


| Basic Information | |
|---|---|
| Family ID | F076100 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 118 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MKYITNKFDSIRLPVEEGLLEWLQEKYPASKYFIKEI |
| Number of Associated Samples | 74 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 77.97 % |
| % of genes near scaffold ends (potentially truncated) | 16.95 % |
| % of genes from short scaffolds (< 2000 bps) | 63.56 % |
| Associated GOLD sequencing projects | 69 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (54.237 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (21.186 % of family members) |
| Environment Ontology (ENVO) | Unclassified (73.729 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (82.203 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.31% β-sheet: 15.38% Coil/Unstructured: 72.31% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF01227 | GTP_cyclohydroI | 43.22 |
| PF14083 | PGDYG | 6.78 |
| PF13394 | Fer4_14 | 4.24 |
| PF02739 | 5_3_exonuc_N | 2.54 |
| PF01230 | HIT | 2.54 |
| PF00149 | Metallophos | 1.69 |
| PF13759 | 2OG-FeII_Oxy_5 | 1.69 |
| PF00984 | UDPG_MGDP_dh | 1.69 |
| PF03819 | MazG | 1.69 |
| PF03721 | UDPG_MGDP_dh_N | 1.69 |
| PF01027 | Bax1-I | 1.69 |
| PF13203 | DUF2201_N | 0.85 |
| PF00383 | dCMP_cyt_deam_1 | 0.85 |
| PF13476 | AAA_23 | 0.85 |
| PF00156 | Pribosyltran | 0.85 |
| PF07733 | DNA_pol3_alpha | 0.85 |
| PF00011 | HSP20 | 0.85 |
| PF02839 | CBM_5_12 | 0.85 |
| PF13517 | FG-GAP_3 | 0.85 |
| PF00004 | AAA | 0.85 |
| PF14743 | DNA_ligase_OB_2 | 0.85 |
| PF08534 | Redoxin | 0.85 |
| PF07230 | Portal_Gp20 | 0.85 |
| PF04325 | DUF465 | 0.85 |
| PF09967 | DUF2201 | 0.85 |
| PF01370 | Epimerase | 0.85 |
| PF00136 | DNA_pol_B | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 3.39 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 3.39 |
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 2.54 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.69 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 1.69 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 1.69 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
| COG0417 | DNA polymerase B elongation subunit | Replication, recombination and repair [L] | 0.85 |
| COG0587 | DNA polymerase III, alpha subunit | Replication, recombination and repair [L] | 0.85 |
| COG2176 | DNA polymerase III, alpha subunit (gram-positive type) | Replication, recombination and repair [L] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 54.24 % |
| All Organisms | root | All Organisms | 45.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001282|B570J14230_10047321 | All Organisms → Viruses → Predicted Viral | 1442 | Open in IMG/M |
| 3300002408|B570J29032_109030036 | Not Available | 572 | Open in IMG/M |
| 3300002408|B570J29032_109239970 | Not Available | 650 | Open in IMG/M |
| 3300004124|Ga0066178_10201995 | Not Available | 570 | Open in IMG/M |
| 3300005517|Ga0070374_10001079 | Not Available | 11538 | Open in IMG/M |
| 3300005517|Ga0070374_10006065 | Not Available | 5693 | Open in IMG/M |
| 3300005517|Ga0070374_10045581 | All Organisms → cellular organisms → Bacteria | 2278 | Open in IMG/M |
| 3300005517|Ga0070374_10119856 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300005517|Ga0070374_10469460 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300005527|Ga0068876_10707863 | Not Available | 538 | Open in IMG/M |
| 3300005580|Ga0049083_10229151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
| 3300005581|Ga0049081_10006470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4432 | Open in IMG/M |
