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300017935|Ga0187848_10468139 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300017937|Ga0187809_10342020 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300017940|Ga0187853_10033112 | All Organisms → cellular organisms → Bacteria | 2747 | Open in IMG/M |
| 3300017955|Ga0187817_10077026 | All Organisms → cellular organisms → Bacteria | 2082 | Open in IMG/M |
| 3300017961|Ga0187778_10894493 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300018007|Ga0187805_10208550 | Not Available | 893 | Open in IMG/M |
| 3300018016|Ga0187880_1197722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 914 | Open in IMG/M |
| 3300018034|Ga0187863_10651062 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300018038|Ga0187855_10049240 | All Organisms → cellular organisms → Bacteria | 2623 | Open in IMG/M |
| 3300018046|Ga0187851_10278840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 973 | Open in IMG/M |
| 3300018047|Ga0187859_10129147 | All Organisms → cellular organisms → Bacteria | 1334 | Open in IMG/M |
| 3300018085|Ga0187772_10879977 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300018085|Ga0187772_11474020 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300018086|Ga0187769_10432685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa ligni | 991 | Open in IMG/M |
| 3300019240|Ga0181510_1278695 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300019270|Ga0181512_1310162 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300020579|Ga0210407_10547681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 903 | Open in IMG/M |
| 3300020580|Ga0210403_11517837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300020581|Ga0210399_10031725 | All Organisms → cellular organisms → Bacteria | 4221 | Open in IMG/M |
| 3300020581|Ga0210399_10510273 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300020581|Ga0210399_10931084 | Not Available | 703 | Open in IMG/M |
| 3300020582|Ga0210395_10034573 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3707 | Open in IMG/M |
| 3300020583|Ga0210401_11153813 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300021168|Ga0210406_10047604 | All Organisms → cellular organisms → Bacteria | 3769 | Open in IMG/M |
| 3300021168|Ga0210406_10268075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1397 | Open in IMG/M |
| 3300021171|Ga0210405_10186944 | Not Available | 1642 | Open in IMG/M |
| 3300021178|Ga0210408_10953608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
| 3300021181|Ga0210388_10094714 | Not Available | 2550 | Open in IMG/M |
| 3300021401|Ga0210393_10795564 | Not Available | 770 | Open in IMG/M |
| 3300021402|Ga0210385_10638701 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300021404|Ga0210389_10979361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300021405|Ga0210387_10041191 | All Organisms → cellular organisms → Bacteria | 3685 | Open in IMG/M |
| 3300021405|Ga0210387_10620548 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300021405|Ga0210387_11366496 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300021406|Ga0210386_10195593 | All Organisms → cellular organisms → Bacteria | 1710 | Open in IMG/M |
