


| Basic Information | |
|---|---|
| Family ID | F076121 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 118 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MNEKAADKKIKRNLEHAAAMIMCWIPKEKRNQYLNYFYSLFTDE |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 50.43 % |
| % of genes near scaffold ends (potentially truncated) | 25.42 % |
| % of genes from short scaffolds (< 2000 bps) | 61.02 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.61 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (67.797 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (21.186 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.932 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (95.763 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.61% β-sheet: 0.00% Coil/Unstructured: 51.39% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.61 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF00565 | SNase | 14.41 |
| PF11397 | GlcNAc | 13.56 |
| PF00436 | SSB | 4.24 |
| PF10592 | AIPR | 3.39 |
| PF00296 | Bac_luciferase | 3.39 |
| PF01844 | HNH | 2.54 |
| PF04860 | Phage_portal | 2.54 |
| PF00041 | fn3 | 1.69 |
| PF07728 | AAA_5 | 1.69 |
| PF03237 | Terminase_6N | 1.69 |
| PF03969 | AFG1_ATPase | 1.69 |
| PF09723 | Zn-ribbon_8 | 1.69 |
| PF13459 | Fer4_15 | 1.69 |
| PF10145 | PhageMin_Tail | 1.69 |
| PF01638 | HxlR | 0.85 |
| PF01527 | HTH_Tnp_1 | 0.85 |
| PF00856 | SET | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 4.24 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 4.24 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 3.39 |
| COG1485 | Cell division protein ZapE (Z ring-associated ATPase), AFG1 superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 1.69 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 67.80 % |
| All Organisms | root | All Organisms | 32.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573027|GS312G0146KB_1113212338886 | Not Available | 699 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10009878 | Not Available | 5111 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10021170 | All Organisms → cellular organisms → Bacteria | 3379 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10061664 | Not Available | 1568 | Open in IMG/M |
| 3300000401|BB_Man_B_Liq_inBBDRAFT_1028911 | Not Available | 640 | Open in IMG/M |
| 3300001962|GOS2239_1014159 | All Organisms → Viruses → Predicted Viral | 1758 | Open in IMG/M |
| 3300004097|Ga0055584_100034609 | All Organisms → Viruses → Predicted Viral | 4975 | Open in IMG/M |
| 3300004097|Ga0055584_100369480 | Not Available | 1480 | Open in IMG/M |
| 3300004097|Ga0055584_101259600 | Not Available | 771 | Open in IMG/M |
| 3300005837|Ga0078893_10174198 | All Organisms → cellular organisms → Bacteria | 2192 | Open in IMG/M |
| 3300005837|Ga0078893_10174445 | Not Available | 997 | Open in IMG/M |
| 3300005837|Ga0078893_11849421 | Not Available | 625 | Open in IMG/M |
| 3300006025|Ga0075474_10003843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 6200 | Open in IMG/M |
| 3300006025|Ga0075474_10037304 | Not Available | 1685 | Open in IMG/M |
| 3300006025|Ga0075474_10060173 | All Organisms → Viruses → Predicted Viral | 1270 | Open in IMG/M |
| 3300006026|Ga0075478_10016529 | Not Available | 2498 | Open in IMG/M |
| 3300006027|Ga0075462_10000609 | Not Available | 11141 | Open in IMG/M |
