


| Basic Information | |
|---|---|
| Family ID | F077430 |
| Family Type | Metagenome |
| Number of Sequences | 117 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MYYIVEITPRGIETFLEGFEDIGEAWDVVSRLQCEARRRRRKVRYEVR |
| Number of Associated Samples | 82 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 82.05 % |
| % of genes near scaffold ends (potentially truncated) | 16.24 % |
| % of genes from short scaffolds (< 2000 bps) | 89.74 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.69 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (65.812 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.803 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.444 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (64.103 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.37% β-sheet: 22.37% Coil/Unstructured: 55.26% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.69 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF00196 | GerE | 4.27 |
| PF00144 | Beta-lactamase | 2.56 |
| PF00436 | SSB | 2.56 |
| PF00072 | Response_reg | 1.71 |
| PF02156 | Glyco_hydro_26 | 1.71 |
| PF10547 | P22_AR_N | 1.71 |
| PF13751 | DDE_Tnp_1_6 | 1.71 |
| PF13977 | TetR_C_6 | 1.71 |
| PF01790 | LGT | 0.85 |
| PF08843 | AbiEii | 0.85 |
| PF12802 | MarR_2 | 0.85 |
| PF00282 | Pyridoxal_deC | 0.85 |
| PF00440 | TetR_N | 0.85 |
| PF01609 | DDE_Tnp_1 | 0.85 |
| PF10552 | ORF6C | 0.85 |
| PF00211 | Guanylate_cyc | 0.85 |
| PF14216 | DUF4326 | 0.85 |
| PF13358 | DDE_3 | 0.85 |
| PF13683 | rve_3 | 0.85 |
| PF09828 | Chrome_Resist | 0.85 |
| PF05685 | Uma2 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 2.56 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 2.56 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 2.56 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 2.56 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 2.56 |
| COG4124 | Beta-mannanase | Carbohydrate transport and metabolism [G] | 1.71 |
| COG0682 | Prolipoprotein diacylglyceryltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.85 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.85 |
| COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 0.85 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.85 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.85 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.85 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.85 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.85 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.85 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.85 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 65.81 % |
| All Organisms | root | All Organisms | 34.19 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003324|soilH2_10033290 | All Organisms → cellular organisms → Bacteria | 10458 | Open in IMG/M |
| 3300003324|soilH2_10127988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Intrasporangium → Intrasporangium calvum | 1860 | Open in IMG/M |
| 3300005355|Ga0070671_101259567 | Not Available | 652 | Open in IMG/M |
| 3300005365|Ga0070688_100792514 | Not Available | 740 | Open in IMG/M |
| 3300005365|Ga0070688_101258452 | Not Available | 596 | Open in IMG/M |
| 3300005466|Ga0070685_10037275 | All Organisms → cellular organisms → Bacteria | 2753 | Open in IMG/M |
| 3300005471|Ga0070698_102048197 | Not Available | 526 | Open in IMG/M |
