


| Basic Information | |
|---|---|
| Family ID | F076253 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 118 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MTTVEFITALFYEVDEQLRAIPKHPEAHLWPSEVV |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 87.93 % |
| % of genes near scaffold ends (potentially truncated) | 81.36 % |
| % of genes from short scaffolds (< 2000 bps) | 93.22 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.780 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (29.661 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.678 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.610 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.75% β-sheet: 0.00% Coil/Unstructured: 68.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF13450 | NAD_binding_8 | 1.69 |
| PF00873 | ACR_tran | 0.85 |
| PF14417 | MEDS | 0.85 |
| PF12680 | SnoaL_2 | 0.85 |
| PF08497 | Radical_SAM_N | 0.85 |
| PF14104 | DUF4277 | 0.85 |
| PF02028 | BCCT | 0.85 |
| PF03050 | DDE_Tnp_IS66 | 0.85 |
| PF04966 | OprB | 0.85 |
| PF01656 | CbiA | 0.85 |
| PF13565 | HTH_32 | 0.85 |
| PF13714 | PEP_mutase | 0.85 |
| PF00589 | Phage_integrase | 0.85 |
| PF13744 | HTH_37 | 0.85 |
| PF00355 | Rieske | 0.85 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.85 |
| PF13551 | HTH_29 | 0.85 |
| PF00239 | Resolvase | 0.85 |
| PF13613 | HTH_Tnp_4 | 0.85 |
| PF06751 | EutB | 0.85 |
| PF13358 | DDE_3 | 0.85 |
| PF01610 | DDE_Tnp_ISL3 | 0.85 |
| PF02629 | CoA_binding | 0.85 |
| PF02810 | SEC-C | 0.85 |
| PF13340 | DUF4096 | 0.85 |
| PF02416 | TatA_B_E | 0.85 |
| PF12778 | PXPV | 0.85 |
| PF01797 | Y1_Tnp | 0.85 |
| PF01179 | Cu_amine_oxid | 0.85 |
| PF01425 | Amidase | 0.85 |
| PF13365 | Trypsin_2 | 0.85 |
| PF04892 | VanZ | 0.85 |
| PF00561 | Abhydrolase_1 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.85 |
| COG1032 | Radical SAM superfamily enzyme YgiQ, UPF0313 family | General function prediction only [R] | 0.85 |
| COG1292 | Choline-glycine betaine transporter | Cell wall/membrane/envelope biogenesis [M] | 0.85 |
| COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 0.85 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.85 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.85 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.85 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.85 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.85 |
| COG3659 | Carbohydrate-selective porin OprB | Cell wall/membrane/envelope biogenesis [M] | 0.85 |
| COG3733 | Cu2+-containing amine oxidase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.85 |
| COG4303 | Ethanolamine ammonia-lyase, large subunit | Amino acid transport and metabolism [E] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.78 % |
| All Organisms | root | All Organisms | 43.22 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000890|JGI11643J12802_12034892 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300005294|Ga0065705_10174064 | All Organisms → cellular organisms → Bacteria | 1645 | Open in IMG/M |
| 3300005569|Ga0066705_10116271 | All Organisms → cellular organisms → Bacteria | 1608 | Open in IMG/M |
| 3300005764|Ga0066903_104668259 | Not Available | 729 | Open in IMG/M |
