


| Basic Information | |
|---|---|
| Family ID | F076961 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MVEDYIQDKVRRDIIKEISNLELPNEWKPQQVIDYIIRKIDKK |
| Number of Associated Samples | 63 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 5.36 % |
| % of genes near scaffold ends (potentially truncated) | 29.91 % |
| % of genes from short scaffolds (< 2000 bps) | 63.25 % |
| Associated GOLD sequencing projects | 59 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (57.265 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater (17.949 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.479 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (68.376 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.25% β-sheet: 0.00% Coil/Unstructured: 57.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF00085 | Thioredoxin | 4.27 |
| PF00082 | Peptidase_S8 | 4.27 |
| PF02675 | AdoMet_dc | 3.42 |
| PF01923 | Cob_adeno_trans | 1.71 |
| PF13578 | Methyltransf_24 | 1.71 |
| PF02511 | Thy1 | 0.85 |
| PF00011 | HSP20 | 0.85 |
| PF02467 | Whib | 0.85 |
| PF00534 | Glycos_transf_1 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 3.42 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 57.26 % |
| All Organisms | root | All Organisms | 42.74 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001836|RCM27_1004368 | Not Available | 888 | Open in IMG/M |
| 3300001839|RCM40_1026640 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3553 | Open in IMG/M |
| 3300001849|RCM26_1256176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
| 3300001968|GOS2236_1003191 | Not Available | 1700 | Open in IMG/M |
| 3300001968|GOS2236_1049874 | Not Available | 1580 | Open in IMG/M |
| 3300001968|GOS2236_1054146 | Not Available | 1984 | Open in IMG/M |
| 3300001968|GOS2236_1076049 | Not Available | 1670 | Open in IMG/M |
| 3300005525|Ga0068877_10271001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 991 | Open in IMG/M |
| 3300005525|Ga0068877_10580406 | Not Available | 611 | Open in IMG/M |
| 3300005527|Ga0068876_10013525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5288 | Open in IMG/M |
| 3300005527|Ga0068876_10021013 | Not Available | 4128 | Open in IMG/M |
| 3300005528|Ga0068872_10305321 | Not Available | 881 | Open in IMG/M |
| 3300005662|Ga0078894_11165152 | Not Available | 655 | Open in IMG/M |
| 3300005758|Ga0078117_1009695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3045 | Open in IMG/M |
| 3300005758|Ga0078117_1023691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2833 | Open in IMG/M |
| 3300005805|Ga0079957_1055749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2384 | Open in IMG/M |
| 3300006875|Ga0075473_10121274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1043 | Open in IMG/M |
| 3300007169|Ga0102976_1025988 | Not Available | 1169 | Open in IMG/M |
| 3300007171|Ga0102977_1022255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. FW510-R10 | 2386 | Open in IMG/M |
| 3300007177|Ga0102978_1226169 | Not Available | 1984 | Open in IMG/M |
| 3300007304|Ga0102689_1814258 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1084 | Open in IMG/M |
| 3300008107|Ga0114340_1010292 | Not Available | 4658 | Open in IMG/M |
