


| Basic Information | |
|---|---|
| Family ID | F077168 |
| Family Type | Metagenome |
| Number of Sequences | 117 |
| Average Sequence Length | 42 residues |
| Representative Sequence | CRFVFDDYPEYNMQLISDCLKPFGFKVLEQGRNKICLEK |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.85 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 94.02 % |
| Associated GOLD sequencing projects | 72 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (58.974 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (46.154 % of family members) |
| Environment Ontology (ENVO) | Unclassified (82.051 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (81.197 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.42% β-sheet: 22.39% Coil/Unstructured: 61.19% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF13392 | HNH_3 | 15.38 |
| PF02945 | Endonuclease_7 | 7.69 |
| PF08241 | Methyltransf_11 | 3.42 |
| PF05050 | Methyltransf_21 | 1.71 |
| PF04471 | Mrr_cat | 0.85 |
| PF04545 | Sigma70_r4 | 0.85 |
| PF02475 | Met_10 | 0.85 |
| PF12705 | PDDEXK_1 | 0.85 |
| PF13443 | HTH_26 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 0.85 |
| COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 0.85 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 0.85 |
| COG2520 | tRNA G37 N-methylase Trm5 | Translation, ribosomal structure and biogenesis [J] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 58.97 % |
| All Organisms | root | All Organisms | 41.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10113167 | Not Available | 1090 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10073443 | All Organisms → Viruses → Predicted Viral | 1220 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10026285 | All Organisms → cellular organisms → Bacteria | 2768 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10092662 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10167412 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 734 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10174412 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 711 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10182151 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 662 | Open in IMG/M |
| 3300001460|JGI24003J15210_10008646 | Not Available | 4207 | Open in IMG/M |
| 3300005509|Ga0066827_10263180 | Not Available | 591 | Open in IMG/M |
| 3300005913|Ga0075108_10056122 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 1483 | Open in IMG/M |
| 3300005913|Ga0075108_10154967 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 816 | Open in IMG/M |
| 3300005931|Ga0075119_1049425 | Not Available | 1057 | Open in IMG/M |
| 3300005933|Ga0075118_10170690 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 719 | Open in IMG/M |
| 3300006090|Ga0082015_1006989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Shandvirus → unclassified Shandvirus → Cyanophage S-RIM4 | 1975 | Open in IMG/M |
| 3300006750|Ga0098058_1030213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Shandvirus → unclassified Shandvirus → Cyanophage S-RIM4 | 1572 | Open in IMG/M |
| 3300006802|Ga0070749_10291373 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300006802|Ga0070749_10591949 | Not Available | 599 | Open in IMG/M |
| 3300006802|Ga0070749_10743776 | Not Available | 522 | Open in IMG/M |
| 3300006810|Ga0070754_10233529 | Not Available | 845 | Open in IMG/M |