| 3300005518|Ga0070699_100344900 | Not Available | 1341 | Open in IMG/M |
| 3300005529|Ga0070741_10092815 | All Organisms → cellular organisms → Bacteria | 3244 | Open in IMG/M |
| 3300005529|Ga0070741_10466468 | Not Available | 1148 | Open in IMG/M |
| 3300005529|Ga0070741_11345090 | Not Available | 596 | Open in IMG/M |
| 3300005617|Ga0068859_100171943 | All Organisms → cellular organisms → Bacteria | 2248 | Open in IMG/M |
| 3300005718|Ga0068866_10236514 | Not Available | 1110 | Open in IMG/M |
| 3300005719|Ga0068861_100609806 | Not Available | 1003 | Open in IMG/M |
| 3300006041|Ga0075023_100211665 | Not Available | 754 | Open in IMG/M |
| 3300006047|Ga0075024_100852246 | Not Available | 514 | Open in IMG/M |
| 3300006057|Ga0075026_100018358 | All Organisms → cellular organisms → Bacteria | 3099 | Open in IMG/M |
| 3300006057|Ga0075026_100135757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1252 | Open in IMG/M |
| 3300006057|Ga0075026_100307659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales | 867 | Open in IMG/M |
| 3300006237|Ga0097621_100363301 | Not Available | 1290 | Open in IMG/M |
| 3300006755|Ga0079222_10074835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae | 1682 | Open in IMG/M |
| 3300006755|Ga0079222_11469939 | Not Available | 636 | Open in IMG/M |
| 3300006791|Ga0066653_10285096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 836 | Open in IMG/M |
| 3300006844|Ga0075428_101230348 | Not Available | 789 | Open in IMG/M |
| 3300006852|Ga0075433_11483963 | Not Available | 586 | Open in IMG/M |
| 3300006854|Ga0075425_101796800 | Not Available | 688 | Open in IMG/M |
| 3300006871|Ga0075434_101614868 | Not Available | 657 | Open in IMG/M |
| 3300006876|Ga0079217_11359049 | Not Available | 552 | Open in IMG/M |
| 3300009012|Ga0066710_104516434 | Not Available | 520 | Open in IMG/M |
| 3300009094|Ga0111539_13333380 | Not Available | 517 | Open in IMG/M |
| 3300009100|Ga0075418_12674065 | Not Available | 545 | Open in IMG/M |
| 3300009101|Ga0105247_10387894 | Not Available | 992 | Open in IMG/M |
| 3300009137|Ga0066709_104052412 | Not Available | 533 | Open in IMG/M |
| 3300009147|Ga0114129_11072287 | Not Available | 1010 | Open in IMG/M |
| 3300009148|Ga0105243_10872857 | Not Available | 893 | Open in IMG/M |
| 3300009148|Ga0105243_10895875 | Not Available | 882 | Open in IMG/M |
| 3300009162|Ga0075423_11460601 | Not Available | 733 | Open in IMG/M |
| 3300009162|Ga0075423_11874245 | Not Available | 647 | Open in IMG/M |
| 3300009162|Ga0075423_12128319 | Not Available | 609 | Open in IMG/M |
| 3300009177|Ga0105248_10571894 | Not Available | 1275 | Open in IMG/M |
| 3300009545|Ga0105237_10528127 | Not Available | 1187 | Open in IMG/M |
| 3300009545|Ga0105237_11959654 | Not Available | 594 | Open in IMG/M |
| 3300009553|Ga0105249_12892443 | Not Available | 551 | Open in IMG/M |
| 3300009840|Ga0126313_11292404 | Not Available | 603 | Open in IMG/M |
| 3300010036|Ga0126305_10502018 | Not Available | 809 | Open in IMG/M |
| 3300010039|Ga0126309_10236556 | Not Available | 1028 | Open in IMG/M |
| 3300010039|Ga0126309_10954636 | Not Available | 572 | Open in IMG/M |
| 3300010040|Ga0126308_10956217 | Not Available | 599 | Open in IMG/M |
| 3300010040|Ga0126308_11005192 | Not Available | 584 | Open in IMG/M |
| 3300010041|Ga0126312_10908399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 642 | Open in IMG/M |