| 3300005842|Ga0068858_102543455 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005843|Ga0068860_102485896 | Not Available | 538 | Open in IMG/M |
| 3300006194|Ga0075427_10067161 | Not Available | 635 | Open in IMG/M |
| 3300007076|Ga0075435_100991295 | Not Available | 734 | Open in IMG/M |
| 3300009012|Ga0066710_101016120 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 1280 | Open in IMG/M |
| 3300009012|Ga0066710_102000228 | Not Available | 859 | Open in IMG/M |
| 3300009012|Ga0066710_104616856 | Not Available | 515 | Open in IMG/M |
| 3300009038|Ga0099829_11564537 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300009089|Ga0099828_10180586 | Not Available | 1877 | Open in IMG/M |
| 3300009089|Ga0099828_11985964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
| 3300009137|Ga0066709_101418415 | Not Available | 1008 | Open in IMG/M |
| 3300009147|Ga0114129_10850749 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300009553|Ga0105249_10945655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 930 | Open in IMG/M |
| 3300009553|Ga0105249_11373366 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300009553|Ga0105249_12429978 | Not Available | 596 | Open in IMG/M |
| 3300009812|Ga0105067_1010571 | Not Available | 1174 | Open in IMG/M |
| 3300010042|Ga0126314_11173316 | Not Available | 573 | Open in IMG/M |
| 3300010047|Ga0126382_11058640 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300010048|Ga0126373_12511686 | Not Available | 574 | Open in IMG/M |
| 3300010358|Ga0126370_11518684 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Rhodothermus → Rhodothermus marinus | 637 | Open in IMG/M |
| 3300010358|Ga0126370_11675656 | Not Available | 611 | Open in IMG/M |
| 3300010358|Ga0126370_11689401 | Not Available | 609 | Open in IMG/M |
| 3300010359|Ga0126376_10639231 | Not Available | 1013 | Open in IMG/M |
| 3300010359|Ga0126376_10680575 | Not Available | 986 | Open in IMG/M |
| 3300010360|Ga0126372_10556518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Algicola → Algicola sagamiensis | 1091 | Open in IMG/M |
| 3300010366|Ga0126379_11541592 | Not Available | 770 | Open in IMG/M |
| 3300010397|Ga0134124_11412426 | Not Available | 722 | Open in IMG/M |
| 3300010398|Ga0126383_12888308 | Not Available | 561 | Open in IMG/M |
| 3300010399|Ga0134127_11799418 | Not Available | 689 | Open in IMG/M |
| 3300011269|Ga0137392_11121525 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 644 | Open in IMG/M |
| 3300011270|Ga0137391_11387881 | Not Available | 549 | Open in IMG/M |
| 3300012199|Ga0137383_10637014 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300012201|Ga0137365_10287643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1219 | Open in IMG/M |
| 3300012201|Ga0137365_10696529 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300012201|Ga0137365_11272880 | Not Available | 523 | Open in IMG/M |
| 3300012202|Ga0137363_10513721 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300012202|Ga0137363_11436873 | Not Available | 580 | Open in IMG/M |
| 3300012203|Ga0137399_10431280 | Not Available | 1101 | Open in IMG/M |