| 3300006810|Ga0070754_10329818 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 679 | Open in IMG/M |
| 3300006810|Ga0070754_10395127 | Not Available | 606 | Open in IMG/M |
| 3300006868|Ga0075481_10099433 | Not Available | 1081 | Open in IMG/M |
| 3300006868|Ga0075481_10145489 | Not Available | 865 | Open in IMG/M |
| 3300006916|Ga0070750_10131195 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300006916|Ga0070750_10297425 | Not Available | 691 | Open in IMG/M |
| 3300006916|Ga0070750_10317057 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 663 | Open in IMG/M |
| 3300006919|Ga0070746_10252604 | Not Available | 823 | Open in IMG/M |
| 3300006919|Ga0070746_10368680 | Not Available | 648 | Open in IMG/M |
| 3300006919|Ga0070746_10497113 | Not Available | 536 | Open in IMG/M |
| 3300006928|Ga0098041_1175370 | Not Available | 687 | Open in IMG/M |
| 3300007234|Ga0075460_10029712 | Not Available | 2122 | Open in IMG/M |
| 3300007234|Ga0075460_10306284 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Jedunavirus → Jedunavirus KpV80 | 520 | Open in IMG/M |
| 3300007234|Ga0075460_10311919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → unclassified Acidiferrobacteraceae → Acidiferrobacteraceae bacterium | 514 | Open in IMG/M |
| 3300007236|Ga0075463_10181062 | Not Available | 680 | Open in IMG/M |
| 3300007344|Ga0070745_1281814 | Not Available | 595 | Open in IMG/M |
| 3300007346|Ga0070753_1124286 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300007538|Ga0099851_1111082 | Not Available | 1039 | Open in IMG/M |
| 3300007538|Ga0099851_1219019 | Not Available | 688 | Open in IMG/M |
| 3300007539|Ga0099849_1195710 | Not Available | 762 | Open in IMG/M |
| 3300007540|Ga0099847_1059756 | Not Available | 1190 | Open in IMG/M |
| 3300007540|Ga0099847_1095496 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 908 | Open in IMG/M |
| 3300007541|Ga0099848_1145218 | Not Available | 881 | Open in IMG/M |
| 3300007542|Ga0099846_1337529 | Not Available | 512 | Open in IMG/M |
| 3300007640|Ga0070751_1010150 | Not Available | 4829 | Open in IMG/M |
| 3300007960|Ga0099850_1119338 | Not Available | 1077 | Open in IMG/M |
| 3300008012|Ga0075480_10207701 | Not Available | 1032 | Open in IMG/M |
| 3300009149|Ga0114918_10047623 | Not Available | 2901 | Open in IMG/M |
| 3300009507|Ga0115572_10375057 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 798 | Open in IMG/M |
| 3300009529|Ga0114919_10522203 | Not Available | 818 | Open in IMG/M |
| 3300010296|Ga0129348_1115737 | Not Available | 939 | Open in IMG/M |
| 3300010297|Ga0129345_1131743 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300010299|Ga0129342_1334990 | Not Available | 517 | Open in IMG/M |
| 3300010300|Ga0129351_1190204 | Not Available | 800 | Open in IMG/M |
| 3300010316|Ga0136655_1047324 | Not Available | 1351 | Open in IMG/M |
| 3300010318|Ga0136656_1139598 | Not Available | 833 | Open in IMG/M |
| 3300010354|Ga0129333_10285932 | Not Available | 1478 | Open in IMG/M |
| 3300010354|Ga0129333_10641164 | Not Available | 918 | Open in IMG/M |
| 3300010368|Ga0129324_10388829 | Not Available | 540 | Open in IMG/M |
| 3300010392|Ga0118731_105288873 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 791 | Open in IMG/M |
| 3300017697|Ga0180120_10091801 | Not Available | 1328 | Open in IMG/M |
| 3300017697|Ga0180120_10215793 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 790 | Open in IMG/M |