| 3300010045|Ga0126311_10034405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales | 3144 | Open in IMG/M |
| 3300010045|Ga0126311_11526898 | Not Available | 560 | Open in IMG/M |
| 3300010166|Ga0126306_10510907 | Not Available | 951 | Open in IMG/M |
| 3300010166|Ga0126306_11334221 | Not Available | 592 | Open in IMG/M |
| 3300010336|Ga0134071_10786598 | Not Available | 508 | Open in IMG/M |
| 3300010358|Ga0126370_10825715 | Not Available | 829 | Open in IMG/M |
| 3300010358|Ga0126370_12505392 | Not Available | 514 | Open in IMG/M |
| 3300010375|Ga0105239_12347779 | Not Available | 621 | Open in IMG/M |
| 3300010375|Ga0105239_12966374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 553 | Open in IMG/M |
| 3300010398|Ga0126383_12286711 | Not Available | 626 | Open in IMG/M |
| 3300010400|Ga0134122_10246611 | All Organisms → cellular organisms → Bacteria | 1506 | Open in IMG/M |
| 3300011119|Ga0105246_10631919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 929 | Open in IMG/M |
| 3300012201|Ga0137365_10196707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium | 1508 | Open in IMG/M |
| 3300012201|Ga0137365_10605505 | Not Available | 803 | Open in IMG/M |
| 3300012201|Ga0137365_11290894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium | 518 | Open in IMG/M |
| 3300012201|Ga0137365_11330779 | Not Available | 508 | Open in IMG/M |
| 3300012204|Ga0137374_10010646 | All Organisms → cellular organisms → Bacteria | 10818 | Open in IMG/M |
| 3300012204|Ga0137374_10055350 | All Organisms → cellular organisms → Bacteria | 4039 | Open in IMG/M |
| 3300012204|Ga0137374_10131257 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2280 | Open in IMG/M |
| 3300012204|Ga0137374_10466125 | Not Available | 988 | Open in IMG/M |
| 3300012212|Ga0150985_103161809 | Not Available | 611 | Open in IMG/M |
| 3300012350|Ga0137372_10791379 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300012353|Ga0137367_10118478 | All Organisms → cellular organisms → Bacteria | 1945 | Open in IMG/M |
| 3300012353|Ga0137367_10535243 | Not Available | 823 | Open in IMG/M |
| 3300012355|Ga0137369_10095738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2449 | Open in IMG/M |
| 3300012355|Ga0137369_10154343 | All Organisms → cellular organisms → Bacteria | 1819 | Open in IMG/M |
| 3300012355|Ga0137369_10228664 | All Organisms → cellular organisms → Bacteria | 1420 | Open in IMG/M |
| 3300012355|Ga0137369_10241370 | Not Available | 1372 | Open in IMG/M |
| 3300012355|Ga0137369_11136937 | Not Available | 507 | Open in IMG/M |
| 3300012356|Ga0137371_11066009 | Not Available | 609 | Open in IMG/M |
| 3300012358|Ga0137368_10160732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium HGW-Chloroflexi-10 | 1647 | Open in IMG/M |
| 3300012358|Ga0137368_10322064 | Not Available | 1038 | Open in IMG/M |
| 3300012358|Ga0137368_10479491 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300012360|Ga0137375_10555867 | Not Available | 965 | Open in IMG/M |
| 3300012532|Ga0137373_10037912 | All Organisms → cellular organisms → Bacteria | 4606 | Open in IMG/M |
| 3300012951|Ga0164300_10610927 | Not Available | 645 | Open in IMG/M |
| 3300013297|Ga0157378_10704747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1029 | Open in IMG/M |
| 3300013297|Ga0157378_11213116 | Not Available | 794 | Open in IMG/M |