| 3300012204|Ga0137374_10164401 | Not Available | 1961 | Open in IMG/M |
| 3300012207|Ga0137381_10602781 | Not Available | 957 | Open in IMG/M |
| 3300012209|Ga0137379_10188565 | All Organisms → cellular organisms → Bacteria | 1975 | Open in IMG/M |
| 3300012211|Ga0137377_10324499 | Not Available | 1475 | Open in IMG/M |
| 3300012356|Ga0137371_10615140 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300012361|Ga0137360_10858321 | Not Available | 782 | Open in IMG/M |
| 3300012362|Ga0137361_10098821 | Not Available | 2534 | Open in IMG/M |
| 3300012362|Ga0137361_10755974 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300012362|Ga0137361_11235929 | Not Available | 670 | Open in IMG/M |
| 3300012399|Ga0134061_1139337 | Not Available | 633 | Open in IMG/M |
| 3300012582|Ga0137358_10300820 | Not Available | 1089 | Open in IMG/M |
| 3300012922|Ga0137394_10669904 | Not Available | 875 | Open in IMG/M |
| 3300012925|Ga0137419_10046226 | All Organisms → cellular organisms → Bacteria | 2781 | Open in IMG/M |
| 3300012929|Ga0137404_10100280 | All Organisms → cellular organisms → Bacteria | 2335 | Open in IMG/M |
| 3300012929|Ga0137404_11534390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 617 | Open in IMG/M |
| 3300012948|Ga0126375_10986212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 685 | Open in IMG/M |
| 3300012971|Ga0126369_10343995 | Not Available | 1511 | Open in IMG/M |
| 3300012971|Ga0126369_11320492 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 811 | Open in IMG/M |
| 3300012972|Ga0134077_10306107 | Not Available | 668 | Open in IMG/M |
| 3300015264|Ga0137403_10225646 | All Organisms → cellular organisms → Bacteria | 1794 | Open in IMG/M |
| 3300015371|Ga0132258_13681452 | Not Available | 1046 | Open in IMG/M |
| 3300015372|Ga0132256_102952605 | Not Available | 572 | Open in IMG/M |
| 3300016422|Ga0182039_11371031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 642 | Open in IMG/M |
| 3300017792|Ga0163161_11710516 | Not Available | 557 | Open in IMG/M |
| 3300017965|Ga0190266_10483229 | Not Available | 716 | Open in IMG/M |
| 3300018052|Ga0184638_1297025 | Not Available | 547 | Open in IMG/M |
| 3300018078|Ga0184612_10548829 | Not Available | 556 | Open in IMG/M |
| 3300018433|Ga0066667_10424868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1080 | Open in IMG/M |
| 3300019259|Ga0184646_1281475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → unclassified Acidiferrobacteraceae → Acidiferrobacteraceae bacterium | 641 | Open in IMG/M |
| 3300020170|Ga0179594_10031061 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 1706 | Open in IMG/M |
| 3300025923|Ga0207681_11013743 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300025927|Ga0207687_11204766 | Not Available | 651 | Open in IMG/M |
| 3300025932|Ga0207690_11443348 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300025961|Ga0207712_10856215 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300026121|Ga0207683_10857658 | Not Available | 843 | Open in IMG/M |
| 3300026536|Ga0209058_1144784 | Not Available | 1130 | Open in IMG/M |
| 3300027056|Ga0209879_1072527 | Not Available | 544 | Open in IMG/M |
| 3300027511|Ga0209843_1093722 | Not Available | 508 | Open in IMG/M |