| 3300021406|Ga0210386_10848351 | Not Available | 784 | Open in IMG/M |
| 3300021407|Ga0210383_10027798 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4727 | Open in IMG/M |
| 3300021407|Ga0210383_10105599 | All Organisms → cellular organisms → Bacteria | 2372 | Open in IMG/M |
| 3300021407|Ga0210383_11186841 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300021420|Ga0210394_10333024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1333 | Open in IMG/M |
| 3300021420|Ga0210394_10580934 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300021433|Ga0210391_11550206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300021477|Ga0210398_10169423 | Not Available | 1779 | Open in IMG/M |
| 3300021559|Ga0210409_10032757 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4984 | Open in IMG/M |
| 3300022873|Ga0224550_1048965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300025434|Ga0208690_1009575 | All Organisms → cellular organisms → Bacteria | 2028 | Open in IMG/M |
| 3300027629|Ga0209422_1000921 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7117 | Open in IMG/M |
| 3300027629|Ga0209422_1036106 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300027648|Ga0209420_1030041 | All Organisms → cellular organisms → Bacteria | 1701 | Open in IMG/M |
| 3300027667|Ga0209009_1072287 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300027727|Ga0209328_10028603 | Not Available | 1714 | Open in IMG/M |
| 3300027768|Ga0209772_10081502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 982 | Open in IMG/M |
| 3300027842|Ga0209580_10667816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 514 | Open in IMG/M |
| 3300027867|Ga0209167_10311017 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300027867|Ga0209167_10415212 | Not Available | 734 | Open in IMG/M |
| 3300027879|Ga0209169_10475001 | Not Available | 657 | Open in IMG/M |
| 3300027879|Ga0209169_10516284 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300027889|Ga0209380_10009144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 5823 | Open in IMG/M |
| 3300027895|Ga0209624_10310090 | Not Available | 1051 | Open in IMG/M |
| 3300027908|Ga0209006_10615467 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300028047|Ga0209526_10270086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces avermitilis | 1158 | Open in IMG/M |
| 3300028748|Ga0302156_10181376 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300028798|Ga0302222_10142186 | Not Available | 947 | Open in IMG/M |
| 3300029910|Ga0311369_11115412 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300029999|Ga0311339_11054898 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 756 | Open in IMG/M |
| 3300030007|Ga0311338_11380511 | Not Available | 657 | Open in IMG/M |
| 3300030053|Ga0302177_10060327 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2273 | Open in IMG/M |
| 3300030053|Ga0302177_10205537 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300030503|Ga0311370_10988198 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300030503|Ga0311370_12440605 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300030580|Ga0311355_11776961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae | 524 | Open in IMG/M |