| 3300013297|Ga0157378_13221037 | Not Available | 507 | Open in IMG/M |
| 3300013306|Ga0163162_11121005 | Not Available | 892 | Open in IMG/M |
| 3300014325|Ga0163163_12403377 | Not Available | 585 | Open in IMG/M |
| 3300014882|Ga0180069_1113835 | Not Available | 653 | Open in IMG/M |
| 3300015084|Ga0167654_1015267 | All Organisms → cellular organisms → Bacteria | 1275 | Open in IMG/M |
| 3300015371|Ga0132258_11786395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1550 | Open in IMG/M |
| 3300015371|Ga0132258_13107860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharothrix → Saccharothrix ecbatanensis | 1148 | Open in IMG/M |
| 3300015371|Ga0132258_13425280 | Not Available | 1088 | Open in IMG/M |
| 3300015372|Ga0132256_101975786 | Not Available | 690 | Open in IMG/M |
| 3300015374|Ga0132255_105392538 | Not Available | 541 | Open in IMG/M |
| 3300018056|Ga0184623_10299575 | Not Available | 727 | Open in IMG/M |
| 3300018465|Ga0190269_11682287 | Not Available | 534 | Open in IMG/M |
| 3300023201|Ga0256614_1079771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 799 | Open in IMG/M |
| 3300023211|Ga0255842_1340472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium | 1070 | Open in IMG/M |
| 3300025899|Ga0207642_11062344 | Not Available | 523 | Open in IMG/M |
| 3300025910|Ga0207684_11592872 | Not Available | 529 | Open in IMG/M |
| 3300025918|Ga0207662_10297347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1072 | Open in IMG/M |
| 3300025923|Ga0207681_11868518 | Not Available | 501 | Open in IMG/M |
| 3300025931|Ga0207644_10598144 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300025935|Ga0207709_10208862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Deinococcales → Deinococcaceae → Deinococcus | 1400 | Open in IMG/M |
| 3300025961|Ga0207712_11883585 | Not Available | 536 | Open in IMG/M |
| 3300026035|Ga0207703_10459417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1191 | Open in IMG/M |
| 3300026075|Ga0207708_11197013 | Not Available | 664 | Open in IMG/M |
| 3300026095|Ga0207676_10644642 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300026118|Ga0207675_100938935 | Not Available | 882 | Open in IMG/M |
| 3300027915|Ga0209069_10054927 | All Organisms → cellular organisms → Bacteria | 1876 | Open in IMG/M |
| 3300027915|Ga0209069_10498366 | Not Available | 685 | Open in IMG/M |
| 3300033551|Ga0247830_11037442 | Not Available | 654 | Open in IMG/M |
| 3300034172|Ga0334913_012271 | Not Available | 2010 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.80% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 9.40% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.55% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.27% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.42% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.42% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.56% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.71% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.71% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 1.71% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.85% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.85% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.85% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.85% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.85% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014882 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10D | Environmental | Open in IMG/M |