| 3300017703|Ga0181367_1026800 | Not Available | 1039 | Open in IMG/M |
| 3300017704|Ga0181371_1087556 | Not Available | 504 | Open in IMG/M |
| 3300017715|Ga0181370_1005995 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Shandvirus → unclassified Shandvirus → Cyanophage S-RIM4 | 1571 | Open in IMG/M |
| 3300017715|Ga0181370_1029847 | Not Available | 708 | Open in IMG/M |
| 3300017773|Ga0181386_1055875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → unclassified Cellvibrionales → Cellvibrionales bacterium TMED49 | 1264 | Open in IMG/M |
| 3300020397|Ga0211583_10258586 | Not Available | 630 | Open in IMG/M |
| 3300020446|Ga0211574_10343957 | Not Available | 644 | Open in IMG/M |
| 3300021957|Ga0222717_10253224 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 1022 | Open in IMG/M |
| 3300021958|Ga0222718_10613416 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 508 | Open in IMG/M |
| 3300021960|Ga0222715_10203853 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300021960|Ga0222715_10517610 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 630 | Open in IMG/M |
| 3300021964|Ga0222719_10234614 | Not Available | 1229 | Open in IMG/M |
| 3300022053|Ga0212030_1017793 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 941 | Open in IMG/M |
| 3300022053|Ga0212030_1046654 | Not Available | 613 | Open in IMG/M |
| 3300022068|Ga0212021_1037415 | Not Available | 963 | Open in IMG/M |
| 3300022068|Ga0212021_1043825 | Not Available | 898 | Open in IMG/M |
| 3300022198|Ga0196905_1035738 | Not Available | 1470 | Open in IMG/M |
| 3300022198|Ga0196905_1105260 | Not Available | 750 | Open in IMG/M |
| 3300022200|Ga0196901_1085977 | Not Available | 1114 | Open in IMG/M |
| 3300022200|Ga0196901_1118991 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300022200|Ga0196901_1188132 | Not Available | 668 | Open in IMG/M |
| 3300022200|Ga0196901_1246495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 555 | Open in IMG/M |
| 3300022227|Ga0187827_10599736 | Not Available | 643 | Open in IMG/M |
| 3300022837|Ga0222711_1022620 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 830 | Open in IMG/M |
| 3300022867|Ga0222629_1006627 | Not Available | 1822 | Open in IMG/M |
| 3300023229|Ga0222661_1011905 | Not Available | 1494 | Open in IMG/M |
| 3300023235|Ga0222634_1012219 | Not Available | 1657 | Open in IMG/M |
| 3300023237|Ga0222650_1019698 | Not Available | 1469 | Open in IMG/M |
| 3300024433|Ga0209986_10500616 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 535 | Open in IMG/M |
| (restricted) 3300024517|Ga0255049_10264312 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 789 | Open in IMG/M |
| 3300025078|Ga0208668_1023329 | Not Available | 1241 | Open in IMG/M |
| 3300025114|Ga0208433_1100582 | Not Available | 717 | Open in IMG/M |
| 3300025122|Ga0209434_1069360 | Not Available | 1051 | Open in IMG/M |
| 3300025268|Ga0207894_1051435 | Not Available | 716 | Open in IMG/M |
| 3300025502|Ga0208903_1023617 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 1830 | Open in IMG/M |
| 3300025603|Ga0208414_1174383 | Not Available | 525 | Open in IMG/M |
| 3300025647|Ga0208160_1061321 | Not Available | 1043 | Open in IMG/M |
| 3300025671|Ga0208898_1034372 | Not Available | 2023 | Open in IMG/M |
| 3300025674|Ga0208162_1068425 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300025751|Ga0208150_1097140 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 965 | Open in IMG/M |
