


| Basic Information | |
|---|---|
| Family ID | F077203 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MTSANDPVLAVAVRAARRAASVIADASRDLRRLPTFSKEHGDI |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 75.86 % |
| % of genes near scaffold ends (potentially truncated) | 99.15 % |
| % of genes from short scaffolds (< 2000 bps) | 94.87 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.598 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (8.547 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.735 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (31.624 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.30% β-sheet: 0.00% Coil/Unstructured: 50.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF00753 | Lactamase_B | 48.72 |
| PF07731 | Cu-oxidase_2 | 25.64 |
| PF07992 | Pyr_redox_2 | 7.69 |
| PF00593 | TonB_dep_Rec | 2.56 |
| PF07732 | Cu-oxidase_3 | 2.56 |
| PF01799 | Fer2_2 | 1.71 |
| PF00111 | Fer2 | 0.85 |
| PF00563 | EAL | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 28.21 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.85 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.85 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.85 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.60 % |
| Unclassified | root | N/A | 9.40 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000550|F24TB_11847566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 797 | Open in IMG/M |
| 3300004479|Ga0062595_100673090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 824 | Open in IMG/M |
| 3300005330|Ga0070690_100586241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 845 | Open in IMG/M |
| 3300005333|Ga0070677_10622802 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 600 | Open in IMG/M |
| 3300005353|Ga0070669_100340744 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1215 | Open in IMG/M |
| 3300005353|Ga0070669_100410554 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1110 | Open in IMG/M |
| 3300005354|Ga0070675_100064049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3039 | Open in IMG/M |
| 3300005356|Ga0070674_102040456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300005459|Ga0068867_100487980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1057 | Open in IMG/M |
| 3300005543|Ga0070672_100014798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5535 | Open in IMG/M |
| 3300005543|Ga0070672_100853086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 803 | Open in IMG/M |
| 3300005560|Ga0066670_10067941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1906 | Open in IMG/M |
| 3300005617|Ga0068859_102148641 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300005618|Ga0068864_102393947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 534 | Open in IMG/M |
| 3300005718|Ga0068866_11127132 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
| 3300005719|Ga0068861_101339176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 697 | Open in IMG/M |
| 3300005719|Ga0068861_101480896 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 665 | Open in IMG/M |
| 3300005842|Ga0068858_102353262 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300005843|Ga0068860_102797528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 506 | Open in IMG/M |
| 3300006056|Ga0075163_11549175 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 641 | Open in IMG/M |