| 3300015084 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5a, rocky medial moraine) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300023201 | Activated sludge enriched bacterial communities from WWTP in Fort Collins, Colorado, USA ? PN | Engineered | Open in IMG/M |
| 3300023211 | Activated sludge enriched bacterial communities from WWTP in Fort Collins, Colorado, USA ? CA | Engineered | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| soilH2_100332906 | 3300003324 | Sugarcane Root And Bulk Soil | MYYIVEITPYGTETFLAGFEESGEAWDAVSRLRCEARRLRRKVRYEVR* |
| soilH2_101279881 | 3300003324 | Sugarcane Root And Bulk Soil | MYYIVEITPQGIETFLEGFEDVGEAWDTVSRLQCEARRRRRRVRYEVR* |
| Ga0070671_1012595671 | 3300005355 | Switchgrass Rhizosphere | MYYIVEITSQGIETFLAGFEDIGAAWDVVSGLRCEARRQRRKVRYEVR* |
| Ga0070688_1007925141 | 3300005365 | Switchgrass Rhizosphere | MYYIVEISPQGIETFLEGFEEVGEAWDVLSRLRCEARRRRCKVRYEVR* |
| Ga0070688_1012584521 | 3300005365 | Switchgrass Rhizosphere | MYYIVEITSQGIETFLEGFEDIGAAWDVASGLRCEARRQRRKVRYEVR* |
| Ga0070685_100372753 | 3300005466 | Switchgrass Rhizosphere | MYYVVDITPRGSETFLAGFEDIGEVWDGVSRLRYEAQRRRRKVRYEVR* |
| Ga0070698_1020481971 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | SAAMYFIVEITPQGIETFLEGFEEVGEAWDVLSRLRCEARRRRCKVRYEVR* |
| Ga0070699_1003449001 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | YIVEITPRGIETFLEGFEDIGEAWDIVSRLQCEAQRRRRKVRYEVR* |
| Ga0070741_100928155 | 3300005529 | Surface Soil | MYFIVEITPQRIETFLEGFEDTSEAWDAVSRLQCEARRRRRRVRYEVR* |
| Ga0070741_104664682 | 3300005529 | Surface Soil | MYFIVEITPRGAETFLGGFEHLADAWDAASRLRCEARRLHSRLRYEVR* |
| Ga0070741_113450901 | 3300005529 | Surface Soil | QEASMYFIVEITPRGTETFLAGFEDLSEAWETASRLRCEARRLRSRLRYEVR* |
| Ga0068859_1001719432 | 3300005617 | Switchgrass Rhizosphere | MSGAPLYYVVEITPRGSETFLAGFEDIGEVWDGVSRLRYEAQRRRRKVRYEVR* |
| Ga0068866_102365141 | 3300005718 | Miscanthus Rhizosphere | MYYIVEITPRGSETFLEGFEEIGEAWDVVSRLLCEARRQRRKVRYEVR* |
| Ga0068861_1006098062 | 3300005719 | Switchgrass Rhizosphere | MYYIVEITPQGIETFLEGFEEVGEAWDVLSRLRCEARRRRCKVRYEVR* |
| Ga0075023_1002116651 | 3300006041 | Watersheds | MYYIVEITSQGIETFLEGFEEVGAAWDVVSRLRCEARRWRRKVRYEVR* |
| Ga0075024_1008522462 | 3300006047 | Watersheds | AAMYYIVEITPQGSETFLEGFEDAGAAWDIVSRLQCEAQRRRRNVRYEVR* |
| Ga0075026_1000183585 | 3300006057 | Watersheds | MYYIVEITPQGVETFLEGFEEVGEAWDVVSRLQCEARRRRRKVRYEVR* |
| Ga0075026_1001357571 | 3300006057 | Watersheds | MYYIVEITPQGSETFLEGFEDAGAAWDIVSRLQCEARRRRRKVRYEVR* |
| Ga0075026_1003076592 | 3300006057 | Watersheds | IVEITSRGSETFLEGFEDIGEAWDVVSRLQCEAQRRHRKVRYEVR* |
| Ga0097621_1003633011 | 3300006237 | Miscanthus Rhizosphere | MYSIVEITPQGIEIFLEGFEEVGEAWDVLSRLRCEARRRRCKVRYEVR* |
| Ga0079222_100748351 | 3300006755 | Agricultural Soil | MYYIVEITAQGIETFLEGFEEVGEAWDAVFRLRCEARRVRRKVRYEVR* |
| Ga0079222_114699392 | 3300006755 | Agricultural Soil | MYYIVEITPQGIETFLEGFEEVGEAWDVVSRLQCEAQRRRRKVRYEVR* |
| Ga0066653_102850962 | 3300006791 | Soil | MYYIVEITPRGIETFLEGFEDIGDAWDVVSRLQCEARRRRRTVRYEVR* |
| Ga0075428_1012303482 | 3300006844 | Populus Rhizosphere | LYYIVEITPQGIETFLEGFEEVGEAWDVVSRLQCEARRRRRKVRYEVR* |
| Ga0075433_114839631 | 3300006852 | Populus Rhizosphere | MYYIVEITPQGIETFLEGFEEVGEAWDVLSRLQCEARRLRRKVRYEVR* |