| 3300027643|Ga0209076_1221068 | Not Available | 515 | Open in IMG/M |
| 3300027654|Ga0209799_1002962 | Not Available | 3435 | Open in IMG/M |
| 3300027654|Ga0209799_1017934 | All Organisms → cellular organisms → Bacteria | 1547 | Open in IMG/M |
| 3300027846|Ga0209180_10087085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1768 | Open in IMG/M |
| 3300027846|Ga0209180_10403484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 774 | Open in IMG/M |
| 3300027873|Ga0209814_10275895 | Not Available | 730 | Open in IMG/M |
| 3300027874|Ga0209465_10155233 | Not Available | 1137 | Open in IMG/M |
| 3300027882|Ga0209590_10028329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacula → Desulfobacula toluolica | 2926 | Open in IMG/M |
| 3300027882|Ga0209590_10209248 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 1235 | Open in IMG/M |
| 3300027882|Ga0209590_10777266 | Not Available | 609 | Open in IMG/M |
| 3300027882|Ga0209590_10800400 | Not Available | 599 | Open in IMG/M |
| 3300027907|Ga0207428_10141097 | All Organisms → cellular organisms → Bacteria | 1839 | Open in IMG/M |
| 3300031094|Ga0308199_1001708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2416 | Open in IMG/M |
| 3300031226|Ga0307497_10517906 | Not Available | 591 | Open in IMG/M |
| 3300031547|Ga0310887_11027067 | Not Available | 527 | Open in IMG/M |
| 3300031640|Ga0318555_10564653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 617 | Open in IMG/M |
| 3300031681|Ga0318572_10265203 | Not Available | 1011 | Open in IMG/M |
| 3300031736|Ga0318501_10271993 | Not Available | 900 | Open in IMG/M |
| 3300031740|Ga0307468_100750946 | Not Available | 824 | Open in IMG/M |
| 3300031763|Ga0318537_10042097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetota incertae sedis → Candidatus Hakubanella → Candidatus Hakubanella thermoalkaliphilus | 1646 | Open in IMG/M |
| 3300031770|Ga0318521_10871989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 550 | Open in IMG/M |
| 3300031771|Ga0318546_10991339 | Not Available | 591 | Open in IMG/M |
| 3300031798|Ga0318523_10478040 | Not Available | 617 | Open in IMG/M |
| 3300031805|Ga0318497_10120129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetota incertae sedis → Candidatus Hakubanella → Candidatus Hakubanella thermoalkaliphilus | 1422 | Open in IMG/M |
| 3300031896|Ga0318551_10789954 | Not Available | 552 | Open in IMG/M |
| 3300031910|Ga0306923_12102496 | Not Available | 570 | Open in IMG/M |
| 3300031946|Ga0310910_10244299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1402 | Open in IMG/M |
| 3300031954|Ga0306926_12155269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 622 | Open in IMG/M |
| 3300031954|Ga0306926_12778864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 529 | Open in IMG/M |
| 3300032000|Ga0310903_10225195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 890 | Open in IMG/M |
| 3300032002|Ga0307416_100307559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1579 | Open in IMG/M |
| 3300032174|Ga0307470_10814517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 725 | Open in IMG/M |
| 3300032261|Ga0306920_101756880 | Not Available | 877 | Open in IMG/M |