| 3300006642|Ga0075521_10549730 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 567 | Open in IMG/M |
| 3300006797|Ga0066659_10588591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 902 | Open in IMG/M |
| 3300006797|Ga0066659_10654141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 856 | Open in IMG/M |
| 3300006844|Ga0075428_101467686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 715 | Open in IMG/M |
| 3300006918|Ga0079216_10519111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 793 | Open in IMG/M |
| 3300006953|Ga0074063_12808309 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 632 | Open in IMG/M |
| 3300009011|Ga0105251_10355875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis | 669 | Open in IMG/M |
| 3300009091|Ga0102851_10349455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1468 | Open in IMG/M |
| 3300009137|Ga0066709_100515622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1686 | Open in IMG/M |
| 3300009177|Ga0105248_10124000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2914 | Open in IMG/M |
| 3300009177|Ga0105248_11761264 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 702 | Open in IMG/M |
| 3300009179|Ga0115028_11087013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 650 | Open in IMG/M |
| 3300009540|Ga0073899_10557341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 836 | Open in IMG/M |
| 3300009678|Ga0105252_10442958 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 597 | Open in IMG/M |
| 3300009687|Ga0116144_10339163 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 763 | Open in IMG/M |
| 3300009870|Ga0131092_11491601 | Not Available | 513 | Open in IMG/M |
| 3300010303|Ga0134082_10164968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 899 | Open in IMG/M |
| 3300010304|Ga0134088_10544773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300010337|Ga0134062_10451474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 638 | Open in IMG/M |
| 3300010343|Ga0074044_11172422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300010401|Ga0134121_10483637 | Not Available | 1137 | Open in IMG/M |
| 3300010403|Ga0134123_11251258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 775 | Open in IMG/M |
| 3300011432|Ga0137428_1170440 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 646 | Open in IMG/M |
| 3300012045|Ga0136623_10478691 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 525 | Open in IMG/M |
| 3300012187|Ga0136622_10153826 | Not Available | 972 | Open in IMG/M |
| 3300012207|Ga0137381_11434890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 582 | Open in IMG/M |
| 3300012285|Ga0137370_10891819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 550 | Open in IMG/M |
| 3300012680|Ga0136612_10295424 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 823 | Open in IMG/M |
| 3300012898|Ga0157293_10232299 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 574 | Open in IMG/M |
| 3300012922|Ga0137394_11563782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300012958|Ga0164299_10488369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 816 | Open in IMG/M |
| 3300012971|Ga0126369_12983925 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 554 | Open in IMG/M |
| 3300013306|Ga0163162_11771465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 706 | Open in IMG/M |
| 3300014312|Ga0075345_1156346 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