| 3300030707|Ga0310038_10228850 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300031233|Ga0302307_10380278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 719 | Open in IMG/M |
| 3300031234|Ga0302325_11613654 | Not Available | 826 | Open in IMG/M |
| 3300031234|Ga0302325_12429412 | Not Available | 628 | Open in IMG/M |
| 3300031236|Ga0302324_100430689 | All Organisms → cellular organisms → Bacteria | 1954 | Open in IMG/M |
| 3300031236|Ga0302324_101379206 | Not Available | 924 | Open in IMG/M |
| 3300031247|Ga0265340_10498078 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300031708|Ga0310686_113645946 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300031708|Ga0310686_117822328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300031941|Ga0310912_11504378 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300032805|Ga0335078_10956781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa ligni | 1020 | Open in IMG/M |
| 3300032895|Ga0335074_10072901 | All Organisms → cellular organisms → Bacteria | 4626 | Open in IMG/M |
| 3300032895|Ga0335074_10110097 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3601 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.79% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 11.97% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 11.97% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.40% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 8.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.84% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.27% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.42% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.42% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.56% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.56% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.71% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.85% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.85% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.85% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.85% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.85% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.85% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019240 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019270 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
| 3300025434 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_102191321 | 3300001593 | Forest Soil | SGTHTAAQTWRLVLFIRHLPQIAPEELNEMKQWDQKSEANPAHF* |
| JGIcombinedJ26739_1018670601 | 3300002245 | Forest Soil | QAWRLVLFIRHLPQITPEELNEMKALNRKMVANPANW* |
| Ga0070731_111179962 | 3300005538 | Surface Soil | AWRLVLFIRHLPQITPEEIKEMNGWNRKPQANPKNF* |
| Ga0070762_100071751 | 3300005602 | Soil | PQTWRLVLFIRHLPQITPEELNEMKGWDPKNEADPAHF* |
| Ga0070764_106432491 | 3300005712 | Soil | QTWRLVLFIRHLPQITPEELDEMNGWDSKREADPTHF* |
| Ga0070764_106965961 | 3300005712 | Soil | TWRLVLFIRHLPQITPEELNEMKGWDPKSEAVPAHF* |
| Ga0070765_1004027113 | 3300006176 | Soil | WRLVLFIRHLPEITDEELNEMKGWNPKMQANPANF* |
| Ga0070765_1007925442 | 3300006176 | Soil | HGTHTVPQTWRLVLFIRHLPQITPEELNEMKGWDPKSEADPAHF* |
| Ga0116125_11678361 | 3300009628 | Peatland | TAAQTWRLVLFIRHLPQITPDELNDMKGWDPKNQADPAHF* |