| 3300006027|Ga0075462_10044865 | Not Available | 1410 | Open in IMG/M |
| 3300006400|Ga0075503_1707270 | Not Available | 858 | Open in IMG/M |
| 3300006401|Ga0075506_1775223 | Not Available | 984 | Open in IMG/M |
| 3300006402|Ga0075511_1235046 | Not Available | 602 | Open in IMG/M |
| 3300006484|Ga0070744_10186853 | Not Available | 591 | Open in IMG/M |
| 3300006735|Ga0098038_1082104 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300006752|Ga0098048_1003792 | Not Available | 6067 | Open in IMG/M |
| 3300006752|Ga0098048_1010222 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 3341 | Open in IMG/M |
| 3300006789|Ga0098054_1059566 | Not Available | 1454 | Open in IMG/M |
| 3300006793|Ga0098055_1038598 | Not Available | 1958 | Open in IMG/M |
| 3300006793|Ga0098055_1074292 | Not Available | 1343 | Open in IMG/M |
| 3300006870|Ga0075479_10016816 | Not Available | 3236 | Open in IMG/M |
| 3300006916|Ga0070750_10000318 | Not Available | 26944 | Open in IMG/M |
| 3300006919|Ga0070746_10189545 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300007137|Ga0101673_1015145 | Not Available | 1171 | Open in IMG/M |
| 3300007236|Ga0075463_10130569 | Not Available | 811 | Open in IMG/M |
| 3300007345|Ga0070752_1005802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 7119 | Open in IMG/M |
| 3300007539|Ga0099849_1254642 | Not Available | 644 | Open in IMG/M |
| 3300007681|Ga0102824_1035465 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300007863|Ga0105744_1089689 | Not Available | 758 | Open in IMG/M |
| 3300009027|Ga0102957_1010268 | All Organisms → Viruses → Predicted Viral | 3195 | Open in IMG/M |
| 3300009077|Ga0115552_1278404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 671 | Open in IMG/M |
| 3300009476|Ga0115555_1032622 | Not Available | 2463 | Open in IMG/M |
| 3300009508|Ga0115567_10639987 | Not Available | 640 | Open in IMG/M |
| 3300010150|Ga0098056_1293519 | Not Available | 536 | Open in IMG/M |
| 3300010296|Ga0129348_1131234 | Not Available | 873 | Open in IMG/M |
| 3300012920|Ga0160423_10018105 | Not Available | 5323 | Open in IMG/M |
| 3300012920|Ga0160423_10177408 | Not Available | 1488 | Open in IMG/M |
| 3300012920|Ga0160423_10575279 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 764 | Open in IMG/M |
| 3300012936|Ga0163109_10894519 | Not Available | 649 | Open in IMG/M |
| 3300012953|Ga0163179_10000288 | Not Available | 35351 | Open in IMG/M |
| 3300017713|Ga0181391_1005713 | Not Available | 3315 | Open in IMG/M |
| 3300017719|Ga0181390_1028210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1776 | Open in IMG/M |
| 3300017749|Ga0181392_1022365 | Not Available | 2016 | Open in IMG/M |
| 3300017782|Ga0181380_1022072 | Not Available | 2365 | Open in IMG/M |
| 3300017949|Ga0181584_10041985 | Not Available | 3263 | Open in IMG/M |
| 3300017949|Ga0181584_10054261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 2824 | Open in IMG/M |
| 3300017949|Ga0181584_10088831 | Not Available | 2126 | Open in IMG/M |
| 3300017949|Ga0181584_10121618 | All Organisms → Viruses → Predicted Viral | 1770 | Open in IMG/M |
| 3300017951|Ga0181577_10054404 | Not Available | 2843 | Open in IMG/M |
| 3300017952|Ga0181583_10451177 | Not Available | 793 | Open in IMG/M |
| 3300017956|Ga0181580_10126881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1846 | Open in IMG/M |