| 3300014323|Ga0075356_1066054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 814 | Open in IMG/M |
| 3300014745|Ga0157377_11429507 | Not Available | 547 | Open in IMG/M |
| 3300014969|Ga0157376_11492378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 709 | Open in IMG/M |
| 3300015374|Ga0132255_103199265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 698 | Open in IMG/M |
| 3300016294|Ga0182041_10326610 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
| 3300017973|Ga0187780_10795739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 684 | Open in IMG/M |
| 3300018084|Ga0184629_10632065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300018469|Ga0190270_13326019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium ADurb.Bin100 | 510 | Open in IMG/M |
| 3300018481|Ga0190271_10241798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1831 | Open in IMG/M |
| 3300018482|Ga0066669_10186653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1571 | Open in IMG/M |
| 3300019878|Ga0193715_1069320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 742 | Open in IMG/M |
| 3300025909|Ga0207705_10639319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 827 | Open in IMG/M |
| 3300025939|Ga0207665_11675782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 503 | Open in IMG/M |
| 3300025986|Ga0207658_10891750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 809 | Open in IMG/M |
| 3300026023|Ga0207677_11646586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 594 | Open in IMG/M |
| 3300026035|Ga0207703_11312119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 696 | Open in IMG/M |
| 3300026059|Ga0208540_1027971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 638 | Open in IMG/M |
| 3300026088|Ga0207641_10271923 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1590 | Open in IMG/M |
| 3300026088|Ga0207641_10714369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 988 | Open in IMG/M |
| 3300026334|Ga0209377_1103728 | Not Available | 1174 | Open in IMG/M |
| 3300026547|Ga0209156_10434745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300027823|Ga0209490_10528651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 639 | Open in IMG/M |
| 3300027877|Ga0209293_10088075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1378 | Open in IMG/M |
| 3300027877|Ga0209293_10689226 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 541 | Open in IMG/M |
| 3300027902|Ga0209048_10152361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1723 | Open in IMG/M |
| 3300028587|Ga0247828_10710756 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 627 | Open in IMG/M |
| 3300028792|Ga0307504_10136382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 820 | Open in IMG/M |
| 3300029984|Ga0311332_11434736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300029990|Ga0311336_10543195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 988 | Open in IMG/M |
| 3300030000|Ga0311337_10171755 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1768 | Open in IMG/M |
| 3300030002|Ga0311350_10035402 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4354 | Open in IMG/M |
| 3300030114|Ga0311333_10282153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1316 | Open in IMG/M |
| 3300030294|Ga0311349_10441442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1231 | Open in IMG/M |
| 3300030491|Ga0302211_10234788 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