| 3300025759|Ga0208899_1079309 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
| 3300025769|Ga0208767_1232683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Enterococcus phage IME-EFm1 | 591 | Open in IMG/M |
| 3300025818|Ga0208542_1036399 | Not Available | 1583 | Open in IMG/M |
| 3300025818|Ga0208542_1066428 | Not Available | 1090 | Open in IMG/M |
| 3300025828|Ga0208547_1202026 | Not Available | 534 | Open in IMG/M |
| 3300025853|Ga0208645_1130943 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300025889|Ga0208644_1317667 | Not Available | 610 | Open in IMG/M |
| 3300026199|Ga0208638_1160386 | Not Available | 598 | Open in IMG/M |
| 3300026267|Ga0208278_1030171 | Not Available | 1406 | Open in IMG/M |
| (restricted) 3300027856|Ga0255054_10125325 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 1271 | Open in IMG/M |
| 3300028125|Ga0256368_1053760 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 705 | Open in IMG/M |
| 3300028196|Ga0257114_1239580 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 651 | Open in IMG/M |
| 3300031631|Ga0307987_1114565 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 710 | Open in IMG/M |
| 3300034374|Ga0348335_033656 | All Organisms → cellular organisms → Bacteria | 2205 | Open in IMG/M |
| 3300034375|Ga0348336_057105 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
| 3300034375|Ga0348336_098857 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 46.15% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 11.97% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 9.40% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 5.98% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.27% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 4.27% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 3.42% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.56% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.71% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.71% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 1.71% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.85% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.85% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.85% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.85% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.85% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.85% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.85% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300005509 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV51 | Environmental | Open in IMG/M |
| 3300005913 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1 | Environmental | Open in IMG/M |
| 3300005931 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9 | Environmental | Open in IMG/M |
| 3300005933 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKE | Environmental | Open in IMG/M |
| 3300006090 | Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP124 | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017703 | Marine viral communities from the Subarctic Pacific Ocean - ?Lowphox_02 viral metaG | Environmental | Open in IMG/M |
| 3300017704 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_07 viral metaG | Environmental | Open in IMG/M |