| 3300017956|Ga0181580_10319661 | Not Available | 1052 | Open in IMG/M |
| 3300017956|Ga0181580_10583873 | Not Available | 722 | Open in IMG/M |
| 3300017967|Ga0181590_10126167 | All Organisms → Viruses → Predicted Viral | 1977 | Open in IMG/M |
| 3300017967|Ga0181590_10654605 | Not Available | 713 | Open in IMG/M |
| 3300017967|Ga0181590_11061308 | Not Available | 525 | Open in IMG/M |
| 3300017969|Ga0181585_10936724 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium TMED214 | 555 | Open in IMG/M |
| 3300017969|Ga0181585_11092781 | Not Available | 504 | Open in IMG/M |
| 3300017986|Ga0181569_10029000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 3999 | Open in IMG/M |
| 3300017986|Ga0181569_10906255 | Not Available | 573 | Open in IMG/M |
| 3300018421|Ga0181592_10766132 | Not Available | 638 | Open in IMG/M |
| 3300019765|Ga0194024_1027305 | All Organisms → Viruses → Predicted Viral | 1232 | Open in IMG/M |
| 3300020175|Ga0206124_10307615 | Not Available | 603 | Open in IMG/M |
| 3300020379|Ga0211652_10004372 | Not Available | 4362 | Open in IMG/M |
| 3300020379|Ga0211652_10007574 | Not Available | 3307 | Open in IMG/M |
| 3300020403|Ga0211532_10085556 | Not Available | 1379 | Open in IMG/M |
| 3300020408|Ga0211651_10040463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 2106 | Open in IMG/M |
| 3300020411|Ga0211587_10020469 | Not Available | 3306 | Open in IMG/M |
| 3300020421|Ga0211653_10042359 | Not Available | 2082 | Open in IMG/M |
| 3300020421|Ga0211653_10111704 | Not Available | 1213 | Open in IMG/M |
| 3300020438|Ga0211576_10054743 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 2272 | Open in IMG/M |
| 3300020438|Ga0211576_10339537 | Not Available | 775 | Open in IMG/M |
| 3300020439|Ga0211558_10015615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 3919 | Open in IMG/M |
| 3300020462|Ga0211546_10003982 | Not Available | 7913 | Open in IMG/M |
| 3300021356|Ga0213858_10054159 | Not Available | 1944 | Open in IMG/M |
| 3300021356|Ga0213858_10195035 | Not Available | 984 | Open in IMG/M |
| 3300021356|Ga0213858_10301332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 765 | Open in IMG/M |
| 3300021364|Ga0213859_10479839 | Not Available | 542 | Open in IMG/M |
| 3300021365|Ga0206123_10026869 | All Organisms → Viruses → Predicted Viral | 3293 | Open in IMG/M |
| 3300021375|Ga0213869_10011982 | Not Available | 5137 | Open in IMG/M |
| 3300021375|Ga0213869_10213993 | Not Available | 861 | Open in IMG/M |
| 3300021958|Ga0222718_10048506 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2713 | Open in IMG/M |
| 3300021958|Ga0222718_10120018 | All Organisms → cellular organisms → Bacteria | 1522 | Open in IMG/M |
| 3300021959|Ga0222716_10019902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 4986 | Open in IMG/M |
| 3300021959|Ga0222716_10279507 | Not Available | 1017 | Open in IMG/M |
| 3300021964|Ga0222719_10136943 | All Organisms → cellular organisms → Bacteria | 1742 | Open in IMG/M |
| 3300022065|Ga0212024_1010988 | All Organisms → Viruses → Predicted Viral | 1357 | Open in IMG/M |
| 3300022065|Ga0212024_1036347 | Not Available | 847 | Open in IMG/M |
| 3300022067|Ga0196895_1005580 | Not Available | 1329 | Open in IMG/M |
| 3300022068|Ga0212021_1046381 | Not Available | 876 | Open in IMG/M |
| 3300022168|Ga0212027_1042680 | Not Available | 581 | Open in IMG/M |