| 3300008107|Ga0114340_1113166 | Not Available | 1063 | Open in IMG/M |
| 3300008114|Ga0114347_1010246 | Not Available | 7868 | Open in IMG/M |
| 3300008114|Ga0114347_1019459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3229 | Open in IMG/M |
| 3300008114|Ga0114347_1085973 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1248 | Open in IMG/M |
| 3300008116|Ga0114350_1001767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 12060 | Open in IMG/M |
| 3300008116|Ga0114350_1017956 | All Organisms → Viruses → Predicted Viral | 2987 | Open in IMG/M |
| 3300008116|Ga0114350_1020020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5614 | Open in IMG/M |
| 3300008116|Ga0114350_1043655 | Not Available | 1677 | Open in IMG/M |
| 3300008116|Ga0114350_1047755 | Not Available | 2146 | Open in IMG/M |
| 3300008116|Ga0114350_1088325 | Not Available | 1010 | Open in IMG/M |
| 3300008116|Ga0114350_1190943 | Not Available | 515 | Open in IMG/M |
| 3300008117|Ga0114351_1058817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2369 | Open in IMG/M |
| 3300008120|Ga0114355_1020387 | Not Available | 6843 | Open in IMG/M |
| 3300008120|Ga0114355_1043593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2103 | Open in IMG/M |
| 3300008120|Ga0114355_1058861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1698 | Open in IMG/M |
| 3300008120|Ga0114355_1064758 | Not Available | 2091 | Open in IMG/M |
| 3300008120|Ga0114355_1072118 | Not Available | 1460 | Open in IMG/M |
| 3300008120|Ga0114355_1217273 | Not Available | 596 | Open in IMG/M |
| 3300008258|Ga0114840_1010253 | Not Available | 1607 | Open in IMG/M |
| 3300009183|Ga0114974_10264858 | Not Available | 1023 | Open in IMG/M |
| 3300010354|Ga0129333_10069942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3261 | Open in IMG/M |
| 3300010354|Ga0129333_10070548 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3247 | Open in IMG/M |
| 3300010354|Ga0129333_10090000 | All Organisms → Viruses → Predicted Viral | 2839 | Open in IMG/M |
| 3300010354|Ga0129333_10252434 | Not Available | 1589 | Open in IMG/M |
| 3300010354|Ga0129333_10270154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1528 | Open in IMG/M |
| 3300010354|Ga0129333_11144855 | Not Available | 648 | Open in IMG/M |
| 3300012962|Ga0129335_1180243 | Not Available | 1017 | Open in IMG/M |
| 3300012968|Ga0129337_1377427 | Not Available | 516 | Open in IMG/M |
| 3300012970|Ga0129338_1380248 | Not Available | 757 | Open in IMG/M |
| 3300013087|Ga0163212_1111687 | Not Available | 874 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10103593 | All Organisms → Viruses → Predicted Viral | 1995 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10327437 | Not Available | 978 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10503243 | Not Available | 737 | Open in IMG/M |
| 3300013372|Ga0177922_10168498 | Not Available | 938 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10058334 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3010 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10263248 | Not Available | 1051 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10674705 | Not Available | 561 | Open in IMG/M |