| Ga0075425_1017968001 | 3300006854 | Populus Rhizosphere | MYYIVEITSQGIETFLEGFEEVGEAWDVLSRLQCEARRRRRRVRYEVR* |
| Ga0075434_1016148681 | 3300006871 | Populus Rhizosphere | MYFIVEITPQGIETFLEGFDEVGEAWDVLSRLQCEARRRRRKVRYEVR* |
| Ga0079217_113590491 | 3300006876 | Agricultural Soil | MYFIVEITPNGTERFLAGFEDSSEAWDVASSLRCEAERRRRKVRYDVR* |
| Ga0066710_1045164341 | 3300009012 | Grasslands Soil | MYFIVEIQPNGTETFLEGFEDSSEAWDVASRLQCLARRRRRKVRYEVR |
| Ga0111539_133333801 | 3300009094 | Populus Rhizosphere | QEGSMYFIVEITSQGIETFLAGFEDIGAAWDVVSGLRCEARRQRRKVRYEVR* |
| Ga0075418_126740651 | 3300009100 | Populus Rhizosphere | MYFIVEITPQGIETFLEGFEEVGEAWDVVSRLQCEARRIRRKVRYEVR* |
| Ga0105247_103878941 | 3300009101 | Switchgrass Rhizosphere | MYSIVEMTPRGTETFLEGFEDIGEAWDVVSRLRCEARRRRQKVRYEVR* |
| Ga0066709_1040524121 | 3300009137 | Grasslands Soil | MYSIVEITPRGSETFLEGFADIGAAWDVVSRLRCEAQRRRRKVRYEVR* |
| Ga0114129_110722872 | 3300009147 | Populus Rhizosphere | MYSIVEITSQGIETFLAGFEDIGAAWDVVSNLQCEARRQRRKVRYEVR* |
| Ga0105243_108728571 | 3300009148 | Miscanthus Rhizosphere | QGIETFLAGFEDIGAAWDVVSGLQCEARRQRRKVRYEVR* |
| Ga0105243_108958751 | 3300009148 | Miscanthus Rhizosphere | MYSIVEITPQGIEIFLEGFEEVGEAWDVLSRLQCEAQRQRRKVRYEVR* |
| Ga0075423_114606011 | 3300009162 | Populus Rhizosphere | MYYIVEIRPNGSETFLEGFEEFDEAWNVLSHLQCEAQRQRRRVRYEVR* |
| Ga0075423_118742451 | 3300009162 | Populus Rhizosphere | MYFIVEIQQSGTETFLEGFEDSSEAWDVASRLQCVARRRKKKVRYKVR* |
| Ga0075423_121283191 | 3300009162 | Populus Rhizosphere | MYFIVEIQPNGTETFLDGFENLSDAWDVVSRLQCEARRRRRKVRYEVR* |
| Ga0105248_105718941 | 3300009177 | Switchgrass Rhizosphere | SSMRGAPMYYVVDITPRGSETFLAGFEDIGEVWDGVSRLRYEAQRRRRKVRYEVR* |
| Ga0105237_105281272 | 3300009545 | Corn Rhizosphere | MYSIVEITPQGIETFLEGFEEVGEAWDVLSRLKCEARRRRCKVRYEVR* |
| Ga0105237_119596541 | 3300009545 | Corn Rhizosphere | MYYIVEITSRGSETFLEGFEDIGEAWDVVSRLQCEARRRRQKVRYEVR* |
| Ga0105249_128924431 | 3300009553 | Switchgrass Rhizosphere | MYYIVEITPQGIETFLEGFEEVGEAWDVVSRLQCEAWRRRRRVRYEVR* |
| Ga0126313_112924041 | 3300009840 | Serpentine Soil | MYFIVEITSQGIETFLEGFEDIGDAWDVVSGLQCEARRQRRKVRYEVR* |
| Ga0126305_105020181 | 3300010036 | Serpentine Soil | MYYIVEITSQGIETFLAGFEDIGAAWDVVSGLQCEARRQRRKVRYEVR* |
| Ga0126309_102365561 | 3300010039 | Serpentine Soil | MYFVIEIQPNGAETFLEGFEDSSDAWDVASSLRCEAQRRRRKVRYEVR* |
| Ga0126309_109546362 | 3300010039 | Serpentine Soil | MYYIVEITSQGIETFLEGFEDIGAAWDVVSGLQCEARRQRRKVRYEVR* |
| Ga0126308_109562172 | 3300010040 | Serpentine Soil | YYIVEITPRGTETFLEGFEDIGEAWDVVSRLRCEALRRRWKVRYEVR* |
| Ga0126308_110051921 | 3300010040 | Serpentine Soil | MYYIVEITAQGIETFLEGFEEVGEAWDVASRLRCEAQWRRRKVRYEVR* |
| Ga0126312_109083992 | 3300010041 | Serpentine Soil | MYYIVEITPNGTETFLEGFEEFSEAWDVLSRLQCEAQRQRRKVRYEVR* |
| Ga0126311_100344053 | 3300010045 | Serpentine Soil | MYYIVEITSRGIETFLEGFEDIGEAWDIVSRLQCEAQRRRRKVRYEVR* |
| Ga0126311_115268981 | 3300010045 | Serpentine Soil | MYYIVEITSQGIETFLAGFEDIGAAWDVVSGLRCEARRQHRKVRYEVR* |
| Ga0126306_105109072 | 3300010166 | Serpentine Soil | MYYIVEITSQGIETFLVGFEDIGAAWDVVSGLQCEARRQRRKVRYEVR* |
| Ga0126306_113342211 | 3300010166 | Serpentine Soil | RGTETFLEGFEDIGEAWNVVSRLRCEAQRRRRKVRYEVR* |
| Ga0134071_107865981 | 3300010336 | Grasslands Soil | MYFIVEIQPNGTETFLEGFEDSSEAWDVASRLQSVARRRRRKVRYEVR* |
| Ga0126370_108257151 | 3300010358 | Tropical Forest Soil | MYYIVEIRPNRSETFLEGFEEFNEAWDVLSRLRCEAQRQRRKVRYEVR* |