| 3300017715 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_06 viral metaG | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300020397 | Marine microbial communities from Tara Oceans - TARA_B100000123 (ERX556052-ERR599075) | Environmental | Open in IMG/M |
| 3300020446 | Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989) | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022227 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_150_PacBio MetaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300022837 | Saline water microbial communities from Ace Lake, Antarctica - #1699 | Environmental | Open in IMG/M |
| 3300022867 | Saline water microbial communities from Ace Lake, Antarctica - #1 | Environmental | Open in IMG/M |
| 3300023229 | Saline water microbial communities from Ace Lake, Antarctica - #551 | Environmental | Open in IMG/M |
| 3300023235 | Saline water microbial communities from Ace Lake, Antarctica - #50 | Environmental | Open in IMG/M |
| 3300023237 | Saline water microbial communities from Ace Lake, Antarctica - #367 | Environmental | Open in IMG/M |
| 3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024517 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3 | Environmental | Open in IMG/M |
| 3300025078 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025114 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025122 | Marine viral communities from the Pacific Ocean - ETNP_2_300 (SPAdes) | Environmental | Open in IMG/M |
| 3300025268 | Marine viral communities from the Deep Pacific Ocean - MSP-114 (SPAdes) | Environmental | Open in IMG/M |
| 3300025502 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKJ (SPAdes) | Environmental | Open in IMG/M |
| 3300025603 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKE (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026199 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV51 (SPAdes) | Environmental | Open in IMG/M |
| 3300026267 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV259 (SPAdes) | Environmental | Open in IMG/M |
| 3300027856 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_23 | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300028196 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m | Environmental | Open in IMG/M |
| 3300031631 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #181 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_101131674 | 3300000101 | Marine | DYPKYNMQLIRDMLKYYDFDILDQGQNKICLEKKI* |
| DelMOSum2011_100734431 | 3300000115 | Marine | FPKYNMQLIRDVLKYYDFDILDQGQNKICLEKKI* |
| DelMOSpr2010_100262851 | 3300000116 | Marine | ANRAAGNCRFVFDDYPKYNMQLISDTLKPFGFSVMEQGRNKICLTMEKE* |
| DelMOSpr2010_100926621 | 3300000116 | Marine | SCRFIFDDYPKYNMQLISDCLKPFGFKVLEQGKNKICLEK* |
| DelMOSpr2010_101674123 | 3300000116 | Marine | PKYNMQLIRDCLKLYGFEIMDQGQNKICLEKNAL* |
| DelMOSpr2010_101744123 | 3300000116 | Marine | FDDFPKYNMQLIRDVLKYYDFDILDQGQNKICLEKKI* |
| DelMOWin2010_101821512 | 3300000117 | Marine | YPKYNMQLIRDMLKYYDFDILDQGQNKICLEKKI* |
| JGI24003J15210_100086461 | 3300001460 | Marine | RFVFDDFPKYNMQLIRDCLKLYGFKIMDQGQNKICLEKDGL* |
| Ga0066827_102631801 | 3300005509 | Marine | ESIWFANHIPNKARFVFDDYPKYNMQLVRDCLKPFGFEILGSGDNKICLEKK* |
| Ga0075108_100561221 | 3300005913 | Saline Lake | PKYNMQLIRDVLKLYGFEIMDQGQNKICLEKIERIVL* |
| Ga0075108_101549673 | 3300005913 | Saline Lake | DFPKYNMQLIRDCLKLYGFEIMDQGQNKICLEKIERLVL* |