| 3300022935|Ga0255780_10025625 | Not Available | 4234 | Open in IMG/M |
| 3300023115|Ga0255760_10010706 | All Organisms → cellular organisms → Bacteria | 7329 | Open in IMG/M |
| (restricted) 3300024255|Ga0233438_10197802 | Not Available | 828 | Open in IMG/M |
| 3300024346|Ga0244775_10035555 | All Organisms → cellular organisms → Bacteria | 4410 | Open in IMG/M |
| 3300024346|Ga0244775_10101153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 2451 | Open in IMG/M |
| 3300025070|Ga0208667_1002051 | Not Available | 6822 | Open in IMG/M |
| 3300025070|Ga0208667_1005941 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 3211 | Open in IMG/M |
| 3300025610|Ga0208149_1061675 | Not Available | 949 | Open in IMG/M |
| 3300025759|Ga0208899_1026438 | Not Available | 2796 | Open in IMG/M |
| 3300025815|Ga0208785_1004701 | Not Available | 5429 | Open in IMG/M |
| 3300025816|Ga0209193_1047468 | Not Available | 1206 | Open in IMG/M |
| 3300025818|Ga0208542_1128925 | Not Available | 703 | Open in IMG/M |
| 3300025869|Ga0209308_10095176 | Not Available | 1452 | Open in IMG/M |
| 3300025890|Ga0209631_10134864 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
| 3300025897|Ga0209425_10249334 | Not Available | 916 | Open in IMG/M |
| 3300027757|Ga0208671_10292259 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300032136|Ga0316201_10131634 | Not Available | 2180 | Open in IMG/M |
| 3300034418|Ga0348337_126272 | Not Available | 773 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 21.19% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 16.10% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 9.32% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 8.47% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 5.08% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.24% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 4.24% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 4.24% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 4.24% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 3.39% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 2.54% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.54% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.54% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.69% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.69% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.85% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.85% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.85% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.85% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.85% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.85% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine | 0.85% |
| Volcanic Co2 Seeps | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seeps | 0.85% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.85% |
| Bioluminescent Bay | Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Bioluminescent Bay | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573027 | Estuarine microbial communities from Columbia River, sample from CR-7km from mouth, GS312-FOS-0p8-CR7-chlmax | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000401 | Marine microbial community from La Parguera, Puerto Rico - BB Mangrove B Liquid | Environmental | Open in IMG/M |