| 3300031547|Ga0310887_10212032 | Not Available | 1060 | Open in IMG/M |
| 3300031682|Ga0318560_10496133 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 661 | Open in IMG/M |
| 3300031726|Ga0302321_100164445 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2292 | Open in IMG/M |
| 3300031792|Ga0318529_10370789 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 666 | Open in IMG/M |
| 3300031846|Ga0318512_10620990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300031873|Ga0315297_11008527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 688 | Open in IMG/M |
| 3300031912|Ga0306921_10938924 | Not Available | 980 | Open in IMG/M |
| 3300031918|Ga0311367_10751092 | Not Available | 989 | Open in IMG/M |
| 3300031938|Ga0308175_102961299 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
| 3300031939|Ga0308174_11740147 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 536 | Open in IMG/M |
| 3300032005|Ga0307411_10334602 | Not Available | 1228 | Open in IMG/M |
| 3300032009|Ga0318563_10675392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 555 | Open in IMG/M |
| 3300032055|Ga0318575_10355644 | Not Available | 742 | Open in IMG/M |
| 3300032180|Ga0307471_100508122 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300032180|Ga0307471_101218242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 917 | Open in IMG/M |
| 3300032276|Ga0316188_10320939 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 802 | Open in IMG/M |
| 3300032516|Ga0315273_11952480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 699 | Open in IMG/M |
| 3300033408|Ga0316605_12401129 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
| 3300033414|Ga0316619_10691549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 859 | Open in IMG/M |
| 3300033418|Ga0316625_101054749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 729 | Open in IMG/M |
| 3300033418|Ga0316625_101475153 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 642 | Open in IMG/M |
| 3300033419|Ga0316601_101030141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 822 | Open in IMG/M |
| 3300033482|Ga0316627_102055366 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 594 | Open in IMG/M |
| 3300033487|Ga0316630_11052599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 714 | Open in IMG/M |
| 3300033513|Ga0316628_102609136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 666 | Open in IMG/M |
| 3300033521|Ga0316616_102079139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 754 | Open in IMG/M |
| 3300033521|Ga0316616_103571826 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300034354|Ga0364943_0454529 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 8.55% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 7.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.27% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 4.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.42% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 2.56% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 