| 3300017788|Ga0169931_10014457 | Not Available | 10677 | Open in IMG/M |
| 3300017788|Ga0169931_10069818 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3575 | Open in IMG/M |
| 3300017788|Ga0169931_10073309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3458 | Open in IMG/M |
| 3300017788|Ga0169931_10663238 | Not Available | 694 | Open in IMG/M |
| 3300020074|Ga0194113_10139098 | Not Available | 2038 | Open in IMG/M |
| 3300020074|Ga0194113_10225550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1476 | Open in IMG/M |
| 3300020074|Ga0194113_10607574 | Not Available | 770 | Open in IMG/M |
| 3300020506|Ga0208091_1000476 | Not Available | 7301 | Open in IMG/M |
| 3300024289|Ga0255147_1000266 | Not Available | 18150 | Open in IMG/M |
| 3300024289|Ga0255147_1017141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1538 | Open in IMG/M |
| 3300024306|Ga0255148_1064289 | Not Available | 638 | Open in IMG/M |
| 3300024352|Ga0255142_1019325 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1098 | Open in IMG/M |
| 3300024481|Ga0256330_1096214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
| 3300024531|Ga0255228_1083722 | Not Available | 645 | Open in IMG/M |
| 3300024557|Ga0255283_1027997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1247 | Open in IMG/M |
| 3300024561|Ga0255288_1120153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
| 3300024570|Ga0255276_1079975 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300024864|Ga0255271_1024197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1316 | Open in IMG/M |
| 3300024866|Ga0255272_1024231 | Not Available | 1520 | Open in IMG/M |
| 3300024866|Ga0255272_1033565 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1298 | Open in IMG/M |
| 3300025283|Ga0208048_1066145 | Not Available | 824 | Open in IMG/M |
| 3300026562|Ga0255285_1100445 | Not Available | 557 | Open in IMG/M |
| 3300026569|Ga0255277_1044673 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1157 | Open in IMG/M |
| 3300026570|Ga0255274_1070050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 912 | Open in IMG/M |
| 3300026572|Ga0255270_1005648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2837 | Open in IMG/M |
| 3300026573|Ga0255269_1219892 | Not Available | 504 | Open in IMG/M |
| 3300027396|Ga0255146_1119109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
| 3300027793|Ga0209972_10015958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4775 | Open in IMG/M |
| 3300027793|Ga0209972_10029038 | All Organisms → Viruses → Predicted Viral | 3226 | Open in IMG/M |
| 3300027793|Ga0209972_10098021 | All Organisms → Viruses → Predicted Viral | 1477 | Open in IMG/M |
| 3300027793|Ga0209972_10208606 | Not Available | 901 | Open in IMG/M |
| 3300027805|Ga0209229_10026757 | All Organisms → cellular organisms → Bacteria | 2512 | Open in IMG/M |
| 3300027816|Ga0209990_10096148 | Not Available | 1442 | Open in IMG/M |
| 3300028103|Ga0255172_1074949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
| 3300028112|Ga0256335_1182725 | Not Available | 544 | Open in IMG/M |
| 3300028286|Ga0256331_1054515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 907 | Open in IMG/M |