| 3300033289|Ga0310914_11645114 | Not Available | 546 | Open in IMG/M |
| 3300034643|Ga0370545_005079 | Not Available | 1749 | Open in IMG/M |
| 3300034673|Ga0314798_109870 | Not Available | 592 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 29.66% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.17% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.24% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.39% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.39% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.54% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.54% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.69% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.69% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.69% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.69% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.85% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.85% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009812 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012399 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034673 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11643J12802_120348921 | 3300000890 | Soil | MITVEFITALFSEVDEQLGAIPKHPEAHLWPSEVVTL |
| Ga0065705_101740641 | 3300005294 | Switchgrass Rhizosphere | MITVEFITALFYEVDEQLHAIPKHPEAHLWPSDAVTLGLLHALKG |
| Ga0066705_101162711 | 3300005569 | Soil | MITMDFITALFYEVDEQLGAIPKHPEAHLWPSEVV |
| Ga0066903_1046682593 | 3300005764 | Tropical Forest Soil | MMTVEFITALFYEVDEQLGAIPKHPEAHLWPSEVV |
| Ga0068858_1025434552 | 3300005842 | Switchgrass Rhizosphere | MTTEELITALFYEVDEQLHAIPKHPEAHLWPSEVV |
| Ga0068860_1024858962 | 3300005843 | Switchgrass Rhizosphere | MTTTIEFITALFCQVADQIPDIPKHPQASLWPSEVV |
| Ga0075427_100671611 | 3300006194 | Populus Rhizosphere | VITVEFITALFYEVDEQMRAIPKHPEAHLWPSEVVT |
| Ga0075435_1009912952 | 3300007076 | Populus Rhizosphere | MITVDFITALFYEVDEQIGAIPTHPEAHLWPSAVVTLGLLHALTVP* |
| Ga0066710_1010161201 | 3300009012 | Grasslands Soil | MITVEFITALFSEVDEQLRTIPKHPEAHLWPSEVV |
| Ga0066710_1020002281 | 3300009012 | Grasslands Soil | LPTAEFITALFCEVDELIGVIPKHPEANLWPSEVGPSG |
| Ga0066710_1046168561 | 3300009012 | Grasslands Soil | MTTTIDFITALFYEVDEQMGTIPKHPEAHLWPSEV |
| Ga0099829_115645371 | 3300009038 | Vadose Zone Soil | MTTVDFITALFYEVDEQLGAIPKHPEAHLWPSEVV |
| Ga0099828_101805861 | 3300009089 | Vadose Zone Soil | MTTVDFITALFYEIDEQLRAIPKHPAAHLWPSEVITLGLL |
| Ga0099828_119859642 | 3300009089 | Vadose Zone Soil | MTTLDFITALFSEVDDQMRDMPKHPDARLWPSEVV |
| Ga0066709_1014184151 | 3300009137 | Grasslands Soil | MTTVDCITALFYEVDEQLRALPKHPEARLWPSEVATLGLLHALKGEGN |
| Ga0114129_108507492 | 3300009147 | Populus Rhizosphere | MIPLDFLTALFYEVEEQLRTIPKPPEAHLWPSAVGTLGLLHALQGVGHRPF* |
| Ga0105249_109456552 | 3300009553 | Switchgrass Rhizosphere | MITVEFITALFSEVDEQLGAIPKHPEAHLWPSEVLTLGLL |
| Ga0105249_113733662 | 3300009553 | Switchgrass Rhizosphere | MTTVDFITALFYEVDEQLRAIPKHPEAHLWPSAVVTLGLLHALKGVG |
| Ga0105249_124299781 | 3300009553 | Switchgrass Rhizosphere | MTTTIEFITALFYHVDEKLHAIPKHPEAHLWPSEV |
| Ga0105067_10105712 | 3300009812 | Groundwater Sand | MTTVDFITALFYEVDEQMGAIPKHPEAHLWASPVHRRNFVR* |