2.56% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.56% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.56% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.71% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.71% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.71% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.71% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.85% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.85% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.85% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.85% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.85% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.85% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.85% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.85% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.85% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.85% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.85% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.85% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.85% |
| Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006056 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNA | Engineered | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009540 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Ph | Engineered | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009687 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG | Engineered | Open in IMG/M |
| 3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011432 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2 | Environmental | Open in IMG/M |
| 3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
| 3300012187 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ448 (21.06) | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012680 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06) | Environmental | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014312 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1 | Environmental | Open in IMG/M |
| 3300014323 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026059 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027823 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-06 (SPAdes) | Environmental | Open in IMG/M |
| 3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030491 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_3 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032276 | Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F24TB_118475662 | 3300000550 | Soil | MSAAASDDSMLIIAARAARTAGSIVLDAARDLKRLPAFSKEHAEI |
| Ga0062595_1006730902 | 3300004479 | Soil | MNQASDPVLAVAVRAARTAASIVVDAARDLKRLPTFSKEQAGIVS |
| Ga0070690_1005862412 | 3300005330 | Switchgrass Rhizosphere | MSAAAPTASDHVLAVAVRAARRAASVIIDASRDLRRLPTFSKE |
| Ga0070677_106228022 | 3300005333 | Miscanthus Rhizosphere | MTIDPVLAVAIRAAHRASSVILDAARDLRRRPAHAKDHGNIAA |
| Ga0070669_1003407441 | 3300005353 | Switchgrass Rhizosphere | MSDVPMIGDPVLAVAVRAARRAASVVVDAARDLKRLPTFSK |
| Ga0070669_1004105541 | 3300005353 | Switchgrass Rhizosphere | MSAGDDSVLSVAIQAARSAAAVITDAARDLVRLPTFSKDHGDIVSTADVEAEDAIVATLR |
| Ga0070675_1000640491 | 3300005354 | Miscanthus Rhizosphere | MSAGDDSVLSVAIQAARSAAAVITDAARDLVRLPTFSKDHGDIV |
| Ga0070674_1020404561 | 3300005356 | Miscanthus Rhizosphere | MSAGDDSVLSVAIQAARSAAAVITDAARDLVRLPTFSKDHGDIVS |
| Ga0068867_1004879802 | 3300005459 | Miscanthus Rhizosphere | MSGSMDAMLAVAVRAARTAGSIVVDASRDLRRLPAFSKEHARVA |
| Ga0070672_1000147985 | 3300005543 | Miscanthus Rhizosphere | MSAAAPTASDHVLAVAVRAARRAASVIIDASRDLRRL |
| Ga0070672_1008530861 | 3300005543 | Miscanthus Rhizosphere | MPDVPMIGDPVLAVAVRAARRAASVVVDAARDLKRLPTFS |
| Ga0066670_100679412 | 3300005560 | Soil | MSDPALAVAVRAARNAAAVISDAAHDLKRLPTFSKERGEIVSAA |
| Ga0068859_1021486411 | 3300005617 | Switchgrass Rhizosphere | MSPSGAGGVDSMLAIAARAARTAGSIVLDAARDLKRLPAFSKEH |