| 3300031758|Ga0315907_10012840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 8146 | Open in IMG/M |
| 3300031758|Ga0315907_10042388 | Not Available | 4036 | Open in IMG/M |
| 3300031758|Ga0315907_10127280 | All Organisms → cellular organisms → Bacteria | 2170 | Open in IMG/M |
| 3300031758|Ga0315907_10173646 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1817 | Open in IMG/M |
| 3300031758|Ga0315907_10342742 | Not Available | 1217 | Open in IMG/M |
| 3300031787|Ga0315900_10262794 | Not Available | 1463 | Open in IMG/M |
| 3300031857|Ga0315909_10031584 | Not Available | 5128 | Open in IMG/M |
| 3300031857|Ga0315909_10118083 | Not Available | 2248 | Open in IMG/M |
| 3300031857|Ga0315909_10203685 | Not Available | 1565 | Open in IMG/M |
| 3300031857|Ga0315909_10361055 | Not Available | 1057 | Open in IMG/M |
| 3300031857|Ga0315909_10659433 | Not Available | 687 | Open in IMG/M |
| 3300031951|Ga0315904_10297970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1513 | Open in IMG/M |
| 3300031951|Ga0315904_10325227 | Not Available | 1428 | Open in IMG/M |
| 3300031951|Ga0315904_11461828 | Not Available | 506 | Open in IMG/M |
| 3300032116|Ga0315903_10009042 | Not Available | 12129 | Open in IMG/M |
| 3300032116|Ga0315903_10336800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1256 | Open in IMG/M |
| 3300032116|Ga0315903_11156899 | Not Available | 526 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 17.95% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 17.09% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 16.24% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 11.97% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 10.26% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 5.98% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.27% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.42% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 3.42% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 2.56% |
| Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 1.71% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.85% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.85% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.85% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.85% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.85% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001836 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM27, ROCA_DNA191_0.2um_MCP-N_C_3a | Environmental | Open in IMG/M |
| 3300001839 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM40, ROCA_DNA238_2.0um_Ob_C_3b | Environmental | Open in IMG/M |
| 3300001849 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM26, ROCA_DNA190_2.0um_MCP-N_C_2b | Environmental | Open in IMG/M |
| 3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005758 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007169 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007171 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007304 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300012962 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024306 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h | Environmental | Open in IMG/M |