| Ga0116102_11575641 | 3300009632 | Peatland | TWRLVLFIRHLPQITAEELNEMKGLNPKRQANPANF* |
| Ga0116113_11216941 | 3300009638 | Peatland | AQTWRLVLFIRHLAQITPEELNEMKALNPKRQANPANW* |
| Ga0116110_10801862 | 3300009643 | Peatland | PWNWRLVLFIRHLPQITPEELNEMNGWDSKMEANPAHF* |
| Ga0116215_10908631 | 3300009672 | Peatlands Soil | TWRLVLFIRYLPRITPEELNEMKGWNSKMEADPAHF* |
| Ga0116216_106200251 | 3300009698 | Peatlands Soil | WRLVLFIRHLPQITPEELNEMDGWNSKMEANPAHF* |
| Ga0074046_100931963 | 3300010339 | Bog Forest Soil | FHGTHTVPQTWRLVLFIRHLPQITPEELNEMKGWDPKNEADPAHF* |
| Ga0150983_149920171 | 3300011120 | Forest Soil | PQTWRLVLFIRHLPQITPDELNDMKGWDPKNQADPAHF* |
| Ga0181532_103870461 | 3300014164 | Bog | AFHGTHTVPQTWRLVLFIRHLPQITPDELNDMKGWDPKNQADPAHF* |
| Ga0181523_103935321 | 3300014165 | Bog | RLVLFIRHLPQITPEELNEMNGWNSKMEADPAHF* |
| Ga0181528_102209221 | 3300014167 | Bog | TWRLVLFIRHLPQITPEELNEMKGWDPKNEANPAHF* |
| Ga0181534_106661891 | 3300014168 | Bog | TWRLVLFIRHLPQITSEELNEMKGWDPKNEANPAHF* |
| Ga0181531_103192391 | 3300014169 | Bog | TVPQTWRLVLFIRHLPQITPEELNEMKGWDSKMEADPAHF* |
| Ga0181531_105131192 | 3300014169 | Bog | GTHTVPQTWRLVLFIRHLPQITPEELNEMKGWDQKSEADPAHF* |
| Ga0181531_105955112 | 3300014169 | Bog | HTVPQTWRLVLFIRHLPQITPEELNEMKGWDPKNEANPAHF* |
| Ga0181531_107718392 | 3300014169 | Bog | VPQTWRLVLFIRHLPQITPEELNEMKGWDPKNEANPAHF* |
| Ga0181526_106081931 | 3300014200 | Bog | TVPWNWRLVLSIRHLPQITPEELNEMNGWDSKMEANPAHF* |
| Ga0181537_108849052 | 3300014201 | Bog | RLVLFIRHLPQITAEELNEMKALNPKRQANPANW* |
| Ga0181537_109256951 | 3300014201 | Bog | TVPWNWRLVLFIRHLPQITPEELNEMNGWDSKMEANPAHF* |
| Ga0182018_104839152 | 3300014489 | Palsa | WRLVLFIRHLPQITAEELNEMKGLNPKKEANPANF* |
| Ga0182024_103090361 | 3300014501 | Permafrost | TWRLVLFIRHLPQITPEELNEMNGWDPKSAADPAHF* |
| Ga0181525_103084792 | 3300014654 | Bog | AFSEAHTAPQAWRLVLFIRHLPQITPEELNEMKGWNRKMVANPANW* |
| Ga0181525_106669082 | 3300014654 | Bog | EAHTAPQAWRLVLFIRHLPQITPEELNEMKGWNRKMMANPANW* |
| Ga0181522_106088881 | 3300014657 | Bog | WRLVLFIRHLPQITPEELNEMNGWNSKMEADPAHF* |
| Ga0181505_108400981 | 3300016750 | Peatland | HTVPQTWRLVLFIRHLPQITPEELNEMKGWDPKNEANPAHF |
| Ga0187848_104681392 | 3300017935 | Peatland | AFHGTHTVPWNWRLVLFIRHLPQITPEELNEMNGWNSKMEADPAHF |
| Ga0187809_103420202 | 3300017937 | Freshwater Sediment | WRLVLFIRHLPQITPEELNEMKGWDPKSEADPAHF |
| Ga0187853_100331121 | 3300017940 | Peatland | PWNWRLVLFIRHLPQITPEELNEMNGWDSKMEANPAHF |
| Ga0187817_100770263 | 3300017955 | Freshwater Sediment | HTVPQTWRLVLFIRHLPQITPEELNEMKGWDPKSEADPAHF |
| Ga0187778_108944932 | 3300017961 | Tropical Peatland | AEKTWRLILFIRHLPQITPEELNEMKGLNRKPQANFADF |
| Ga0187805_102085501 | 3300018007 | Freshwater Sediment | THTVPQTWRLVLFIRHLPQITPEELNDMKGWDPKNEANPAHF |
| Ga0187880_11977221 | 3300018016 | Peatland | FHGTHTVPWNWRLVLFIRHLPQITPEELNEMNGWNSKMEADPAHF |
| Ga0187863_106510621 | 3300018034 | Peatland | GTHTVPQTWRLVLFIRHLPQITPEELNEMMGWDPKNEANPAHF |
| Ga0187855_100492401 | 3300018038 | Peatland | HTVPQTWRLVLFIRHLPQITPEELNEMKGWDSKMEADPSHF |
| Ga0187851_102788401 | 3300018046 | Peatland | TVPQTWRLVLFIRHLPQITPEELNEMKGWNSKMEADPSHF |
| Ga0187859_101291471 | 3300018047 | Peatland | HTVPQTWRLVLFIRHLPQITPEELNEMAGWDPKSYAVPAHF |
| Ga0187772_108799771 | 3300018085 | Tropical Peatland | FSEVHTAEKTWRLILFIRHLPQITPEELNEMKGLNRKREANPANF |