| Ga0126370_125053922 | 3300010358 | Tropical Forest Soil | MYFIVEITPQGIETFLEGFEEVGEAWDVLSRLQCEARRRRRKVRYEVR* |
| Ga0105239_123477791 | 3300010375 | Corn Rhizosphere | MYFIVEITPRGAETFLGGFEELSEAWEIASRLRCEAHRQHNRLRYKVR* |
| Ga0105239_129663742 | 3300010375 | Corn Rhizosphere | MYYIVEISPQGIETFLEGFEKVGEAWDTLSCLRCESRRRCRKVRYEVR* |
| Ga0126383_122867111 | 3300010398 | Tropical Forest Soil | MYFIVEITPQGIETFLEGFEEVGEAWDVISRLRCEARRVRRKVRYEVR* |
| Ga0134122_102466114 | 3300010400 | Terrestrial Soil | MFFIVEIQPNGTERFLDGFEDQGDAWDVVSRLQCAAQRQRRRVRYEVR* |
| Ga0105246_106319191 | 3300011119 | Miscanthus Rhizosphere | MYSIVEITPQGSETFLEGFEDIGEAWDVVSRLRCKARRRRRKVRYEVR* |
| Ga0137365_101967072 | 3300012201 | Vadose Zone Soil | MYYIVEITPQGIETFLEGFEEVGEAWDVLSRLQCEARRMRRKVRY* |
| Ga0137365_106055052 | 3300012201 | Vadose Zone Soil | MYFIVDIRPNGTESFLESSQDSGEAWDLVSRLQCDAQRRRWKVRYEVR* |
| Ga0137365_112908941 | 3300012201 | Vadose Zone Soil | MYYIVEITPQGIETFLEGFEEVGEAWDVVSRLQCEARRVRRKVRYEVR* |
| Ga0137365_113307791 | 3300012201 | Vadose Zone Soil | MYYIVEIRPNGSETFLEGFEEFSEAWDVLSRLQCEAQRQRRKVRYE |
| Ga0137374_1001064614 | 3300012204 | Vadose Zone Soil | MYYIVEITPQGIETFLEGFEEVGEAWDVVSRLQCEAQRRRRNVRYEVR* |
| Ga0137374_100553502 | 3300012204 | Vadose Zone Soil | MGEKPPVPVEIRPNGIETFLAGFEEFEEAWDVLSRLQCEARRQRRKVRYEVR* |
| Ga0137374_101312573 | 3300012204 | Vadose Zone Soil | MYYIVEIRPNGAETFLEGFEEFSEAWDVLSRLQCEAQRQRRKVRYEVR* |
| Ga0137374_104661251 | 3300012204 | Vadose Zone Soil | MYYIIEITSRGSETFLEGFEDIGEAWDIVSRLQCEAQRRRRKVRYEVR* |
| Ga0150985_1031618091 | 3300012212 | Avena Fatua Rhizosphere | MYYVVEITPRGSETFLAGFEDIGEVWDGVSRLRCEAQRRRRKVRYEVR* |
| Ga0137372_107913791 | 3300012350 | Vadose Zone Soil | ITPRGTVTFLEGFEDIGDAWDVVSRLQCEAQRWRRKVRYEVR* |
| Ga0137367_101184782 | 3300012353 | Vadose Zone Soil | MGEKPPVPVEIRPNGIETFLAGFEAFEKAWDVLSRLQCEARRQRRKVRYEVR* |
| Ga0137367_105352431 | 3300012353 | Vadose Zone Soil | MYYIVEITPRGIEIFLERFEYIGEAWDVVSRLRCEARRRRRKVRYEVR* |
| Ga0137369_100957383 | 3300012355 | Vadose Zone Soil | MYYIVEITSRGSETFLEGFEDIGEAWDIVSRLQCEAQRRRRKVHYEVR* |
| Ga0137369_101543432 | 3300012355 | Vadose Zone Soil | MGEKPPVPVEIRLNGIETFLEGFEEFEEAWDVLSRLQCEARRQRRKVRYEVR* |
| Ga0137369_102286642 | 3300012355 | Vadose Zone Soil | MYYIVEITPQGIETFLDGFEDIGDAWDVVSRLQCEAQRWRRKVRYEVR* |
| Ga0137369_102413702 | 3300012355 | Vadose Zone Soil | MYYIVEITPRGTETFLEGFEDIGDAWDVVSRLQCEARRRRWKVRYEVR* |
| Ga0137369_111369371 | 3300012355 | Vadose Zone Soil | MYFIVEIQPNGTETFLEGFEDSSEAWDVAFRLQCMARRRRRKVRYEVR* |
| Ga0137371_110660091 | 3300012356 | Vadose Zone Soil | MYYIVEIRPNGTETFLEGFEEFNEAWDVLSRLQCEAQRQRRKIRYEVR* |
| Ga0137368_101607321 | 3300012358 | Vadose Zone Soil | MYYIVEMRPNGAETFLEEFSEAWDVLSRLQCEAQRQRRKVRYEVR* |
| Ga0137368_103220642 | 3300012358 | Vadose Zone Soil | MYFIVEIQPNGTETFLEGFEDSSEAWDVAFRLQRMARRRRRKVRYEVR* |
| Ga0137368_104794911 | 3300012358 | Vadose Zone Soil | YIVEITPQGIETFLDGFEDIGDAWDVVSRLQCEAQRWRRKVRYEVR* |
| Ga0137375_105558671 | 3300012360 | Vadose Zone Soil | MYFIVEIQPNGTETFLEGFEDSSEAWDVASRLQCMARRRRRKVRYEVR* |
| Ga0137373_100379124 | 3300012532 | Vadose Zone Soil | MYYIVEIRPNGAETFLEGFEEFSEAWDVLSRLQCEAQRQRRKVRYDVR* |
| Ga0164300_106109272 | 3300012951 | Soil | MYYIVEITPRGSETFLEGFEDIGEAWDVVSRLQCEARRQRRKVRYEVR* |
| Ga0157378_107047473 | 3300013297 | Miscanthus Rhizosphere | MYSIVEITPQGIETFLEGFEEVGEAWDTVSRLQCAARRRRRKVRYEVR* |