| 3300024352 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300024481 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024531 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024557 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024561 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024570 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024864 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024866 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025283 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L (SPAdes) | Environmental | Open in IMG/M |
| 3300026562 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026569 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026570 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026572 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027396 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8h | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028103 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d | Environmental | Open in IMG/M |
| 3300028112 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028286 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| RCM27_10043681 | 3300001836 | Marine Plankton | VDYIQDHIRDSIIKEIKDLELPYEWKPSEVINYIVRMIDKNGQAPR* |
| RCM40_10266407 | 3300001839 | Marine Plankton | VDYIQDHIRDSIIKEIENLELPYEWKPSEVINYIVRMIDKNGQAPR* |
| RCM26_12561761 | 3300001849 | Marine Plankton | MVEDYIQDKVRRDIVKEIRNLELPEEWKTQQVIDYIIRKIEIK* |
| GOS2236_10031915 | 3300001968 | Marine | KVRRDIIKEIGNLELPEEWKPHQVIDYIIRKIDKK* |
| GOS2236_10498744 | 3300001968 | Marine | MVEEYLTEKVRRDIIKEIGNLELPEEWKPQQVIDYIIRKIDKK* |
| GOS2236_10541468 | 3300001968 | Marine | VEEYLIEKVRKDIIKEIGNLELPKEWKPQQVIDYIIRKIDKK* |
| GOS2236_10760492 | 3300001968 | Marine | MVEDYLQEKVRRDIIKDIRNLELPEEWKPQQVIDYIIRKIDKK* |
| Ga0068877_102710016 | 3300005525 | Freshwater Lake | VEEYLQEKVRRDVIKEISNLELPDEWKPHQVIDYIIRKINKK* |
| Ga0068877_105804062 | 3300005525 | Freshwater Lake | MVEEYLQEKVRRDIIKEIGNLELPNEWKPQQVIDYIIRKIEIK* |
| Ga0068876_100135253 | 3300005527 | Freshwater Lake | MQDYIDTKVRQDIVNQISNLELPEDWKPQQVIDYIIRKIDKDNVR* |
| Ga0068876_100210132 | 3300005527 | Freshwater Lake | MVEDYIDTKIRRDIIKQIRNLELPKDWKTQQVIDYIIRKIDKDNVEKV* |
| Ga0068872_103053213 | 3300005528 | Freshwater Lake | MVEDYIDTKIRRDIIKQIRNLELPKDWKTQQVIDYIIRKIDKDNVEKA* |
| Ga0078894_111651523 | 3300005662 | Freshwater Lake | NNIVEDYIQEKVRRDIVKEIGNLELPDNWKPQQVIDYIIRKIDKK* |
| Ga0078117_100969511 | 3300005758 | Lake Water | MVEEYLQEKVRRDVIKEISNLELPNEWKPQQVIDYIIRKIDKK* |
| Ga0078117_10236919 | 3300005758 | Lake Water | MVEDYLQDKVRRDIIKEIRNLELPNEWKTQQVIDYIIRKIDKK* |
| Ga0079957_10557493 | 3300005805 | Lake | MEDYLDDKVRRDIVKQISNLELPEEWKPYQVIDYIIRKINKK* |
| Ga0075473_101212742 | 3300006875 | Aqueous | MVEDYIQDKVRRDVIKEIRNLELPNDWKPQQVIDYIIRKIDKE* |
| Ga0102976_10259886 | 3300007169 | Freshwater Lake | EDYIQDKVRRDIIKEIRNLELPKEWEPQMVIDYIIRKIDKK* |
| Ga0102977_10222552 | 3300007171 | Freshwater Lake | VEDYIENKVREEIVKELSNLELPYEWKPKEVINFIIRKIQK* |
| Ga0102978_12261698 | 3300007177 | Freshwater Lake | MVDDYIDQKVRRDIIKEIRNLELPNEWNPQQVIDYIIRKIDKN* |
| Ga0102689_18142581 | 3300007304 | Freshwater Lake | DTKIRRDIIKQIRNLELPKDWKTQQVIDYIIRKIDKDNVEKV* |