| 3300001962 | Marine microbial communities from Cocos Island, Costa Rica - GS023 | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006400 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006401 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006402 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007137 | Seawater microbiome, Papua New Guinea CO2 seep, Dobu 'control', water-dc | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007681 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 | Environmental | Open in IMG/M |
| 3300007863 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2um | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020379 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168) | Environmental | Open in IMG/M |
| 3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
| 3300020408 | Marine microbial communities from Tara Oceans - TARA_B100000925 (ERX555963-ERR599118) | Environmental | Open in IMG/M |
| 3300020411 | Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130) | Environmental | Open in IMG/M |
| 3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300020462 | Marine microbial communities from Tara Oceans - TARA_B100001559 (ERX556040-ERR598986) | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022067 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022168 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2) | Environmental | Open in IMG/M |
| 3300022935 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG | Environmental | Open in IMG/M |
| 3300023115 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025815 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025897 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes) | Environmental | Open in IMG/M |
| 3300027757 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes) | Environmental | Open in IMG/M |
| 3300032136 | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GS312G0146KB_00249850 | 2189573027 | Marine Estuarine | MNEQAADKKAKRNLEHAAAIIMCWTPKEKRDYYLNYFQSLFNDR |
| DelMOSum2011_100098784 | 3300000115 | Marine | LNEKAADKKIKRNLEHAAAMIMCWIPKEKRNQYLNYFYSLFTDE* |
| DelMOWin2010_1002117010 | 3300000117 | Marine | MNEKAADKKIKRNLEHAAAMIMCWIPKEKRNQYLNYFYSLFTDE* |
| DelMOWin2010_100616642 | 3300000117 | Marine | VKEEKLPEKAADKKIRRNLEHAAAMIMMWIPKEKRNQYLNYFYSLFTDE* |
| BB_Man_B_Liq_inBBDRAFT_10289112 | 3300000401 | Bioluminescent Bay | LNEGAADKKIKKLLQHAAVMIMCWIPADKRNQYLNYFYSLFTDEQ* |
| GOS2239_10141592 | 3300001962 | Marine | VKEERLPEKAADKKIKKLLEYAAAMIVMWTPKEIRNQYFDYLYTLCEDQDA* |
| Ga0055584_1000346099 | 3300004097 | Pelagic Marine | MNEKAADRKIKILLQHSAIMIMCWIPSEKRNQYLNYFYSLFTDEEL* |
| Ga0055584_1003694803 | 3300004097 | Pelagic Marine | MNEKAADKKIKRNLEHAAAMIMCWIPKEKRNQYLNYFYSLFNDE* |
| Ga0055584_1012596002 | 3300004097 | Pelagic Marine | MNEKAADKKIKRNLEYAAAMIMCWIPKEKRNQYLNYFYSLFTDE* |
| Ga0078893_101741983 | 3300005837 | Marine Surface Water | MDEKPADKKIKRNLEHAAAMIMCWIPKDKRNQYLNYFYSLFTD* |
| Ga0078893_101744453 | 3300005837 | Marine Surface Water | MNENAANRKIKKFLMSAAVMINIWIPVDKRIQYLNYFYSLIIDTEKE* |
| Ga0078893_118494212 | 3300005837 | Marine Surface Water | MLNEQAADRKIKKLLQYCAVMINLWIPKEKRTRYINYLYSYLTES* |
| Ga0075474_1000384314 | 3300006025 | Aqueous | MNEGAANRKIKRFLQHAAVMINMWIPVEKRNQYLNYFYSIIIDKEKE* |
| Ga0075474_100373044 | 3300006025 | Aqueous | LNEGAANKKIKRLLQHAAIMIMSWIPAEKRNQYLNYFYSLFTDE* |
| Ga0075474_100601732 | 3300006025 | Aqueous | MPEGAADKKIKKLLQHSAIMIMAWIPADKRNQYLNYFYSLFTDE* |