| Ga0157378_112131162 | 3300013297 | Miscanthus Rhizosphere | MYHIVEITPQGIETFLEGFEEVGEAWDVLSRLRCEARRRRCKVRYEVR* |
| Ga0157378_132210371 | 3300013297 | Miscanthus Rhizosphere | MYFIVEITSQGIETFLAGFEDIGEAWDVVSRLQCEARRQRRKVRYEV |
| Ga0163162_111210051 | 3300013306 | Switchgrass Rhizosphere | MYYIVEITPRGSETFLEGFEEIGEAWDVVSRLQCEARRRRRKIRYEVR |
| Ga0163163_124033771 | 3300014325 | Switchgrass Rhizosphere | MYYVVDITPRGSETFLAGFEDIGEAWDIVSHLQCEAQRRRR |
| Ga0180069_11138352 | 3300014882 | Soil | MYFIVEITPRGAETFLEGFEDIGEAWDVVSRLQCEARRRRRKVRYEVR* |
| Ga0167654_10152671 | 3300015084 | Glacier Forefield Soil | MYYIVEITQQGIETFLEGFEEVGEAWDVVSRLQCEARRRRRKVRYEVR* |
| Ga0132258_117863952 | 3300015371 | Arabidopsis Rhizosphere | MYYIIEITPQGNETFLEGFEEVGEAWDTVSRLRCEAQRRRRRVRYEVR* |
| Ga0132258_131078601 | 3300015371 | Arabidopsis Rhizosphere | MYFIVEITPQGIETFLDGFEEVGEAWDVVSRLQCEARRRRRKVRYEVR* |
| Ga0132258_134252801 | 3300015371 | Arabidopsis Rhizosphere | MYYIVEITPRGIETFLEGFEDSGEAWDVVSRLQCEARRRRQKVRYEVR* |
| Ga0132256_1019757861 | 3300015372 | Arabidopsis Rhizosphere | MYYIVEITPRGIETFLEGFEDIGEAWDVVSRLQCEARRRRRKVRYEVR* |
| Ga0132255_1053925381 | 3300015374 | Arabidopsis Rhizosphere | MYFIVEITSQGIETFLAGFEDIGEAWDVVSGLRCEARRQRRKVRYEVR* |
| Ga0184623_102995751 | 3300018056 | Groundwater Sediment | MYYIVEITSRGSETFLEGFEDIGEAWDVVSRLQCEARRQRRRVRYEVR |
| Ga0190269_116822871 | 3300018465 | Soil | MYYIVEITPRGSETFLEGFEDIGEAWDVVSRLQCEARRQRRRVRYEVR |
| Ga0256614_10797711 | 3300023201 | Activated Sludge | MYYIVEITAQGIETFLEGFEDVGEAWDTVSRLRCEARRQRRNVRYEVR |
| Ga0255842_13404722 | 3300023211 | Activated Sludge | MYFIVEITPQGIETFLEGFEEVGEAWDVVSRLLCEARRRRRKVRYEVC |
| Ga0207642_110623441 | 3300025899 | Miscanthus Rhizosphere | MYYIVEITPRGSETFLEGFEEIGEAWDVVSRLLCEARRQRRKVRYEVR |
| Ga0207684_115928722 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTREAVKYFIIEIKPNGTEIFIEGFEEFDEAWDVLSRLQCEAQRQRRKVRYEVR |
| Ga0207662_102973472 | 3300025918 | Switchgrass Rhizosphere | MYYVVDITPRGSETFLAGFEDIGEVWDGVSRLRYEAQRRRRKVRYEVR |
| Ga0207681_118685181 | 3300025923 | Switchgrass Rhizosphere | DRSAAMYYIVEITPQGIETFLEGFEEVGEAWDVVSRLQCEAWRRRRRVRYEVR |
| Ga0207644_105981442 | 3300025931 | Switchgrass Rhizosphere | MYYIVEITSQGIETFLAGFEDIGAAWDVVSGLRCEARRQRRKVRYEVR |
| Ga0207709_102088621 | 3300025935 | Miscanthus Rhizosphere | ASMYYIVEITPRGSETFLEGFEEIGEAWDVVSRLLCEARRQRRKVRYEVR |
| Ga0207712_118835851 | 3300025961 | Switchgrass Rhizosphere | MYYIVEITPQGIETFLEGFEEVGEAWDVVSRLQCEAWRRRRRVRYEVR |
| Ga0207703_104594172 | 3300026035 | Switchgrass Rhizosphere | MYYIVEITPQGIETFLEGFEEVGAAWDVVSRLQCEARRRRRKVRYEVR |
| Ga0207708_111970132 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MYYIIEITPRGSETFLEGFEEIGEAWDVVSRLQCEARRRRQKVRYEVR |
| Ga0207676_106446421 | 3300026095 | Switchgrass Rhizosphere | RPNGIETFLEGFEEFSEAWDVLSRLQCEAQRQRRKVRYEVR |
| Ga0207675_1009389352 | 3300026118 | Switchgrass Rhizosphere | MYYIVEITPQGIEIFLEGFEEVGEAWDVLSRLRCEARRRRCKVRYEVR |
| Ga0209069_100549272 | 3300027915 | Watersheds | MYYIVEITSQGIETFLEGFEEVGAAWDVVSRLRCEARRWRRKVRYEVR |
| Ga0209069_104983661 | 3300027915 | Watersheds | MYFIVEMTPRGAETFLGGFEDLAEAWEAVSRLRCEARRRRSKLRYDVR |
| Ga0247830_110374421 | 3300033551 | Soil | MYYIVEITSQGIETFLAGFEDIGEAWDVVSGLQCEARGMRRRVRYEVR |
| Ga0334913_012271_1573_1719 | 3300034172 | Sub-Biocrust Soil | MYFIIEIQPNGTETFLEGFEDESEAWDVASRLQCVARRRRRKVRYEVR |
| ⦗Top⦘ |