| Ga0075119_10494251 | 3300005931 | Saline Lake | VFDDFPKYNMQLIRDCLKLYGFEIMDQGQNKICLEKNGL* |
| Ga0075118_101706902 | 3300005933 | Saline Lake | PKYNMQLIRDCLKLYGFEIMDQGQNKICLEKIERVVL* |
| Ga0082015_10069891 | 3300006090 | Marine | NHIPNKARFVFDDYPKYNMQLVRDCLKPFGFEILETGKNKICLEKK* |
| Ga0098058_10302131 | 3300006750 | Marine | ESIWFANHIPNKARFVFDDYPKYNMQLVRDCLKPFGFEILESGDNKICLEKK* |
| Ga0070749_102913733 | 3300006802 | Aqueous | FANRAAGSCRFVFDDYPEYNMQLISDCLKPFGFKVLEQGKNKICLEK* |
| Ga0070749_105919492 | 3300006802 | Aqueous | FANRAAGSCRFVFDDYPEYNMQLISDCLKPFGFKVLEQGKTKICLEK* |
| Ga0070749_107437761 | 3300006802 | Aqueous | RAAGSCRFVFDDYPKYNMQLTSDILKPFGFSVMQQGRNKICLEKK* |
| Ga0070754_102335292 | 3300006810 | Aqueous | AGSCRFVFDDYPEYNMQLISDCLKPFGFKVLEQGRNKICLEKNEVE* |
| Ga0070754_103298181 | 3300006810 | Aqueous | RYVFDDFPKYNMQLIRDVLKYYDFDILDQGQNKICLEKKI* |
| Ga0070754_103951272 | 3300006810 | Aqueous | VFDDYPEYNMQLISDCLKPFGFKVLEQGRNKICLEK* |
| Ga0075481_100994334 | 3300006868 | Aqueous | MTRDVITEAVWFANRAAGNCRFVFDDYPKYNMQLISDTLKPFGFSVMEQG |
| Ga0075481_101454891 | 3300006868 | Aqueous | VFDDYPKYDMQLISNCLKPFGFKVLEQGRNKICLENC* |
| Ga0070750_101311951 | 3300006916 | Aqueous | DYPKYNMQLTSDILKPFGFSVMQQGRNKICLEKK* |
| Ga0070750_102974251 | 3300006916 | Aqueous | VFDDYPKYNMQLISDTLKPFGFSVMEQGRNKICLNIKK* |
| Ga0070750_103170571 | 3300006916 | Aqueous | IFDDYPKYNMQLIRDMLKYYDFDILDQGQNKICLEKKI* |
| Ga0070746_102526042 | 3300006919 | Aqueous | FDDYPKYDMQLISDCLKPFGFSVMQQGKNKICLEK* |
| Ga0070746_103686802 | 3300006919 | Aqueous | AGSCRFVFDDYPEYNMQLISDCLKPFGFKVLEQGKTKICLEK* |
| Ga0070746_104971132 | 3300006919 | Aqueous | WFANRAAGSCRFVFDDYPKYNMQLTSDILKPFGFSVMQQGRNKICLEKK* |
| Ga0098041_11753703 | 3300006928 | Marine | ARFIFDDYPKYNMQLISDCLKPYGFSVMEQGQNKICLEKQNT* |
| Ga0075460_100297121 | 3300007234 | Aqueous | GSCRFVFDDYPKYDMQLVSNCLKPFGFRPMQQGNNKICLEREQNDNNI* |
| Ga0075460_103062842 | 3300007234 | Aqueous | VFDDYPEYNMQLISDCLKPFGFKVLEQGKNKICLEK* |
| Ga0075460_103119191 | 3300007234 | Aqueous | AGSCRFVFDDYPKYNMQLTSDILKPFGFSVMQQGRNKICLEKK* |
| Ga0075463_101810622 | 3300007236 | Aqueous | WFANRAAGSCRFVFDDYPKYDMQLVSNCLKPFGFRPMQQGNNKICLEKNEVE* |
| Ga0070745_12818141 | 3300007344 | Aqueous | AGSCRFVFDDYPEYNMQLISDCLKPFGFKVLEQGRNKICLEKK* |
| Ga0070753_11242863 | 3300007346 | Aqueous | FDDYPEYNMQLISDCLKPFGFKVLEQGRNKICLEK* |
| Ga0099851_11110821 | 3300007538 | Aqueous | SCRFVFDDYPKYNMQLISDCLKPFGFKVLEQGRNKICLQK* |
| Ga0099851_12190191 | 3300007538 | Aqueous | FDDYPEYNMQLISDCLKPFGFKVLEQGRNKICLEKK* |
| Ga0099849_11957101 | 3300007539 | Aqueous | CRFVFDDYPEYNMQLISDCLKPFGFKVLEQGKNKICLEK* |
| Ga0099847_10597561 | 3300007540 | Aqueous | HKYNMQIVKDCIKPFGFNVIEQEKKKICMEKKKRQ* |
| Ga0099847_10954961 | 3300007540 | Aqueous | VWFANRAAGSCRFVFDDYPEYDMQLVSDCLKPFGFKVMEQGRNKICLERYLKN* |
| Ga0099848_11452182 | 3300007541 | Aqueous | FDDYPEYNMQLISDTLKPFGFSVMEQGRNKICLQK* |
| Ga0099846_13375293 | 3300007542 | Aqueous | AGSCRFVFDDYPEYDMQLISDCLKPFGFKVLEQGRNKICLEKK* |
| Ga0070751_101015010 | 3300007640 | Aqueous | AAGSCRFVFDDYPKYDMQLVSNCLKPFGFRPMQQGNNKICLEKEQNDNNI* |
| Ga0099850_11193381 | 3300007960 | Aqueous | SCRFVFDDYPKYNMQLISDTLKPFGFSVMEQGRNKICLQK* |
| Ga0075480_102077012 | 3300008012 | Aqueous | CRFVFDDYPKYDMQLVSNCLKPFGFRPMQQGNNKICLEKNEVE* |
| Ga0114918_100476231 | 3300009149 | Deep Subsurface | DFPKYNMQLIRDVLKLYGFEIMDQGQNKICLEKIERIVL* |
| Ga0115572_103750571 | 3300009507 | Pelagic Marine | VFDDFPKYNMQLIRDVLKYYDFDILDQGQNKICLEKKI* |