| Ga0075478_100165293 | 3300006026 | Aqueous | LNEGAADKKIKRLLQHAAIMIMSWIPAEKRNQYLNYFYSLFTDE* |
| Ga0075462_1000060911 | 3300006027 | Aqueous | LPEKAADKKIRRNLEHAAAMIMMWIPKEKRNQYLNYFYSLFTDE* |
| Ga0075462_100448653 | 3300006027 | Aqueous | MNETAADRKIKKLLQHAAVMIMCWIPAEKRNQYLNYFYSLFTDE* |
| Ga0075503_17072701 | 3300006400 | Aqueous | RLIMNEGAANRKIKRFLQHAAVMINMWIPVEKRNQYLNYFYSIIIDKEKE* |
| Ga0075506_17752233 | 3300006401 | Aqueous | MNEGAANRKIKRFLQHAAVMINIWIPVEKRNQYLNYFYSIIIDKEKE* |
| Ga0075511_12350463 | 3300006402 | Aqueous | GAANRKIKRFLQHAAVMINMWIPVEKRNQYLNYFYSIIIDKEKE* |
| Ga0070744_101868532 | 3300006484 | Estuarine | MNEQAADKKAKRNLEHAAAIIMCWTPKEKRDYYLNYFQSLFNDR* |
| Ga0098038_10821043 | 3300006735 | Marine | EEKLPEKAADKKIRKLLEYAAAMMMMWIPKEKRSQYFSYLYTLCEFKEQDA* |
| Ga0098048_10037929 | 3300006752 | Marine | MTMNEKAADKKIKRNLEHAAAMIMCWIPKEKRNQYLNYFYSLFNDE* |
| Ga0098048_10102229 | 3300006752 | Marine | MNENAANRKIKKFLMLAAVMINMWIPVDKRTQYLNYFYSLIIDTEKK* |
| Ga0098054_10595662 | 3300006789 | Marine | LNEKAADKKIKRNLEHAAAMIMCWIPKEKRNQYLNYFYSLFTD* |
| Ga0098055_10385985 | 3300006793 | Marine | LPEKAADKKIKRNLEHAAAMIMCWIPKEKRNQYLNYFYSLFNDE* |
| Ga0098055_10742926 | 3300006793 | Marine | LNEKAADKKIKRNLEHAAAMIMCWIPKEKRNQYLNYFYSLFNDE* |
| Ga0075479_100168165 | 3300006870 | Aqueous | EGAANKKIKRLLQHAAIMIMSWIPAEKRNQYLNYFYSLFTDE* |
| Ga0070750_100003186 | 3300006916 | Aqueous | LPEKAADKKIRRNLEHAAAMIMMWIPKEKRNQCLNYFYSLFTDE* |
| Ga0070746_101895451 | 3300006919 | Aqueous | KIKKLLQHAAVMIMCWIPAEKRNQYLNYFYSLFTDE* |
| Ga0101673_10151452 | 3300007137 | Volcanic Co2 Seeps | LNEGAADRKIKKLLQHAAIMIMCWIPANKRNQYLNYFYSLFTDE* |
| Ga0075463_101305692 | 3300007236 | Aqueous | LGRIGRLIMNEGAANRKIKRFLQHAAVMINMWIPVEKRNQYLNYFYSIIIDKEKE* |
| Ga0070752_100580219 | 3300007345 | Aqueous | LGRIGRLIMNEGAANRKIKRFLQHAAVMINIWIPVEKRNQYLNYFYSIIIDKEKE* |
| Ga0099849_12546423 | 3300007539 | Aqueous | MPESAADKKIKKLLQHSAIMIMAWIPADKRNQYLNYFYSLFTDE* |
| Ga0102824_10354651 | 3300007681 | Estuarine | KPADKKIKRNLEHAAAMIMCWIPKDKRNQYLNYFYSLFTD* |
| Ga0105744_10896891 | 3300007863 | Estuary Water | MNESAANRKIKKFLMLAAVMINIWIPVDKRTQYINYFYSLIIDTEKE* |
| Ga0102957_10102687 | 3300009027 | Pond Water | VKEEKLPEKAADKKIKRNLEHAAAMIMCWIPKDKRNQYLNYFYSLFTD* |
| Ga0115552_12784041 | 3300009077 | Pelagic Marine | MNEKAADKKIKRNLEYAAAMIMCWIPKEKRNQYLNYFYSLFT |
| Ga0115555_10326221 | 3300009476 | Pelagic Marine | MNEKAADKKIKRNLEHAAAMIMCWIPKEKRNQYLNYFYSLF |
| Ga0115567_106399872 | 3300009508 | Pelagic Marine | MNEKAADKKIKKNLEYAAAMIMCWIPKEKRNQYLNYFYSLFTDE* |
| Ga0098056_12935192 | 3300010150 | Marine | VKEEKLPEKAADKKIKRNLEHAAAMIMCWIPKEKRNQYLNYFYSLFNDE* |
| Ga0129348_11312342 | 3300010296 | Freshwater To Marine Saline Gradient | MNEGAADRKIKNFLMHAAVMINSWIPLEKRNQYLNYFYSLIIDEEK* |
| Ga0160423_100181054 | 3300012920 | Surface Seawater | MDEKAADKKIKRNLEHAAAMIMCWIPKDKRNQYLNYFYSLFTD* |
| Ga0160423_101774082 | 3300012920 | Surface Seawater | VKEEKLPEKAADKKIKRNLEHAAAMIMMWIPKEKRNQYLNYFYSLFTDE* |
| Ga0160423_105752793 | 3300012920 | Surface Seawater | ADKKIKKLLEYAAAMIVMWTPKETRNKYFDYLYTLCEDQDA* |
| Ga0163109_108945191 | 3300012936 | Surface Seawater | VKEEKLPEKAADKKIKRNLEHAAAMIMMWIPAEKRNQYLNYFYSLFTDE* |
| Ga0163179_1000028826 | 3300012953 | Seawater | LPEKAADKKIRKLLEYAAAMMMMWIPKEKRNQYFSYLYTLCEFKEKDA* |
| Ga0181391_10057132 | 3300017713 | Seawater | VKEEKLPEKAADKKIKRYLENAAAMIMVWIPAEKRNSYLNYFYSLFTDQDA |