| Ga0187772_114740202 | 3300018085 | Tropical Peatland | EKTWRLILFIRHLPQITPEELNEMKGLNRKIQANPGDW |
| Ga0187769_104326851 | 3300018086 | Tropical Peatland | AWRLVLFIRHLPQITPEELNEMKGLNRKPEANPANF |
| Ga0181510_12786951 | 3300019240 | Peatland | TVPQTWRLVLFIRHLPQITPEELNEMKGWDPKNEANPAHF |
| Ga0181512_13101621 | 3300019270 | Peatland | TWRLVLFIRHLPQITPEELNEMKTLNRKMQSNPANW |
| Ga0210407_105476811 | 3300020579 | Soil | FSGTHSVAQTWHLVLFIRHLPQVTPAELNEMKGWDPKSAADPAHF |
| Ga0210403_115178372 | 3300020580 | Soil | TWRLVLFIRHLPQITPEELNEMKGWDPKSEADPAHF |
| Ga0210399_100317253 | 3300020581 | Soil | WRLVLFIRHLPQITPEELNEMKGWDPKSEANPAHF |
| Ga0210399_105102731 | 3300020581 | Soil | AQTWRLVLFIRHLPQITAEELNEMKGWDPKSAADPAHF |
| Ga0210399_109310841 | 3300020581 | Soil | TWRLVLFIRHLPQITPEELNEMKGWGQKSEADPAHF |
| Ga0210395_100345737 | 3300020582 | Soil | MPAFSGTHTAAQTWRLVLFIRHLPQITAEELNEMKGWDQKSEADPAHF |
| Ga0210401_111538132 | 3300020583 | Soil | AFHGTHTVPQTWRLVLFIRHLPQITPEELNEMKGWDQKSAADPAHF |
| Ga0210406_100476041 | 3300021168 | Soil | FSGTHTAAQTWRLVLFIRHLPQITAEELNEMKGWDPKSAADPAHF |
| Ga0210406_102680751 | 3300021168 | Soil | THTVPQTWRLVLFIRHLPQITAEELNEMERLDPKSEADQTHF |
| Ga0210405_101869441 | 3300021171 | Soil | VPQTWRLVLFIRHLPQITPEELNEMKGWDPKSDADPAHF |
| Ga0210408_109536081 | 3300021178 | Soil | TVPQTWRLVLFIRHLPQITAEELNEMKRLDPKSEADPAHF |
| Ga0210388_100947141 | 3300021181 | Soil | TVPQTWRLVLFIRHLPQITPEELNEMKGWDPKSEADPAHF |
| Ga0210393_107955641 | 3300021401 | Soil | TVPQTWRLVLFIRHLPQITPEELNEMKGWDQKSEADPAHF |
| Ga0210385_106387012 | 3300021402 | Soil | WRLVLFSRHLPQITPEELNEMKGWDPKSEADPAHF |
| Ga0210389_109793611 | 3300021404 | Soil | PAFSGTHTAAQTWRLVLFIRHLPQITAEELNEMKGWDQKSEADPAHF |
| Ga0210387_100411911 | 3300021405 | Soil | TWRLVLFIRHLPQITAEELNEMKRLEPKSEADPAHF |
| Ga0210387_106205482 | 3300021405 | Soil | THTVPLTWRLVLFIRHLPQITAEELNEMERLYPKSEANPAHF |
| Ga0210387_113664961 | 3300021405 | Soil | TVPQTWRLVLFIRHLPQITPEELNEMKGWDPKSEADTAHF |
| Ga0210386_101955931 | 3300021406 | Soil | SGTHTAAQTWRLVLFIRHLPQITAEELNEMKGWDPKSEADPAHF |
| Ga0210386_108483511 | 3300021406 | Soil | HTVPQTWRLVLFIRHLPQITPEELNEMKGWDQKSAADSAHF |
| Ga0210383_100277985 | 3300021407 | Soil | QTWRLVLFIRHLPQITPEELNEMKGWDPKSEAVPAHF |
| Ga0210383_101055991 | 3300021407 | Soil | VPQTWRLVLFIRHLPQITPEELNEMKGWDQKSAADPAHF |
| Ga0210383_111868412 | 3300021407 | Soil | MPAFHGTHTVPQTWRLVLFIRHLPQINPEELNEMNGWNSKMEADPAHF |
| Ga0210394_103330243 | 3300021420 | Soil | GTHTVPQTWRLVLFIRHLPQITPEELNEMKGWDPKSEADPAHF |
| Ga0210394_105809342 | 3300021420 | Soil | WRLVLFIRHLPRITAEELDEMKRLDPTSEADPAHF |
| Ga0210391_115502062 | 3300021433 | Soil | MPAFHGTHTDPQTWRLVLFIRHLPQITPEELNEMNGWNSKMEADPAHF |
| Ga0210398_101694231 | 3300021477 | Soil | FHGTHTVPQTWRLVLFIRHLPQITPEELNDMKGWDPKNEADPAHF |
| Ga0210409_100327576 | 3300021559 | Soil | HTAAQTWRLVLFIRHLPQITAEELNEMKGWDPKSEADPAHF |
| Ga0224550_10489651 | 3300022873 | Soil | PQTWRLVLFIRHLPQITPEELNEMKGWDPKNEADPAHF |
| Ga0208690_10095751 | 3300025434 | Peatland | PQTWRLVLFIRHLPQITPDELNDMKGWDPKNQADPAHF |
| Ga0209422_100092112 | 3300027629 | Forest Soil | SAAQAWRLVLFIRHLPQITAEELNEMKGLNPKRQANPANW |
| Ga0209422_10361062 | 3300027629 | Forest Soil | SAAQAWRLVLFIRHLPQITAEELNEMKGLNPKPQANPANW |