| Ga0114340_10102928 | 3300008107 | Freshwater, Plankton | MVEEYLQEKIRRDVIKEISNLEFPNEWNPQQVIDYIIRKIERQ* |
| Ga0114340_11131663 | 3300008107 | Freshwater, Plankton | MVEEYLQEKVRRDVVKEISNLELPDNWKPQQVIDYIIRKITK* |
| Ga0114347_10102469 | 3300008114 | Freshwater, Plankton | VEDYIDNSVRRDIIKDISNLELPDDWKPNQVIDYIIRKIDKK* |
| Ga0114347_10194592 | 3300008114 | Freshwater, Plankton | MLEEYIENKVRQDIIKEINNLELPHEWKPKEVINFIIRKIDKGNVK* |
| Ga0114347_10859731 | 3300008114 | Freshwater, Plankton | EEYLQEKVRRDVIKEISNLELPDEWKPHQVIDYIIRKINKK* |
| Ga0114350_100176718 | 3300008116 | Freshwater, Plankton | MVEDYIDIKIRRDIIKQISDLELPEDWKTQQVIDYIIRKIDKDNVR* |
| Ga0114350_10179562 | 3300008116 | Freshwater, Plankton | VEEYLDEKVRRDVIKEIGNLELPEEWNPQQVIDYIIRKIEIK* |
| Ga0114350_102002015 | 3300008116 | Freshwater, Plankton | VEDYIDNSVRRDIIKDIRNLELPEDWKPNQVIDYIIRKIDKK* |
| Ga0114350_10436552 | 3300008116 | Freshwater, Plankton | VEEYLQEKVRRDVIKEISNLELPEEWKPQQVIDYIIRKINRK* |
| Ga0114350_10477559 | 3300008116 | Freshwater, Plankton | MVEDYIQEKVRRDIVKDILDLELPETWKPQQVIDYIIRKIDKK* |
| Ga0114350_10883252 | 3300008116 | Freshwater, Plankton | VEEYLDEKVRRDVIKEIGDLELPEEWKPHQVIDYIIRKINRK* |
| Ga0114350_11909432 | 3300008116 | Freshwater, Plankton | MVEDYIDSKIRRDLAKQIRDLELPPDWRTKDVINYILRI |
| Ga0114351_10588178 | 3300008117 | Freshwater, Plankton | KVRRDIIKDILNLELPNDWEPHQVIDYIIRKIDKK* |
| Ga0114355_10203879 | 3300008120 | Freshwater, Plankton | MEDYIDNSVRRDIIKDIRNLELPDDWKPNQVIDYIIGKIDKK* |
| Ga0114355_10435931 | 3300008120 | Freshwater, Plankton | MVEEYLIEKVRRDIIKEIGNLELPNEWKPQQVIDYIIRKIEKK* |
| Ga0114355_10588611 | 3300008120 | Freshwater, Plankton | VEEYLDEKVRRDVIKEIGDLELPEEWKPQQVIDYIIRKINRK* |
| Ga0114355_10647581 | 3300008120 | Freshwater, Plankton | RRDIIKQIRNLELPKDWKTQQVIDYIIRKIDKDNVEKA* |
| Ga0114355_10721186 | 3300008120 | Freshwater, Plankton | RRDIIKQIRNLELPKDWKTQQVIDYIIRKIDKDNVEKV* |
| Ga0114355_12172733 | 3300008120 | Freshwater, Plankton | MVEEYLEQKIRRDIIKEIGNLELPEEWNPQQVIDYIIRKIEIK* |
| Ga0114840_10102531 | 3300008258 | Freshwater, Plankton | YIDNSVRRDIIKDISNLELPDDWKPNQVIDYIIRKIDKK* |
| Ga0114974_102648582 | 3300009183 | Freshwater Lake | VEDYIDNSVRRDIIKDIRNLELPDDWKPNQVIDYIIGKIDKK* |
| Ga0129333_100699422 | 3300010354 | Freshwater To Marine Saline Gradient | MEDYIQDKVRQDIIKEISNLELPYEWKPREVIAYIIRKIDKK* |
| Ga0129333_100705483 | 3300010354 | Freshwater To Marine Saline Gradient | VEEYLQEKIRRDVIKEISNLELPEEWKPQQVIDYIIRKINRK* |
| Ga0129333_100900002 | 3300010354 | Freshwater To Marine Saline Gradient | VRDYIDYKVRADIIKEITDLELPEDWKTKQVIDYIVRKINKDNVR* |
| Ga0129333_102524342 | 3300010354 | Freshwater To Marine Saline Gradient | VEEYLQEKVRKDIIREIGNLELPKEWEPQMVIDYIIRKIDKK* |
| Ga0129333_102701542 | 3300010354 | Freshwater To Marine Saline Gradient | MVEEYLQEKVRRDVINEISNLELPEEWKPQQVIDYIIRKINKI* |
| Ga0129333_109963691 | 3300010354 | Freshwater To Marine Saline Gradient | MLEEYIENKVRQDIIKEINNLELPNEWNPKEVINFIIRKIDKGNVK* |
| Ga0129333_111448552 | 3300010354 | Freshwater To Marine Saline Gradient | MVEDYIQEKVRRDVIKEISNLELPNDWKPYQVIDYIIRKIDKK* |
| Ga0129335_11802435 | 3300012962 | Aqueous | EEYLQEKVRKDIIREIGNLELPKEWEPQMVIDYIIRKIDKK* |
| Ga0129337_13774271 | 3300012968 | Aqueous | YIQDKVRRDIIKDILNLELPNEWEPHQVIDYIIRKINKK* |