| Ga0181390_10282103 | 3300017719 | Seawater | MNESAANRKIKKFLMLAAVMINIWIPVDKRTQYLNYFYSLIVDTEKE |
| Ga0181392_10223651 | 3300017749 | Seawater | LPEKAADKKIKRYLENAAAMIMVWIPAEKRNSYLNYFYSLFTDQD |
| Ga0181380_10220724 | 3300017782 | Seawater | MNEQAADKKAKRNLEHAAAIIMCWTPKEKKDYYLNYFQSLFNDR |
| Ga0181380_11527732 | 3300017782 | Seawater | KKFLMLAAVMINIWIPVDKRTQYLNYFYSLIIDTEKE |
| Ga0181584_100419855 | 3300017949 | Salt Marsh | MNEGAANRKIKRFLQHAAVMINIWIPVEKRNQYLNYFYSIIIDEEKDE |
| Ga0181584_1005426110 | 3300017949 | Salt Marsh | MNEGAADRKIKNLLMHAAVMINIWIPIEKRNQYLNYFYSLIIDEEKK |
| Ga0181584_100888314 | 3300017949 | Salt Marsh | LNEGAADKKIKKHLQYAAVMIMAWIPADKRNQYLNYFYSLFTDES |
| Ga0181584_101216182 | 3300017949 | Salt Marsh | MNEGAADRKIKNFLMHAAVMINSWIPLEKRNQYLNYFYSLIIDEEK |
| Ga0181577_100544043 | 3300017951 | Salt Marsh | MNEGAANRKIKRFLQHAAVMINTWIPVGKRNQYLNYFYSIIIDEEKDE |
| Ga0181583_104511772 | 3300017952 | Salt Marsh | MNEGAANRKIKRFLQHAAVMINIWIPVEKRNQYLNYFYSIIIDEEK |
| Ga0181580_101268814 | 3300017956 | Salt Marsh | MDEKAADKKIKRNLEHAAAMIMCWIPKGKRNQYLNYFYSLFTD |
| Ga0181580_103196612 | 3300017956 | Salt Marsh | LNEGAADKKIKRLLQHAAIMIMSWIPAEKRNQYLNYFYSLFTDE |
| Ga0181580_105838732 | 3300017956 | Salt Marsh | MNETAADRKIKKLLQKSAVMIMCWIPAEKRNQYLNYFYSLFTDE |
| Ga0181590_101261674 | 3300017967 | Salt Marsh | MNEGAANRKIKRFLQHAAVMINTWIPVVKRNQYLNYFYSIIIDEEKDE |
| Ga0181590_106546051 | 3300017967 | Salt Marsh | VKEEKLPEKAADNKIKKLLEHAAVMIMAWVPAEKRNQYLNYFYSLFTDE |
| Ga0181590_110613082 | 3300017967 | Salt Marsh | LNEKAADKKIKRNLEHAAAMIMCWIPKGKRNHYLNYFYSLFTDE |
| Ga0181585_109367241 | 3300017969 | Salt Marsh | DKKIKRLLQHAAIMIMSWIPAEKRNQYLNYFYSLFTDE |
| Ga0181585_110927811 | 3300017969 | Salt Marsh | RKIKRFLQHAAVMINTWIPVGKRNQYLNYFYSIIIDEEKE |
| Ga0181569_100290002 | 3300017986 | Salt Marsh | MNEGAANRKIKRFLQHAAVMINTWIPVGKRNQYLNYFYSIIIDEEKE |
| Ga0181569_109062551 | 3300017986 | Salt Marsh | LNEKAADKKIKRNLEHAAAMIMCWIPKGKRNQYLNYFYSLFTD |
| Ga0181592_107661322 | 3300018421 | Salt Marsh | VPEEAANRKIKKLLQHAAIMINLWIPVEKRNQYLNYFYSIIIDEEKK |
| Ga0194024_10273052 | 3300019765 | Freshwater | MNEGAANRKIKRFLQHAAVMINMWIPVEKRNQYLNYFYSIIIDKEKE |
| Ga0206124_103076151 | 3300020175 | Seawater | LPEKAADKKIKRNLEHAAAMIMMWIPKEKRNQYLNYFYSLFTDE |
| Ga0211652_100043724 | 3300020379 | Marine | VKEEKLPEKAADKKIKRNLEHAAAMIMCWIPKEKRNQYLNYFYSLFNDE |
| Ga0211652_100075742 | 3300020379 | Marine | LNEKAADKKIKRNLEHAAAMIMCWIPKEKRNQYLNYFYSLFTD |
| Ga0211532_100855563 | 3300020403 | Marine | MNEDAANRKIKRAIQHIAIMINLWIPVEKRTQYLNYLYSFIVDEEKNEQ |
| Ga0211651_100404632 | 3300020408 | Marine | MNEEAANRKIKKLLSHCASMINIWIPVNKRVQYLSFLYSLILIDTEEEE |
| Ga0211587_100204693 | 3300020411 | Marine | VKEEKLPEKAADKKIKKILEYAAAMIVMWTPKETRNQYFDYLYTLCEDQDA |
| Ga0211653_100423591 | 3300020421 | Marine | MTMNEKAADKKIKRNLEHAAAMIMCWIPKEKRNQYLNYFYSLF |
| Ga0211653_101117042 | 3300020421 | Marine | MNEKAADRKIKRNLEHAAAMVLCWIPKEKRNQYLNYFYSLIEDTEKK |
| Ga0211576_100547438 | 3300020438 | Marine | MNESAANRKIKKFLMLAAVMINIWIPVDKRTQYLNYFYSLIIDTEKE |
| Ga0211576_103395373 | 3300020438 | Marine | LPEKAADKKIKRYLENAAAMIMVWIPAEKRNSYLNYF |
| Ga0211558_100156152 | 3300020439 | Marine | MNEAAANRKIKKILSYAAVMINLWIPVKKRTQYLNYFYSLIIDEENDE |
| Ga0211546_100039825 | 3300020462 | Marine | LPEKAADKKIRKLLEYAAAMMMMWIPKEKRNQYFSYLYTLCEFKEKDA |