| Ga0126314_111733161 | 3300010042 | Serpentine Soil | MSTLNLITALFYEVDEQLGALPTPPEAPLWPREVITLGLLQALTGGGNRA |
| Ga0126382_110586401 | 3300010047 | Tropical Forest Soil | MTTTVEFITALFYEVDEQLGAIPKHPEAHLWPSEV |
| Ga0126373_125116862 | 3300010048 | Tropical Forest Soil | MTTEELITALFYEVDEQLHAIPKHPEAHLWPSEVVSLGLLHALTVP* |
| Ga0126370_115186841 | 3300010358 | Tropical Forest Soil | MTTEELITALCYEVDEQLHAIPKHPEAHLWPSEVVTLG |
| Ga0126370_116756561 | 3300010358 | Tropical Forest Soil | MTTIEFITALFCQVDDQLAGFPKHPEAHLWPREVV |
| Ga0126370_116894012 | 3300010358 | Tropical Forest Soil | MMTVELITALFYEVDEQLRAIPKHPEAHLWPSEVV |
| Ga0126376_106392312 | 3300010359 | Tropical Forest Soil | MMTVEFITALFYEVDEQLGAIPKHPEAHLWPSEVVT |
| Ga0126376_106805751 | 3300010359 | Tropical Forest Soil | MTTTIEFITALFYEVDEQLGAIPKHPEAHLWPSEVV |
| Ga0126372_105565182 | 3300010360 | Tropical Forest Soil | MMTVEVITALFEEVAEQIGASPTHPEAHLWPSEVGRSGLGGR* |
| Ga0126379_115415921 | 3300010366 | Tropical Forest Soil | MMTVEFITALFYEVDEQIGAIPKHPEAHLWPSEVV |
| Ga0134124_114124261 | 3300010397 | Terrestrial Soil | GVEEPMTTTSDFITALFCQVDDHLAGLLKHPEAHLWPSAVVTLGLLHALTVP* |
| Ga0126383_128883081 | 3300010398 | Tropical Forest Soil | MTTVELITALFYEVDEQLHAIPKHPEAHLWPSEVV |
| Ga0134127_117994182 | 3300010399 | Terrestrial Soil | MTTVEFITALFYEVDEQLRAIPKHPEAHLWPSEVLTLGLLHALTVP* |
| Ga0137392_111215251 | 3300011269 | Vadose Zone Soil | MITVEFITALFYEVDEQLHTIPKHPEAHLWPSEVV |
| Ga0137391_113878811 | 3300011270 | Vadose Zone Soil | ESCMITVEFITALFYEVDEQLPAIPKHPEAHLWQ* |
| Ga0137383_106370142 | 3300012199 | Vadose Zone Soil | MTIVEFIAALFYEVDEQLRTMPKHPEAHLWPSEVV |
| Ga0137365_102876431 | 3300012201 | Vadose Zone Soil | MEEPMTTVEFITALFHHVDEPMRAMPKHPEARLWPSEV |
| Ga0137365_106965293 | 3300012201 | Vadose Zone Soil | MMTVEFITALFYEVDEQLRAIPKHPEAHLWPSEVV |
| Ga0137365_112728801 | 3300012201 | Vadose Zone Soil | MTTTIDFITALFYEVDEQMGAIPKHPEAHLWPSEVV |
| Ga0137363_105137211 | 3300012202 | Vadose Zone Soil | MTTVDVITALFYEVDEQLRTIPKHPEAHLWPSAVVTLGLLHALKGV |
| Ga0137363_114368731 | 3300012202 | Vadose Zone Soil | VSTIEFITALFYEVDEQLGAIPKHPEAHLWPSEVV |
| Ga0137399_104312801 | 3300012203 | Vadose Zone Soil | MTTVDFITALFSEVDEQLHAIPKHPEAPLWPSEVLTLGLLHALKG |
| Ga0137374_101644013 | 3300012204 | Vadose Zone Soil | MTTVDFITALFYEVDEQMGAIPKHPEAHLWPSEVV |
| Ga0137381_106027813 | 3300012207 | Vadose Zone Soil | ALFCQVDDQLSGLPKHPEAHLWPSEVVTLVRTHV* |
| Ga0137379_101885653 | 3300012209 | Vadose Zone Soil | MTTVEFITALFYEVDEQLRAIPKHPEAHLWPSEVV |
| Ga0137377_103244993 | 3300012211 | Vadose Zone Soil | MTTVEFITALFCEVDAQLHTIPKHPEAHLWPSEVGTLGL |
| Ga0137371_106151401 | 3300012356 | Vadose Zone Soil | MTTVDFITALFYEVDAQMRALPKHPEARLWPSEVV |
| Ga0137360_108583212 | 3300012361 | Vadose Zone Soil | MITVDCITALFYEVDEQMGAIPKHPKAHLWPSEVGTLGLLHARTVP* |
| Ga0137361_100988211 | 3300012362 | Vadose Zone Soil | MTTLDFITAFFYEVDEQLRAIPQHPEAHLWPSEIVTLGLLH |
| Ga0137361_107559742 | 3300012362 | Vadose Zone Soil | MSTVELITALFFEVDEQIGAIRKQPEGHLWPSEVVTLGLV |
| Ga0137361_112359291 | 3300012362 | Vadose Zone Soil | MITIDFITALFYQVDEQMGAIPKHPEAHLWPSDVVT |
| Ga0134061_11393372 | 3300012399 | Grasslands Soil | MTTVEFITALFYEVDEQLRTIPKHPEAHLWPSEVGTLGLLHALTVP* |