| Ga0129338_13802481 | 3300012970 | Aqueous | DKVRRDIVKQISNLELPEEWKPYQVIDYIIRKINKK* |
| Ga0163212_11116871 | 3300013087 | Freshwater | VEDYINNKVRQDIIKEISNLELPESWKPKMVIDYII |
| (restricted) Ga0172367_101035939 | 3300013126 | Freshwater | YTVEDYIQDKVRRDIIKEIRNLELPKEWEPQMVIDYIIRKIDKNNV* |
| (restricted) Ga0172367_102299802 | 3300013126 | Freshwater | VEDYIENKVRQEIIKELSNLELPYEWKPKEVIDFIIRKIEK* |
| (restricted) Ga0172373_103274372 | 3300013131 | Freshwater | VEDYIQDKVRRDIIKEIRNLELPKEWEPQMVIDYIIRKIDKNNV* |
| (restricted) Ga0172373_105032432 | 3300013131 | Freshwater | MVEDYVQEKVRQDIIKDILNLELPETWKPQQVIDYIIRKIDKK* |
| (restricted) Ga0172372_101732621 | 3300013132 | Freshwater | IENKVRQEIIKELSNLELPYEWKPKEVIDFIIRKIEK* |
| Ga0177922_101684983 | 3300013372 | Freshwater | MVEEYLQEKIRRDVIKEISNLEFPNDWNPQQVIDYIIRKIERQ* |
| (restricted) Ga0172376_1005833410 | 3300014720 | Freshwater | MVEDYIQDKVRRDIIKEISNLELPNEWKPQQVIDYIIRKIDKK* |
| (restricted) Ga0172376_102632485 | 3300014720 | Freshwater | MVEDYIQDKVRRDIIKEIRNLELPEDWKPQMVIDYIIRKIDKK* |
| (restricted) Ga0172376_106747051 | 3300014720 | Freshwater | MVEDYIQDKVRRDIIKEIRNLELPKEWEPQMVIDYIIRKIDKNNV* |
| Ga0169931_1001445723 | 3300017788 | Freshwater | VEDYIENKVRQEIIKELSNLELPHEWKPKEVIDFIIRKIKKE |
| Ga0169931_1006981810 | 3300017788 | Freshwater | MVEDYVQEKVRQDIIKDILNLELPETWKPQQVIDYIIRKIDKK |
| Ga0169931_100733091 | 3300017788 | Freshwater | MVEDYIQDKVRRDIIKEISNLELPNEWKPQQVIDYIIRKIDKK |
| Ga0169931_106632382 | 3300017788 | Freshwater | MVEDYIQDKVRRDIIKEIRNLELPEDWKPQMVIDYIIRKIDKK |
| Ga0194113_101390982 | 3300020074 | Freshwater Lake | VEDYINNKVRQDIIKEISNLELPESWKPKMVIDYIIEKINKK |
| Ga0194113_102255502 | 3300020074 | Freshwater Lake | VEDYINNKVRRDIIKEIRNLELPEDWKPQMVIDYILRKIDKE |
| Ga0194113_106075742 | 3300020074 | Freshwater Lake | VEDYINNKVRQDIINEIRNLELPEDWKPQMVIDYILRKIDRE |
| Ga0208091_100047612 | 3300020506 | Freshwater | VEDYIDNSVRRDIIKDISNLELPDDWKPNQVIDYIIRKIDKK |
| Ga0255147_100026629 | 3300024289 | Freshwater | MVEEYLQEKVRRDIIKEISNLELPNEWKPQQVIDYIIRKINKK |
| Ga0255147_10171412 | 3300024289 | Freshwater | MVEEYLIEKVRRDIIKEIGNLELPNEWKPQQVIDYIIRKIEKK |
| Ga0255148_10642892 | 3300024306 | Freshwater | MVEDYIQDKVRRDIIKDILNLELPNEWEPHQVIDYIIRKIDKK |
| Ga0255142_10193252 | 3300024352 | Freshwater | MVEDYIQDKVRRDIIKEIRNLELPNNWKPEQVIDYIIRKIDKK |
| Ga0256330_10962142 | 3300024481 | Freshwater | LQEKVRRDIIKEISNLELPNEWKPQQVIDYIIRKINKK |
| Ga0255228_10837222 | 3300024531 | Freshwater | MVEDYIQDKVRRDIIQEIRDLELPNEWEPQMVIDYII |
| Ga0255283_10279976 | 3300024557 | Freshwater | EDYIQDKVRRDIINEIRNLELPIEWKPQQVIDYIIRKINKE |
| Ga0255288_11201531 | 3300024561 | Freshwater | NMVEDYIQDKVRRDIINEIRNLELPIEWKPQQVIDYIIRKINKE |
| Ga0255276_10799752 | 3300024570 | Freshwater | MVEDYIQDKVRRDIIREIRNLELPKEWEPQIVIDYIIRKIDKK |
| Ga0255271_10241971 | 3300024864 | Freshwater | EKVRRDIIKEISNLELPNEWKPQQVIDYIIRKINKK |
| Ga0255272_10242314 | 3300024866 | Freshwater | MVEDYIQDKVIRDIIREIRNLELPKEWEPQIVIDYIIRKIDKK |
| Ga0255272_10335651 | 3300024866 | Freshwater | DKVRRDIINEIRNLELPIEWKPQQVIDYIIRKINKE |
| Ga0208048_10661451 | 3300025283 | Freshwater | VVEDYINNKVRQDIIKEISNLELPESWKPKMVIDYII |
| Ga0255285_11004451 | 3300026562 | Freshwater | IEDKVRRDIIKDILNLELPNEWEPHQVIDYIIRKIDKK |