| Ga0213858_100541593 | 3300021356 | Seawater | MNEGAANRKIKRFLQHAAVMINIWIPVGKRNQYLNYFYSIIIDEEKDE |
| Ga0213858_101950352 | 3300021356 | Seawater | MNETAANRKIKKILSYAAVMVNLWIPVKKRTQYLNYFYSLIIDEENDE |
| Ga0213858_103013322 | 3300021356 | Seawater | VKEEKLPEKAADKKIKRLLEYAAAMIVMWTPKEKRNQYFDYLHTLCEDQNA |
| Ga0213859_104798392 | 3300021364 | Seawater | DEKAADKKIKRNLEHAAAMIMCWIPKGKRNQYLNYFYSLFTD |
| Ga0206123_100268692 | 3300021365 | Seawater | MNEKAADKKIKRNLEHAAAMIMCWIPKEKRNQYLNYFYSLFNDE |
| Ga0213869_100119823 | 3300021375 | Seawater | LNEKAADKKIKRNLEHAAAMIMCWIPKEKRNQYLNYFYSLFTDE |
| Ga0213869_102139932 | 3300021375 | Seawater | MNEKAADKKIKRNLEHAAAMIMCWIPKEKRNQYLNYFYSLFTDE |
| Ga0222718_100485061 | 3300021958 | Estuarine Water | NKKQLLVVKEEKLPEKAADKKIKRNLEHAAAMIMCWIPKEKRNQYLNYFYSLFTDE |
| Ga0222718_101200181 | 3300021958 | Estuarine Water | RMNEQSADRKIKRLLQHVAVIIMCWIPAEKRNQYLNYFYSLFTDE |
| Ga0222716_100199029 | 3300021959 | Estuarine Water | MDEKAADRKIKRNLEHAAVMIMCWIPRDKRNQYLNYFYSLFTD |
| Ga0222716_102795073 | 3300021959 | Estuarine Water | VKEEKLPEKAADKKIKRNLEHAAAMIMCWIPKEKRNQYLNYFYSLFTDE |
| Ga0222719_101369435 | 3300021964 | Estuarine Water | MDEKPADKKIKRNLQHAAAMIMCWIPKDKRNQYLNYFYSLFTD |
| Ga0212024_10109883 | 3300022065 | Aqueous | MNETAADRKIKKLLQHAAVMIMCWIPAEKRNQYLNYFYSLFTDE |
| Ga0212024_10363472 | 3300022065 | Aqueous | VKEEKLPEKAADKKIRRNLEHAAAMIMMWIPKEKRNQYLNYFYSLFTDE |
| Ga0196895_10055803 | 3300022067 | Aqueous | KKRLLQHAAIMIMSWIPAEKRNQYLNYFYSLFTDE |
| Ga0212021_10463812 | 3300022068 | Aqueous | KEEKLPEKAADKKIRRNLEHAAAMIMMWIPKEKRNQYLNYFYSLFTDE |
| Ga0212027_10426802 | 3300022168 | Aqueous | LNEGAADKKIKRLLQHAAIMIMSWIPAEKRNQYLNYFY |
| Ga0255780_1002562511 | 3300022935 | Salt Marsh | IMNEGAADRKIKNFLMHAAVMINSWIPLEKRNQYLNYFYSLIIDEEK |
| Ga0255760_1001070620 | 3300023115 | Salt Marsh | MNEGAADRKIKNLLMHAAVMINIWIPIEKRNQYLNY |
| (restricted) Ga0233438_101978022 | 3300024255 | Seawater | MNENAANRKIKKFLMLAAVMINIWIPVDKRTQYINYFYSLIIDTEKE |
| Ga0244775_100355555 | 3300024346 | Estuarine | MDEKPADKKIKRNLEHAAAMIMCWIPKDKRNQYLNYFYSLFTD |
| Ga0244775_101011532 | 3300024346 | Estuarine | MNESAANRKIKKFLMLAAVMINIWIPVDKRTQYINYFYSLIIDTEKE |
| Ga0208667_10020519 | 3300025070 | Marine | MTMNEKAADKKIKRNLEHAAAMIMCWIPKEKRNQYLNYFYSLFNDE |
| Ga0208667_10059412 | 3300025070 | Marine | MNENAANRKIKKFLMLAAVMINMWIPVDKRTQYLNYFYSLIIDTEKK |
| Ga0208149_10616752 | 3300025610 | Aqueous | MPEGAADKKIKKLLQHSAIMIMAWIPADKRNQYLNYFYSLFTDE |
| Ga0208899_10264388 | 3300025759 | Aqueous | MNEGAANRKIKRFLQHAAVMINIWIPVEKRNQYLNYFYSIIIDKEKE |
| Ga0208785_10047019 | 3300025815 | Aqueous | LNEGAANKKIKRLLQHAAIMIMSWIPAEKRNQYLNYFYSLFTDE |
| Ga0209193_10474681 | 3300025816 | Pelagic Marine | LNEKAADKKIKRNLEHAAAMIMCWIPKEKRNQYLNYFYSLFNDE |
| Ga0208542_11289252 | 3300025818 | Aqueous | MNEGAANRKIKRFLQHAAVMINIWIPVEKRNQYLNY |
| Ga0209308_100951765 | 3300025869 | Pelagic Marine | MNEKAADKKIKRNLEHAAAMIMCWIPKEKRNQYLNYFYSL |
| Ga0209631_101348643 | 3300025890 | Pelagic Marine | MNEKAADRKIKILLQHSAIMIMCWIPSEKRNQYLNYFYSLFTDEEL |
| Ga0209425_102493342 | 3300025897 | Pelagic Marine | MNEKAADKKIKRNLEYAAAMIMCWIPKEKRNQYLNYFYSLFTDE |
| Ga0208671_102922591 | 3300027757 | Estuarine | DKKIKRNLEHAAAMIMCWIPKDKRNQYLNYFYSLFTD |
| Ga0316201_101316341 | 3300032136 | Worm Burrow | AADKKIKSLLQHAAIMILSWIPAEKRNQYLNYFYSLFTDE |
| Ga0348337_126272_3_113 | 3300034418 | Aqueous | MNEGAADKKIKRLLQHAAIMIMSWIPAEKRNQYLNYF |
| ⦗Top⦘ |