| Ga0068864_1023939473 | 3300005618 | Switchgrass Rhizosphere | MNTGDDSVLAVAIQAARSAAAVLTDAARDLVRLPTFSKDHGDIVSTADVEAEDAIVA |
| Ga0068866_111271321 | 3300005718 | Miscanthus Rhizosphere | MSAGDDSVLSVAIQAARSAAAVITDAARDLVRLPTFSKDHGDIVSTAD |
| Ga0068861_1013391762 | 3300005719 | Switchgrass Rhizosphere | MTSANDPVLAVAVRAARRAASVIADASRDLRRLPTFSKEHGDI |
| Ga0068861_1014808961 | 3300005719 | Switchgrass Rhizosphere | MSLGNDPVLAVATRAARTAASILVDATRDLRRLPAFS |
| Ga0068858_1023532621 | 3300005842 | Switchgrass Rhizosphere | MSPSGAGGVDSMLAIAARAARTAGSIVLDAARDLKRLPAFSKEHAEIV |
| Ga0068860_1027975281 | 3300005843 | Switchgrass Rhizosphere | VNTSSDPVLAVAVRAARRAASVIVDASRDLRRLPTFSKEHGDIVSAAD |
| Ga0075163_115491752 | 3300006056 | Wastewater Effluent | MTNDPVLAVAVRAARSAASILTDAARDLKRLPTFSKEHGDIVSGAD |
| Ga0075521_105497302 | 3300006642 | Arctic Peat Soil | MSMTDDPVLAVAVRAARTAASVVADAARDLKRLPSFSK |
| Ga0066659_105885912 | 3300006797 | Soil | MNDPALAVAVRAARNAAAVISDAAHDLKRLPTFSKERGEIVSAAA |
| Ga0066659_106541411 | 3300006797 | Soil | MFMIATMNATSDPILAVAVRAARRAASVIIDASRD |
| Ga0075428_1014676862 | 3300006844 | Populus Rhizosphere | MADAPMVTDPVLAVAVRAARRAAAVIIDAARDLKRLPTFSKEHGDIVS |
| Ga0079216_105191111 | 3300006918 | Agricultural Soil | VNAPGDAVLAVAVRAARRAAAVIGDASRDLKRLPTYSKEAGEIVVMADKEAE |
| Ga0074063_128083091 | 3300006953 | Soil | MPAASDPVLAVAMRAARSAASVVADAARDLKRLPTFSKEHGDIV |
| Ga0105251_103558751 | 3300009011 | Switchgrass Rhizosphere | MQNDPVLAVAVHAARRAAAVLVDAGRDLKRRPMHAKDH |
| Ga0102851_103494552 | 3300009091 | Freshwater Wetlands | MAHDPVLAVAVRAARRAAAVITDAARDLKRLPSHAKQHGDLIANAGVEA |
| Ga0066709_1005156221 | 3300009137 | Grasslands Soil | MSDPSLAVAVRAARNAAAVIDDAAHDLKRLPAFSKEHGEIASTADAEA |
| Ga0105248_101240001 | 3300009177 | Switchgrass Rhizosphere | MSAGDDSVLSVAIQAARSAAAVITDAARDLVRLPTFSKDH |
| Ga0105248_117612642 | 3300009177 | Switchgrass Rhizosphere | MTTTSSDPVLAVAVRAARRAASVIIDASRDLRRLPTFSKEHG |
| Ga0115028_110870132 | 3300009179 | Wetland | MQNDTVLAVAVRAARRAASVMEDAARDLKRLPSHSKEHGDIVTSADM |
| Ga0073899_105573412 | 3300009540 | Activated Sludge | MSDVPMVGDPVLAVAVRAARRAASVIVDAGRDLKRLPTFSKEHGEIAAAA |
| Ga0105252_104429581 | 3300009678 | Soil | VTTTNDAVLAVAVRAARRAAAVVNDASRDLKRLPTFFKEHGDI |
| Ga0116144_103391631 | 3300009687 | Anaerobic Digestor Sludge | MADLPMIGDPVLAVAVRAARRASSVLVDAARDLKRLPTFSKEHDEIAAAA |
| Ga0131092_114916011 | 3300009870 | Activated Sludge | MINDPVLAVAVRAARRAGSVVIDAARDLKRLPAHAKEHA |
| Ga0134082_101649681 | 3300010303 | Grasslands Soil | MSDPALAVAVRAARNAAAVISDAAHDLKRLPTFSKERGEIVSAAAAEAKN |
| Ga0134088_105447732 | 3300010304 | Grasslands Soil | MSDPSLAVAVRAARNAAAVISDAAHDLKRLPAFSKEHGEIASTADA |
| Ga0134062_104514742 | 3300010337 | Grasslands Soil | MNDPALAVAVRAARNAAAVISAAAHDLKRLPTFSKE |
| Ga0074044_111724221 | 3300010343 | Bog Forest Soil | MSDPCLAVAVRAARNAAAIIEDAARDLARLPSSSQAHA |
| Ga0134121_104836372 | 3300010401 | Terrestrial Soil | MSDVPMIGDPVLAVAVRAARRAASVVVDAARDLKRLPTFSKE |
| Ga0134123_112512582 | 3300010403 | Terrestrial Soil | MTMHHDPILAVAIRAARRAGSVIVDAARDLKRLPSHAKGHDEIAKVAD |
| Ga0137428_11704402 | 3300011432 | Soil | LNTSSDPVLAVAVRAARRAASVIIDASRDLRRLPTFSKE |
| Ga0136623_104786912 | 3300012045 | Polar Desert Sand | VTLAADPVLAVAVRAAQRAASIVSDSARDLKRLPIYSREHRD |
| Ga0136622_101538262 | 3300012187 | Polar Desert Sand | VSLAADPVLAVAVRAAQRAASIVSDSARDLKRLPIYSRE |
| Ga0137381_114348902 | 3300012207 | Vadose Zone Soil | MNTTADPVLAVAVRAARRAGSVIIDASRDLRRLPTFSK |