| Ga0114919_105222031 | 3300009529 | Deep Subsurface | FVFDDYPKYDMQLVSNCLKPFGFRPMQQGNNKICLEKNEVE* |
| Ga0129348_11157373 | 3300010296 | Freshwater To Marine Saline Gradient | AAGSCRFVFDDYPEYNMQLISDCLKPFGFKVLEQGKNKICLEK* |
| Ga0129345_11317433 | 3300010297 | Freshwater To Marine Saline Gradient | WFANRAAGSCRFVFDDYPEYNMQLISDCLKPFGFKVLEQGKNKICLEK* |
| Ga0129342_13349902 | 3300010299 | Freshwater To Marine Saline Gradient | FVFDDYPEYNMQLISDCLKPFGFKVLEQGRNKICLEK* |
| Ga0129351_11902042 | 3300010300 | Freshwater To Marine Saline Gradient | FANRAAGSCRFVFDDYPEYNMQLISDCLKPFGFKVLEQGKSKICLEK* |
| Ga0136655_10473241 | 3300010316 | Freshwater To Marine Saline Gradient | FDDYPKYNMQLIRDVLKYYDFDILDQGQNKICLEKKI* |
| Ga0136656_11395983 | 3300010318 | Freshwater To Marine Saline Gradient | RFVFDDYPEYNMQLISDCLKPFGFKVLEQGKNKICLQK* |
| Ga0129333_102859323 | 3300010354 | Freshwater To Marine Saline Gradient | RAAGSCRFVFDDYPEYNMQLISDTLKPFGFSVMEQGRNKICLQK* |
| Ga0129333_106411643 | 3300010354 | Freshwater To Marine Saline Gradient | AGSCRFVFDDYPEYNMQLISDCLKPFGFKVLEQGKNKICLEK* |
| Ga0129324_103888293 | 3300010368 | Freshwater To Marine Saline Gradient | ANRAAGSCRFVFDDYPEYNMQLISDCLKPFGFKVLEQGRNKICLEKK* |
| Ga0118731_1052888731 | 3300010392 | Marine | IFDDYPKYNMQLIRDMLKYYDFDILDQGSNKICLEKKI* |
| Ga0180120_100918013 | 3300017697 | Freshwater To Marine Saline Gradient | ANRAAGSCRFVFDDYPEYNMQLISDCLKPFGFKVLEQGKNKICLEK |
| Ga0180120_102157931 | 3300017697 | Freshwater To Marine Saline Gradient | RYVFDDFPKYNMQLIRDVLKYYDFDILDQGQNKICLEKKI |
| Ga0181367_10268002 | 3300017703 | Marine | ARFVFDDYPKYNMQLVRDCLKPFGFEILGSGDNKICLEKK |
| Ga0181371_10875561 | 3300017704 | Marine | NKARFVFDDYPKYNMQLVRDCLKPFGFEILESGDNKICLEKK |
| Ga0181370_10059951 | 3300017715 | Marine | IPNKARFVFDDYPKYNMQLVRDCLKPFGFEILESGDNKICLEKK |
| Ga0181370_10298471 | 3300017715 | Marine | SIWFANHIPNKARFVFDDYPKYNMQLVRDCLKPFGFEILESGDNKICLEKK |
| Ga0181386_10558753 | 3300017773 | Seawater | PKYNMQLIRDCLKPFGFDIMDQGKNKICLEKQRLVM |
| Ga0211583_102585863 | 3300020397 | Marine | DYPKYNMPLIQSALEPFGFKKLEAGKNKICLEKRRNNL |
| Ga0211574_103439571 | 3300020446 | Marine | CRFVFDDYPKYNMPLIQSALEPFGFKKLEAGKNKICLEKRRYIL |
| Ga0222717_102532244 | 3300021957 | Estuarine Water | IVFDDYPKYDMPLIRMVLGYYDFQLYEQGENRICLEKI |
| Ga0222718_106134162 | 3300021958 | Estuarine Water | RYIFDDYPKYNMQLIRDMLKYYDFDILDQGQNKICLEKKI |
| Ga0222715_102038533 | 3300021960 | Estuarine Water | CRFIFDDYPKYDMQLISDTLKPFGFSVMQQGNNKICLEK |
| Ga0222715_105176102 | 3300021960 | Estuarine Water | IFDDYPKYNMQLIRDMLKYYDFDILDQGQNKICLEKKI |
| Ga0222719_102346141 | 3300021964 | Estuarine Water | IFDYYPKYNMQLIRDMLKYYDFDILDQGQNKICLEKKI |
| Ga0212030_10177933 | 3300022053 | Aqueous | FANRAAGSCRFVFDDYPEYDMQLVSDCLKPFGFKVMEQGRNKICLERYLTN |
| Ga0212030_10466541 | 3300022053 | Aqueous | CRFVFDDYPEYNMQLISDCLKPFGFKVLEQGRNKICLEK |
| Ga0212021_10374153 | 3300022068 | Aqueous | RFIFDDYPKYNMQLISDCLKPFEFKVLEQGKNKICLEK |
| Ga0212021_10438251 | 3300022068 | Aqueous | FANRAAGSCRFVFDDYPKYDMQLVSNCLKPFGFRPMQQGNNKICLEKNEVE |
| Ga0196905_10357383 | 3300022198 | Aqueous | FDDYPEYNMQLISDCLKPFGFKVLEQGRNKICLEK |
| Ga0196905_11052601 | 3300022198 | Aqueous | NRAAGSCRFVFDDYPKYNMQLISDTLKPFGFSVMEQGRNKICLTMEKE |
| Ga0196901_10859771 | 3300022200 | Aqueous | VFDDYPEYNMQLISDTLKPFGFSVMEQGRNKICLQK |
| Ga0196901_11189913 | 3300022200 | Aqueous | FVFDDYPEYNMQLISDCLKPFGFKVLEQGRNKICLEK |