| Ga0255277_10446732 | 3300026569 | Freshwater | MVEEYLIEKVRRDIIKEIGNLELPNEWKPQQVIDYIIRKI |
| Ga0255274_10700502 | 3300026570 | Freshwater | VEDYIQDKVRRDIIKDILNLELPNDWEPHQVIDYIIR |
| Ga0255270_10056482 | 3300026572 | Freshwater | MVEEYLQEKVRRDIIKEISNLEIPNERKPKQVIDYIIRKINKK |
| Ga0255269_12198922 | 3300026573 | Freshwater | MVEDYIQDKVRRDIIREIRNLELPNEWKPQMVIDYIIRKID |
| Ga0255146_11191091 | 3300027396 | Freshwater | QDKVRRDIINEIRNLELPIEWKPQQVIDYIIRKINKE |
| Ga0209972_100159583 | 3300027793 | Freshwater Lake | VEEYLQEKVRRDVIKEISNLELPDEWKPHQVIDYIIRKINKK |
| Ga0209972_100290383 | 3300027793 | Freshwater Lake | VEEYLQEKVRRDVIKEISNLELPEEWKPQQVIDYIIRKINRK |
| Ga0209972_100980216 | 3300027793 | Freshwater Lake | YIQDKVRRDIIKDILNLELPNDWEPHQVIDYIIRKIDKK |
| Ga0209972_102086061 | 3300027793 | Freshwater Lake | VEEYLDEKVRRDVIKEIGDLELPEEWKPQQVIDYIIRKINR |
| Ga0209229_100267575 | 3300027805 | Freshwater And Sediment | VEEYLEQKVRRDIIKEIGNLELPEEWKPQQVIDYIIRKIEIK |
| Ga0209990_100961482 | 3300027816 | Freshwater Lake | MVEDYIDTKIRRDIIKQIRNLELPKDWKTQQVIDYIIRKIDKDNVEKV |
| Ga0255172_10749493 | 3300028103 | Freshwater | VEEYLTEKVRRDIIKEISNLELPEEWKPHQVIDYIIRKINNVK |
| Ga0256335_11827251 | 3300028112 | Freshwater | VEDYIQDKVRRDIINEIRNLELPIEWKPQQVIDYIIRKINKE |
| Ga0256331_10545151 | 3300028286 | Freshwater | VEDYIQDKVRRDIIKDILNLELPNDWEPHQVIDYII |
| Ga0315907_100128406 | 3300031758 | Freshwater | MQDYIDTKVRQDIVNQISNLELPEDWKPQQVIDYIIRKIDKDNVR |
| Ga0315907_100423884 | 3300031758 | Freshwater | MVEDYIDIKIRRDIIKQISDLELPEDWKTQQVIDYIIRKIDKDNVR |
| Ga0315907_101272802 | 3300031758 | Freshwater | VEEYLDEKVRRDVIKEIGDLELPEEWKPQQVIDYIIRKINRK |
| Ga0315907_101736462 | 3300031758 | Freshwater | MVEEYLQEKVRRDIIKEIGNLELPNEWKPQQVIDYIIRKIEIK |
| Ga0315907_101831274 | 3300031758 | Freshwater | MLEEYIENKVRQDIIKEINNLELPHEWKPKEVINFIIRKIDKGNVK |
| Ga0315907_103427425 | 3300031758 | Freshwater | MVEDYIDTKIRRDIIKQIRNLELPKDWKTQQVIDYIIRKIDKDNVEKA |
| Ga0315900_102402614 | 3300031787 | Freshwater | VEDYIENKVRQEIIKELSNLELPYEWKPSEVIRFIIRKIEK |
| Ga0315900_102627947 | 3300031787 | Freshwater | IIKQIRNLELPKDWKTQQVIDYIIRKIDKDNVEKA |
| Ga0315909_100315849 | 3300031857 | Freshwater | MVEDYIQEKVRRDIVKDILDLELPETWKPQQVIDYIIRKIDKK |
| Ga0315909_101180832 | 3300031857 | Freshwater | VEDYIDNSVRRDIIKDIRNLELPEDWKPNQVIDYIIRKIDKK |
| Ga0315909_102036851 | 3300031857 | Freshwater | NIVEEYLQEKVRRDIAKEIGNLELPKEWEPQQVIDYIIRKIIK |
| Ga0315909_103610552 | 3300031857 | Freshwater | MEDYIDNSVRRDIIKDIRNLELPDDWKPNQVIDYIIGKIDKK |
| Ga0315909_106594333 | 3300031857 | Freshwater | MVEEYLQEKIRRDVIKEISNLEFPNEWNPQQVIDYIIRKIERQ |
| Ga0315904_102979703 | 3300031951 | Freshwater | MVEDYIDTNIRRDIITQIRNLELPEEWKAQQVIDYIIRKIDKDNVEKV |
| Ga0315904_103252272 | 3300031951 | Freshwater | VEEYLDEKVRRDVIKEIGDLELPEEWKPHQVIDYIIRKINRK |
| Ga0315904_114618282 | 3300031951 | Freshwater | NRVMEDYIQDKVRQDIIKEISNLELPYEWKPREVIAYIIRKIDKK |
| Ga0315903_1000904211 | 3300032116 | Freshwater | MVEDYIQDKVRRDIIREIRDLELPNEWEPQMVIDYIIRKIDKK |
| Ga0315903_103368001 | 3300032116 | Freshwater | VEDYIQDKVRRDIIKDILNLELPNDWEPHQVIDYIIRKIDKK |
| Ga0315903_111568991 | 3300032116 | Freshwater | EQKVRRDIIKEIGNLELPEEWNPQQVIDYIIRKIEIK |
| ⦗Top⦘ |