| Ga0137370_108918191 | 3300012285 | Vadose Zone Soil | MSDPSLAVAVRAARNAAAVISDAAHDLKRLPTFSKEH |
| Ga0136612_102954242 | 3300012680 | Polar Desert Sand | MNAPNDPVLAVAVRAARRAAAVIGDASRDLKRLPTFSKEHGEIV |
| Ga0157293_102322992 | 3300012898 | Soil | MSDVPMIGDPVLAVAVRAARRAASVVVDAARDLKRLPTFSKEHLEI |
| Ga0137394_115637822 | 3300012922 | Vadose Zone Soil | MNATTDSVLAVAVRAARRAASVIIDASRDLRRLPTFSKEHADIVST |
| Ga0164299_104883691 | 3300012958 | Soil | MTNDQVLAVAIRAAHRASSVIIDAARDLRRRPAHAKDHGDIAAEA |
| Ga0126369_129839252 | 3300012971 | Tropical Forest Soil | MTNDPVLAVAIRAAHRAASVILDAARDLRRRPAHAK |
| Ga0163162_117714651 | 3300013306 | Switchgrass Rhizosphere | MSAGDDSVLSVAIQAARSAAAVITDAARDLVRLPTFSKDHGDIVSTADV |
| Ga0075345_11563461 | 3300014312 | Natural And Restored Wetlands | LTRPVDPVLAVAVRAARRAAAVVADASRDLKRLPTFSKEQGAIVSAADR |
| Ga0075356_10660542 | 3300014323 | Natural And Restored Wetlands | MAALDDPVLSVAVRAARSAASVIVDAARDLARLPTFSKDHGDIVSTADVEAEDA |
| Ga0157377_114295071 | 3300014745 | Miscanthus Rhizosphere | MQNDTVLAVAVHAARRAAAVLFDAARDLKRRPMHAK |
| Ga0157376_114923781 | 3300014969 | Miscanthus Rhizosphere | MSVTNDPVLAVAVRAARTAASIVIDAALDLKRLPTFSKDHGDIVSGADME |
| Ga0132255_1031992651 | 3300015374 | Arabidopsis Rhizosphere | MSAADDPILSVAIQAARSAAAVITDAARDLVRLPTFSKDHGDI |
| Ga0182041_103266102 | 3300016294 | Soil | MVGDPVLAVAVRAVRRAAAVVIDAARDLKRLPTFS |
| Ga0187780_107957392 | 3300017973 | Tropical Peatland | LNDPALAVAERAARNAAAVIGDAARDLKRLATFSK |
| Ga0184629_106320651 | 3300018084 | Groundwater Sediment | MINDPVLAVAVRAARRAASVIIDAARDLKRLPSHAKEHGDIVTA |
| Ga0190270_133260192 | 3300018469 | Soil | MNTSSDPVLAVAVRAARRAASVIIDASRDLRRLPTFS |
| Ga0190271_102417981 | 3300018481 | Soil | MTQIADPVLAVAVRAARRAASVIGDASRDLKRLPTFSKEHGDIFSA |
| Ga0066669_101866531 | 3300018482 | Grasslands Soil | MNTTSDPVLAVAVRAARRAASVIIDASRDLRRLPTF |
| Ga0193715_10693201 | 3300019878 | Soil | MNATTDSVLAVAVRAARRAASVIIDASRDLRRLPTFSKEHADI |
| Ga0207705_106393192 | 3300025909 | Corn Rhizosphere | MSTMAGDPTLAVAVRAARRAASVVADASRDLRRLPTFSEEHG |
| Ga0207665_116757823 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MTMAADPVLAVAVRAARRAASVMVDASRDLRRLPTFSKEHGDI |
| Ga0207658_108917501 | 3300025986 | Switchgrass Rhizosphere | MSAGDDSVLSVAIQAARSAAAVITDAARDLVRLPTFSK |
| Ga0207677_116465862 | 3300026023 | Miscanthus Rhizosphere | MIAPGSDVVLEVAIRGARRAASVIIDAARDLTHLPAH |
| Ga0207703_113121192 | 3300026035 | Switchgrass Rhizosphere | MTNDPVLSVAIRAAHRASSVIIDAARDLRRRPAHAKD |
| Ga0208540_10279712 | 3300026059 | Natural And Restored Wetlands | LTRPVDPVLAVAVRAARRAAAVVADASRDLKRLPTFSKEQGAIVSAADREA |
| Ga0207641_102719233 | 3300026088 | Switchgrass Rhizosphere | MQNDPVLAVAVHAARRAAAVLVDAARDLKRRPMHAKDHGDIVFNAD |
| Ga0207641_107143692 | 3300026088 | Switchgrass Rhizosphere | MSGSMDAMLAVAVRAARTAGSIVVDASRDLRRLPAFSKEHAQV |
| Ga0209377_11037282 | 3300026334 | Soil | MINDPVLAVAVRAARRAGSVIVDAARDLKRLPSHASDH |
| Ga0209156_104347451 | 3300026547 | Soil | MSDPALAVAVRAARNAAAVISDAAHDLKRLPTFSKERGDIVSAA |
| Ga0209689_14010921 | 3300027748 | Soil | MSDPSLAVAVRAARNAAAVISDAAHDLKRLPAFSKEHGEIASTADAEAGNAIV |
| Ga0209490_105286512 | 3300027823 | Freshwater | MTTSHDPVLSVAVRAAQAAASVIADAALDLKRLPTF |
| Ga0209293_100880753 | 3300027877 | Wetland | LTRPADPVLAVAVRAARRAAAVIADAARDLKRLPTF |
| Ga0209293_106892262 | 3300027877 | Wetland | VSAPISDPVLAVAVRAARRAGAVIVDAARDLKRLPAHAKEHGDIATN |
| Ga0209048_101523612 | 3300027902 | Freshwater Lake Sediment | MNQDPILAVAVRAARRAGSVIIDAARDLKRLPSHAKGHGEIAKAAD |