| Ga0196901_11881321 | 3300022200 | Aqueous | GSCRFVFDDYPEYNMQLISDCLKPFGFKVLEQGRNKICLEK |
| Ga0196901_12464952 | 3300022200 | Aqueous | ANRAAGSCRFVFDDYPEYDMQLVSDCLKPFGFKVMEQGRNKICLERYLTN |
| Ga0187827_105997363 | 3300022227 | Seawater | DDYPKYNMQLVRDCLKPFGFEILESGDNKICLEKK |
| Ga0222711_10226204 | 3300022837 | Saline Water | FDDFPKYNMQLIRDCLKLYGFEIMDQGQNKICLEKIERLVL |
| Ga0222629_10066271 | 3300022867 | Saline Water | FDDFPKYNMQLIRDCLKLYGFEIMDQGQNKICLEKIERVVL |
| Ga0222661_10119054 | 3300023229 | Saline Water | DDFPKYNMQLIRDCLKLYGFEIMDQGQNKICLEKIERVVL |
| Ga0222634_10122191 | 3300023235 | Saline Water | RYVFDDFPKYNMQLIRDVLKLYGFEIMDQGQNKICLEKIERIVL |
| Ga0222650_10196984 | 3300023237 | Saline Water | RFVFDDFPKYNMQLIRDVLKLYGFEIMDQGQNKICLEKIERIVL |
| Ga0209986_105006161 | 3300024433 | Deep Subsurface | DDYPKYNMQLIRDMLKYYDFDILDQGQNKICLEKKI |
| (restricted) Ga0255049_102643124 | 3300024517 | Seawater | RYVFDDFPKYNMQLIRDILKYYDFDILDEGQNKICLEKKI |
| Ga0208668_10233294 | 3300025078 | Marine | VLTESIWFANHIPNKARFVFDDYPKYNMQLVRDCLKPFGFEILGSGDNKICLEKK |
| Ga0208433_11005821 | 3300025114 | Marine | PNKARFVFDDYPKYNMQLVRDCLKPFGFEILESGNNKICLEKK |
| Ga0209434_10693601 | 3300025122 | Marine | RFVFDDYPKYNMQLVRDCLKPFGFEILGSGNNKICLEKK |
| Ga0207894_10514353 | 3300025268 | Deep Ocean | LTESIWFANHIPNKARFVFDDYPKYNMQLVRDCLKPFGFEILESGDNKICLEKK |
| Ga0208903_10236171 | 3300025502 | Saline Lake | FPKYNMQLIRDCLKLYGFEIMDQGQNKICLEKIERLVL |
| Ga0208414_11743832 | 3300025603 | Saline Lake | FDDFPKYNMQLIRDCLKLYGFEIMDQGQNKICLEKNGL |
| Ga0208160_10613213 | 3300025647 | Aqueous | AAGSCRFVFDDYPEYNMQLISDCLKPFGFSVMQQGKNKICLEK |
| Ga0208898_10343724 | 3300025671 | Aqueous | WFANRAAGSCRFVFDDYPKYDMQLVSNCLKPFGFRPMQQGNNKICLEREQNDNNI |
| Ga0208162_10684251 | 3300025674 | Aqueous | ATGNCRFVFDDYPKYNMQLISDTLKPFGFSVMEQGRNKICLTMEKE |
| Ga0208150_10971403 | 3300025751 | Aqueous | IFDDYPKYNMQLIRDMLKYYDFDILDQGSNKICLEKKI |
| Ga0208899_10793093 | 3300025759 | Aqueous | AAGSCRFVFDDYPEYNMQLISDCLKPFGFKVLEQGRNKICLEKNEVE |
| Ga0208767_12326831 | 3300025769 | Aqueous | FIFDDYPKYNMQLISDTLKPFGFSVMEQGRNKICLKN |
| Ga0208542_10363993 | 3300025818 | Aqueous | GSCRFVFDDYPKYDMQLVSNCLKPFGFRPMQQGNNKICLEREQNDNNI |
| Ga0208542_10664283 | 3300025818 | Aqueous | VFDDYPKYNMQIVADCLKPFGFYVLEQGKNKICLEKKQ |
| Ga0208547_12020261 | 3300025828 | Aqueous | WFANRAAGNCRFIFDDYPKYDMQLISDCLKPFGFSVMQQGRNKICLEK |
| Ga0208645_11309431 | 3300025853 | Aqueous | AAGSCRFVFDDYPEYNMQLISDCLKPFGFKVLEQGRNKICLEK |
| Ga0208644_13176672 | 3300025889 | Aqueous | AVWFANRAAGSCRFVFDDYPEYNMQLISDCLKPFGFKVLEQGKTKICLEK |
| Ga0208638_11603861 | 3300026199 | Marine | ESIWFANHIPNKARFVFDDYPKYNMQLVRDCLKPFGFEILGSGDNKICLEKK |
| Ga0208278_10301714 | 3300026267 | Marine | IPNKARFVFDDYPKYNMQLVRDCLKPFGFEILESGNNKICLEKK |
| (restricted) Ga0255054_101253254 | 3300027856 | Seawater | YNMQLIRDVLKLYGFEIMDQGQNKICLEKIERIVL |
| Ga0256368_10537601 | 3300028125 | Sea-Ice Brine | VFDDFPKYNMQLIRDVLKLYGFEIMDQGQNKICLERNAL |
| Ga0257114_12395802 | 3300028196 | Marine | TRYIFDDYPKYNMQLIRDILKYYDFDILDQGKNKICLEKKI |
| Ga0307987_11145653 | 3300031631 | Marine | FVFDDFPKYNMQLIRDCLKLYGFEIMDQGQNKICLEKNGL |
| Ga0348335_033656_2074_2205 | 3300034374 | Aqueous | NCRFVFDDYPKYNMQLISDTLKPFGFSVMEQGRNKICLTMEKE |
| Ga0348336_057105_1403_1513 | 3300034375 | Aqueous | VFDDYPKYNMQLVSDCLKPFGFKVLEQGKNKICLEK |
| Ga0348336_098857_864_995 | 3300034375 | Aqueous | SCRFVFDDYPKYNMQLISDTLKPFGFSVMEQGRNKICLTMEKE |
| ⦗Top⦘ |