| Ga0137358_103008202 | 3300012582 | Vadose Zone Soil | MTTTIEFITALFYHVDEKLHAIPKHPEAHLWPSEVGTLGLLHALTVP* |
| Ga0137394_106699041 | 3300012922 | Vadose Zone Soil | MTTLDFITALFYEVDEQLRAIPKHPEAHLWPSEIVTLG |
| Ga0137419_100462261 | 3300012925 | Vadose Zone Soil | MEDTMTTLNFITALFCQVDDHLPTIPKHPEAHLWPSEIVTVG |
| Ga0137404_101002803 | 3300012929 | Vadose Zone Soil | MTTVDFITALFYEVDEQLRAIPKHPEAHLWPSEVV |
| Ga0137404_115343901 | 3300012929 | Vadose Zone Soil | MMTVELITALFYEVDEQLRPMPQHPEAHLWPSEVVTHPSQLKL* |
| Ga0126375_109862121 | 3300012948 | Tropical Forest Soil | MTTEELITALFYQVDNQLAGLLKHPEAHLWPSEVVILGLLHALKG |
| Ga0126369_103439953 | 3300012971 | Tropical Forest Soil | MTTVDLITALFYEVDEQLRTIPKHPEAHLWPSEVV |
| Ga0126369_113204922 | 3300012971 | Tropical Forest Soil | MTTPEFITALFYHVDEQLRTVPKPPAARRGPREVVP* |
| Ga0126369_125061312 | 3300012971 | Tropical Forest Soil | MTTTIEFITVLFCQVDDHLSAIPKHPEVPLRPREVITVGLGHAHTGVGT |
| Ga0134077_103061071 | 3300012972 | Grasslands Soil | MMTVECITALFSEVDEQIGAIPKHPEAHLWPSEVVTLGL |
| Ga0137403_102256464 | 3300015264 | Vadose Zone Soil | MTTIDFITALFYQVDEQMRAMPKHPDAHLWPSERP* |
| Ga0132258_136814523 | 3300015371 | Arabidopsis Rhizosphere | MTTTIEFITALFCQVDDQLAGLPKHPEAHLWPSEVV |
| Ga0132256_1029526051 | 3300015372 | Arabidopsis Rhizosphere | MSTVVLIAALFFEVDEQLRALPTHPEAHLWPSEVVTLGLVH |
| Ga0182039_113710311 | 3300016422 | Soil | MASFAMSTTMDFITALFCQVDDHLSAIPKHPEAHLWPSEV |
| Ga0163161_117105161 | 3300017792 | Switchgrass Rhizosphere | MTTWDLIIALFYHVDEQLHTMPKHPEAHLWPSEPM |
| Ga0190266_104832291 | 3300017965 | Soil | MTTVEFITALFYEVDEQLRTIPKHPEAHLWPSEVVIL |
| Ga0184638_12970251 | 3300018052 | Groundwater Sediment | MITLDFITALFYQVDEQMRALPKHPEAHLWPSEVV |
| Ga0184612_105488291 | 3300018078 | Groundwater Sediment | MTTLDFITALFYEVDEQLRAIPQHPEAHLWPSEVGTLGLLHALKGVGVVF |
| Ga0066667_104248681 | 3300018433 | Grasslands Soil | MTTTIEFRTALVCQVDDQLAGLPTHPEAPLWPSEVVT |
| Ga0184646_12814751 | 3300019259 | Groundwater Sediment | MTTLDFITALFYEVDEQLRAIPKHPHARRWPSEVGTLGLLHARKGG |
| Ga0179594_100310613 | 3300020170 | Vadose Zone Soil | MTTIDFITAFFYQVDEQMRASPTHPEAHLWPSEVG |
| Ga0207681_110137431 | 3300025923 | Switchgrass Rhizosphere | MTTTSDFITALFCQVDDHLAGLLKHPATHLWPSEV |
| Ga0207687_112047661 | 3300025927 | Miscanthus Rhizosphere | MTTVEFITALFYEVDEQLRAIPKHPEAHLWPSEVLTLGLLHALTVP |
| Ga0207690_114433481 | 3300025932 | Corn Rhizosphere | MTTVDFITALFYEVDEQLGTIPKHPEAHLWPSEVV |
| Ga0207712_108562152 | 3300025961 | Switchgrass Rhizosphere | MTTVDFITALFYEVDEQLRAIPKHPEAHLWPSAVVTLGLLHALKG |
| Ga0207683_108576582 | 3300026121 | Miscanthus Rhizosphere | EFITALFYDVDEQLHTIPKHPEAHLWPSAVVTLGLLHALTVP |
| Ga0209058_11447841 | 3300026536 | Soil | MSTVEFITALFFEVDEQLCAIPKHPEAHLWPSEVVT |
| Ga0209879_10725271 | 3300027056 | Groundwater Sand | MTTEEFITALFSEVDEQLRAIPKHPEAHLWPSAIVTLGLLHALKG |
| Ga0209843_10937221 | 3300027511 | Groundwater Sand | MTTVDFITALFYEVDEQMGAIPKHPEAHLWASPVHRRNFVR |
| Ga0209076_12210681 | 3300027643 | Vadose Zone Soil | MTVECITALFSEVDEQLGALPTHPEAHLWPSEVVPVGLLP |
| Ga0209799_10029624 | 3300027654 | Tropical Forest Soil | MATVEFITALFYEVDEQLGAIPKHPEAHLWPSEVATLGLLHALKGVAIGPSIAG |