| Ga0247828_107107561 | 3300028587 | Soil | MNTSSYPVLAVAVRAARRAASVIIDASRDLRRLPTFSKEHGDIVSSADT |
| Ga0307504_101363822 | 3300028792 | Soil | MSDPSLAVAVRAARNAAAVISDAAHDLKRLPAFSK |
| Ga0311332_114347362 | 3300029984 | Fen | MSIADDPVLAVAVRAARSAASVISDAARDLVRLPTF |
| Ga0311336_105431951 | 3300029990 | Fen | MSIADDPVLAVAVRAARSAASVISDAARDLIRLPTFS |
| Ga0311337_101717551 | 3300030000 | Fen | MNAADDPVLAVAVRAARSAASVISDAARDLVRLPTFSKDHGDIVSTA |
| Ga0311350_100354021 | 3300030002 | Fen | MSIGDDPVLAVAVRAARSAASVISDAARDLVRLPTFSKDHGDIVSTA |
| Ga0311333_102821531 | 3300030114 | Fen | VSAADDAVLAVAVRAARSAASVITDAAHDLVRLPTFSKDHGDIVSTADVE |
| Ga0311349_104414421 | 3300030294 | Fen | MNAADDPVLAVAVRAARSAASVIADAARDLVRLPTFSKDHGDIVSTADVEAE |
| Ga0302211_102347881 | 3300030491 | Fen | VSMIDDPVLAVAMRAARTAASVVADAARDLKRLPTFSKDHGHIVTAAD |
| Ga0310887_102120322 | 3300031547 | Soil | MADAPMVTDPVLAVAVRAARRAAAVIIDAARDLKRLPTFSKEH |
| Ga0318560_104961332 | 3300031682 | Soil | MTNDPVLAVAIRAAHRASSVILDAARDLRRRPSHAKDHGDVATEA |
| Ga0302321_1001644451 | 3300031726 | Fen | VSAADDTVLAVAVRAARSAAAVITDAARDLVRLPTFSKDHGDIVSTADIEAE |
| Ga0318529_103707892 | 3300031792 | Soil | MTNDPVLAVAIRAAHRASSVILDAARDLRRRPSHAKDHG |
| Ga0318512_106209902 | 3300031846 | Soil | MTMVGDPVLAVAVRAARRAASVTVDASRDLRRLPTFSKEHGD |
| Ga0315297_110085271 | 3300031873 | Sediment | MNQDPVLAVAVRAARRAGSVIIDAARDLKRLPSHAKGHGDIARA |
| Ga0306921_109389243 | 3300031912 | Soil | MNDAALAVAVRAARNAGGVIADAARDLPRLATFSKEHG |
| Ga0311367_107510922 | 3300031918 | Fen | MNADNDPVLAVAVRAARTAASILDDAARDLKRLPSFSKAHGAVVSAADIE |
| Ga0308175_1029612991 | 3300031938 | Soil | MSTMAGDPTLAVAVRAARRAASVVADASRDLRRLPTFSKE |
| Ga0308174_117401472 | 3300031939 | Soil | MSTMAGDPTLAVAVRAARRAASVVADASRDLRRLPTY |
| Ga0307411_103346021 | 3300032005 | Rhizosphere | LTAPGDAVLAVAVRAARRAAAVIGDASRDLRRLPTYSKEHG |
| Ga0318563_106753921 | 3300032009 | Soil | MSDPTLAVAVRAARNAAAVIADATQDLKRLPAFSKEHGE |
| Ga0318575_103556442 | 3300032055 | Soil | MVGDPVLAVAVRAVRRAAAVVIDAARDLKRLPTFSKEHADIVT |
| Ga0307471_1005081223 | 3300032180 | Hardwood Forest Soil | MQATAMTNDPVLAVAVRAAHRASSVILDAARDLRRRPAH |
| Ga0307471_1012182422 | 3300032180 | Hardwood Forest Soil | MINDPVLAVAVRAARRAGSVIVDAARDLKRLPAHAKEH |
| Ga0316188_103209392 | 3300032276 | Worm Burrow | MSAANDPVLAVAVRAARTAASIIVDAARDLKRLPTFSKE |
| Ga0315273_119524802 | 3300032516 | Sediment | MSNTDDPVLAVAVRAARSAASVIADAARDLGRLPTFSKDHGDIVSTADVEAE |
| Ga0316605_124011291 | 3300033408 | Soil | VSGAGDTVLAVAVRAAQRAASVIIDAARDLKRLPTYAKEHGD |
| Ga0316619_106915491 | 3300033414 | Soil | LTRPADPVLAVAVRAARRAAAVIADAARDLKRLPTFSKEQGDIVSAAD |
| Ga0316625_1010547491 | 3300033418 | Soil | LTRPADPVLAVAVRAARRAAAVIADAARDLKRLPTFSKEQGDIVSAA |
| Ga0316625_1014751531 | 3300033418 | Soil | MSPANDPVLAVAVRAARTAASIIIDAARDLKRLPTFSKEHGD |
| Ga0316601_1010301411 | 3300033419 | Soil | LTLPADPVIAVAVRAARRAAAVIADASRDLKRLPTFSKEHGDIVSGADKEA |
| Ga0316627_1020553661 | 3300033482 | Soil | MQNDTVLAVAVRAARRAASVMEDAARDLKRLPSHSKEHGDI |
| Ga0316630_110525991 | 3300033487 | Soil | LTRPVDPVLAVAVRAARRAAAVIADAARDLKRLPTFSKEQGDIVSAADQEA |
| Ga0316628_1026091362 | 3300033513 | Soil | LTRPADPVLAVAVRAARRAAAVIADAARDLKRLPTFSKDQGDIVSAADQEAE |
| Ga0316616_1020791391 | 3300033521 | Soil | LTLPADPVIAVAVRAARRAAAVIADASRDLKRLPTFSKEHGDIVSGADKE |
| Ga0316616_1035718262 | 3300033521 | Soil | LTRPADPVLAVAVRAARRAAAVIADAARDLKRLPTFSKGQGDIVS |
| Ga0364943_0454529_2_154 | 3300034354 | Sediment | MSAADDSVLSVAVRAARSAAAVITDAARDLVRLPTFSKDHGDIVSTADVEA |
| ⦗Top⦘ |