| Ga0209420_10300413 | 3300027648 | Forest Soil | FHGSHTVPQTWRLVLFIRHLPQITPEELNEMAGWDPKSYAVPAHF |
| Ga0209009_10722871 | 3300027667 | Forest Soil | HTVPQTWRLVLFIRHLPQITPEELNEMKRWDPKNEADPAHF |
| Ga0209328_100286032 | 3300027727 | Forest Soil | WRLVLFIRHLPQITPEELNEMKGWDPKSEAVPAHF |
| Ga0209772_100815023 | 3300027768 | Bog Forest Soil | TWRLVLFIRHLPQITPEEVNEMKGWDPKSEADPAHF |
| Ga0209580_106678161 | 3300027842 | Surface Soil | PAFSGTHTPALTWRLVLFIRHLPQITPEELNEMNGWDPKSAADPAHF |
| Ga0209167_103110173 | 3300027867 | Surface Soil | WRLVLFIRHLPQITPEELNEMKGWNSKMEADPAHF |
| Ga0209167_104152122 | 3300027867 | Surface Soil | THTVPQTWRLVLFIRHLPQITAEELNEMKRLDPTSEADPAHF |
| Ga0209169_104750011 | 3300027879 | Soil | PQTWRLVLFIRHLPQITPEELDEMNGWDSKREADPTHF |
| Ga0209169_105162842 | 3300027879 | Soil | TWRLVLFIRHLPQITPEELNEMKGWDPKSEAVPAHF |
| Ga0209380_100091445 | 3300027889 | Soil | AFSGTHTAAQTWRLVLFIRHLPQITAEELNEMKRLDPKSEADPAHF |
| Ga0209624_103100901 | 3300027895 | Forest Soil | TWRLVLFIRHLPQITPEELNEMKGWDPKNEANPAHF |
| Ga0209006_106154671 | 3300027908 | Forest Soil | AFSGTHTPALTWRLVLFIRHLPQITPEELHEMEGWDPKSAADPAHF |
| Ga0209526_102700862 | 3300028047 | Forest Soil | PQTWRLVLFIRHLPQITPEELNEMKGWDPKSEAVPAHF |
| Ga0302156_101813761 | 3300028748 | Bog | MPAFHGTHTVPWNWRLVLFIRHLPQITPEELNEMNGWDSKMEANPAHF |
| Ga0302222_101421862 | 3300028798 | Palsa | MPAFSGTHTVPQTWRLVLFIRHLPQITPEELNEMKGWDSKMEADPSHF |
| Ga0311369_111154122 | 3300029910 | Palsa | TVPQTWRLVLFIRHLPQITPEDLNEMKGWDPKNEANPAHF |
| Ga0311339_110548981 | 3300029999 | Palsa | WRLVLFIRHLPQITPEELNEMKGWDPKNEADPAHF |
| Ga0311338_113805112 | 3300030007 | Palsa | TWRLVLFIRHLPQTTPEEFSEIKALNPKMVANPANW |
| Ga0302177_100603273 | 3300030053 | Palsa | GTHTVPQTWRLVLFIRHLPQITPEELNEMKGWDPKNEADPVHF |
| Ga0302177_102055372 | 3300030053 | Palsa | TAAQTWRLVLFIRHLPQITAEELNQMKGLNPKPEANPANF |
| Ga0311370_109881982 | 3300030503 | Palsa | TAAQTWRLVLFIRHLPQITAAELNQMKGLNPKPEANPANF |
| Ga0311370_124406051 | 3300030503 | Palsa | HTVPQTWRLVLFIRHLPQITPEELNEMKGWDQKNEADPAHF |
| Ga0311355_117769611 | 3300030580 | Palsa | MPAFSEAHTPEKTWRLVLFIRHLPQITPGELNEMKGWNRKMQANPANW |
| Ga0310038_102288501 | 3300030707 | Peatlands Soil | HTVPQTWRLVLFIRHLPQITPEEVNEMKGWDPKSEANPANF |
| Ga0302307_103802781 | 3300031233 | Palsa | VPQTWRLVLFIRHLPQITPEELNEMKGWDPKNEADPAHF |
| Ga0302325_116136541 | 3300031234 | Palsa | QTWRLVLFIRHLPQITPEELNEMKGWDSKMEADPSHF |
| Ga0302325_124294122 | 3300031234 | Palsa | QTWRLVLFIRHLPQITPEELNEMKGWDPKNEANPAHF |
| Ga0302324_1004306891 | 3300031236 | Palsa | AFHGTHTVPQTWRLVLFIRHLPQITPEELNEMKGWDPKNEANPAHF |
| Ga0302324_1013792062 | 3300031236 | Palsa | THTVPQTWRLVLFIRHLPQIRPEELNEMKGWDPKNEADPAHF |
| Ga0265340_104980781 | 3300031247 | Rhizosphere | SEAHTPEKAWRLVLFIRHLPQITPEELNEMKALNRKMVANPADW |
| Ga0310686_1136459462 | 3300031708 | Soil | WRLVLFIRHLPQITPEELNEMKRWDPKNEADPAHF |
| Ga0310686_1178223281 | 3300031708 | Soil | EHTPPLNWRLILFIRHLPQITPEELNEMKGWDPKSEADPAHF |
| Ga0310912_115043781 | 3300031941 | Soil | FKEIHTPEKTWRLILFIRHLPQITPEELNEMKGLNRKPQADFADF |
| Ga0335078_109567812 | 3300032805 | Soil | QTWRLVLFIRHLPQITPEEVNEMKGWDPKNEADPAHF |
| Ga0335074_100729015 | 3300032895 | Soil | HTAPQAWRLVLFIRHLPQITPEELNEMKGWNRKMMANPANW |
| Ga0335074_101100976 | 3300032895 | Soil | MLAFHGTHTVPQTWRLVLFIRHLPQITAEELKEMDGWNRKPQANPKDF |
| ⦗Top⦘ |