| Ga0209799_10179341 | 3300027654 | Tropical Forest Soil | MTTTIELITALFSEVDEQLGAIPKHPDALLWPSEV |
| Ga0209180_100870853 | 3300027846 | Vadose Zone Soil | MITVEFITALFYEIDEQQRAIPKYPEAHLWPSEVVRS |
| Ga0209180_104034841 | 3300027846 | Vadose Zone Soil | MTTLEFITALFYEVDEQLRTIPKPPEAHLWPREVVT |
| Ga0209814_102758951 | 3300027873 | Populus Rhizosphere | MITVEFITVLFYEVDEQLRTIPKHPEAHLWPSEVITLGLL |
| Ga0209465_101552331 | 3300027874 | Tropical Forest Soil | MMTVELITALFYEVDEQLGAIPKHPEAHLWPSEVV |
| Ga0209590_100283292 | 3300027882 | Vadose Zone Soil | MITLDFITALFYQVDEQMRALPKHPEAHLWPGASKTEH |
| Ga0209590_102092481 | 3300027882 | Vadose Zone Soil | MITVEFITALFYEVDEQLRTIPKHPEAHLWPSAVVTLG |
| Ga0209590_107772662 | 3300027882 | Vadose Zone Soil | MTATIEFITALFCQVDDQLSGFPTHPEAHLWPSEVV |
| Ga0209590_108004002 | 3300027882 | Vadose Zone Soil | MTTTIEFITALFCQVDDHLPAIPKHPEAHLWPSEVV |
| Ga0207428_101410974 | 3300027907 | Populus Rhizosphere | MSTVEFITALFYEVDEQLRTIPKHPDAHLWPSEIVT |
| Ga0308199_10017081 | 3300031094 | Soil | MTTVECITALFYAVDEQMHALPKPPEAHLWPSEVGTLGLLHA |
| Ga0307497_105179062 | 3300031226 | Soil | MITVEFITALFYEVDEQLRAIPKHPEAHLWPSEAVTLGLL |
| Ga0310887_110270672 | 3300031547 | Soil | MTTWDLIIALFYHVDEQLHDMPKHREAHLWPSGVVT |
| Ga0318555_105646531 | 3300031640 | Soil | MITMDFITALFYEVDEQLGAIPTHPEAHLWPSEVL |
| Ga0318572_102652031 | 3300031681 | Soil | MTTIDVITALFYEVDEQMRLISTHLEAHLWPSEVVTLG |
| Ga0318501_102719931 | 3300031736 | Soil | MTTEELITALFSEVDEQLRTLPTHPEAYLWPSAVVTVGLLHALKGAGNQPCSRW |
| Ga0307468_1007509461 | 3300031740 | Hardwood Forest Soil | RGEESRMMTVAFITALFYEVDEQLGAIPKHPEAHLWPSAVVTLGLLHALTVP |
| Ga0318537_100420971 | 3300031763 | Soil | MTTEELITALFSEVDEQLRTIPQHPEAHRWPSAVVTLGLLH |
| Ga0318521_108719891 | 3300031770 | Soil | MTTEELITALFYEVDEQLRAIPKHPEAHLWPSAVVTLG |
| Ga0318546_109913391 | 3300031771 | Soil | MTTIDVITALFYEVDEQMRLISTHLEAHLWPSEVVT |
| Ga0318523_104780402 | 3300031798 | Soil | MTTTSEFITALFCQVDDHLAGLPTHPEAHLWPSEVITLG |
| Ga0318497_101201292 | 3300031805 | Soil | MTTEELITALFSEVDEQLRTLPTHPEAYLWPSAVVTVGLLHALKGAGNQPCSRWLTRASRPLLP |
| Ga0318551_107899541 | 3300031896 | Soil | MSTTMDFITALFCQVDDHLSAIPKHPEAHLWPSEV |
| Ga0306923_121024961 | 3300031910 | Soil | MTTTDEFITALFCQADDQLSGFPKHPEAHLWPSEVV |
| Ga0310912_107165632 | 3300031941 | Soil | MTTTSEFITAFFCQVDDHLAGLPTHPEAHLWPSEVITLGL |
| Ga0310910_102442993 | 3300031946 | Soil | MTTEELITALFSEVDEQLRTLPTHPEAYLWPSAVVTVGLLHAL |
| Ga0306926_121552692 | 3300031954 | Soil | MTVEFITALFYEVDEQLRAIPKHPEAHLWPSEVVT |
| Ga0306926_127788642 | 3300031954 | Soil | MTTTIEFITALFCQVDDHLAGLPKHPEAHLWPSEVLT |
| Ga0310903_102251952 | 3300032000 | Soil | MTTLGFISALFYEVDEPVHAIPKHPEAHLWPSEVITLCLLNARKGVGNH |
| Ga0307416_1003075591 | 3300032002 | Rhizosphere | LFYEVDEQLRTIPKHPEAHLWPSEVITLGLLHALKGMGNRPFYRW |
| Ga0307470_108145171 | 3300032174 | Hardwood Forest Soil | MTTVEFITALFYEVDEQMGAIPKHPEAHLWPSEVV |
| Ga0306920_1017568801 | 3300032261 | Soil | MTTVELITAVFSEVDEQIGAIPTPPEAHLWPSEVVTLG |
| Ga0310914_116451141 | 3300033289 | Soil | MTTWDFITALFYHVDEQLPDIPKHPEAHLWPSEVV |
| Ga0370545_005079_3_113 | 3300034643 | Soil | MTTTGAFSTALCDAVDAQLHALPSHPEAHLWPSEVVT |
| Ga0314798_109870_3_125 | 3300034673 | Soil | MSTVEFITALFYEVDKQMRAIPKHPEAHRWPSEVVPLGLLH |
| ⦗Top⦘ |