| 3300005582|Ga0049080_10193297 | Not Available | 674 | Open in IMG/M |
| 3300005584|Ga0049082_10053441 | Not Available | 1417 | Open in IMG/M |
| 3300005584|Ga0049082_10134256 | Not Available | 862 | Open in IMG/M |
| 3300005662|Ga0078894_10029524 | All Organisms → cellular organisms → Bacteria | 4509 | Open in IMG/M |
| 3300005662|Ga0078894_10169428 | All Organisms → Viruses → Predicted Viral | 1970 | Open in IMG/M |
| 3300005662|Ga0078894_10769140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter | 845 | Open in IMG/M |
| 3300005662|Ga0078894_11109859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Vibrio phage 2.275.O._10N.286.54.E11 | 675 | Open in IMG/M |
| 3300005662|Ga0078894_11176655 | Not Available | 651 | Open in IMG/M |
| 3300005662|Ga0078894_11284074 | Not Available | 616 | Open in IMG/M |
| 3300006118|Ga0007859_1009861 | All Organisms → Viruses → Predicted Viral | 2206 | Open in IMG/M |
| 3300006484|Ga0070744_10002571 | Not Available | 5476 | Open in IMG/M |
| 3300006484|Ga0070744_10026306 | All Organisms → cellular organisms → Bacteria | 1723 | Open in IMG/M |
| 3300006484|Ga0070744_10048008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Vibrio phage 2.275.O._10N.286.54.E11 | 1253 | Open in IMG/M |
| 3300006639|Ga0079301_1199180 | Not Available | 575 | Open in IMG/M |
| 3300007597|Ga0102919_1171521 | Not Available | 680 | Open in IMG/M |
| 3300008055|Ga0108970_11637990 | All Organisms → Viruses → Predicted Viral | 1442 | Open in IMG/M |
| 3300008107|Ga0114340_1070658 | Not Available | 1470 | Open in IMG/M |
| 3300008108|Ga0114341_10010299 | Not Available | 7237 | Open in IMG/M |
| 3300009026|Ga0102829_1277247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
| 3300009151|Ga0114962_10011268 | Not Available | 6579 | Open in IMG/M |
| 3300009151|Ga0114962_10021818 | All Organisms → Viruses → Predicted Viral | 4513 | Open in IMG/M |
| 3300009151|Ga0114962_10205788 | Not Available | 1146 | Open in IMG/M |
| 3300009151|Ga0114962_10542479 | Not Available | 610 | Open in IMG/M |
| 3300009152|Ga0114980_10031947 | Not Available | 3252 | Open in IMG/M |
| 3300009164|Ga0114975_10000084 | Not Available | 60899 | Open in IMG/M |
| 3300009164|Ga0114975_10000362 | Not Available | 34027 | Open in IMG/M |
| 3300009164|Ga0114975_10004507 | Not Available | 9118 | Open in IMG/M |
| 3300009164|Ga0114975_10012484 | Not Available | 5261 | Open in IMG/M |
| 3300009180|Ga0114979_10020232 | Not Available | 4249 | Open in IMG/M |
| 3300009180|Ga0114979_10170519 | All Organisms → Viruses → Predicted Viral | 1327 | Open in IMG/M |
| 3300009182|Ga0114959_10097408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1618 | Open in IMG/M |
| 3300009182|Ga0114959_10175746 | All Organisms → Viruses → Predicted Viral | 1123 | Open in IMG/M |
| 3300010160|Ga0114967_10077352 | Not Available | 1992 | Open in IMG/M |
| 3300010885|Ga0133913_10676732 | All Organisms → Viruses → Predicted Viral | 2702 | Open in IMG/M |
| 3300012345|Ga0157139_1015297 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
| 3300012663|Ga0157203_1001606 | Not Available | 5456 | Open in IMG/M |
| 3300012663|Ga0157203_1043558 | Not Available | 613 | Open in IMG/M |
| 3300012665|Ga0157210_1000039 | Not Available | 68403 | Open in IMG/M |
| 3300012665|Ga0157210_1000055 | Not Available | 62405 | Open in IMG/M |
| 3300012665|Ga0157210_1007052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2147 | Open in IMG/M |
| 3300012665|Ga0157210_1015360 | All Organisms → Viruses → Predicted Viral | 1281 | Open in IMG/M |
| 3300013004|Ga0164293_10102541 | Not Available | 2194 | Open in IMG/M |
| 3300013006|Ga0164294_10000149 | Not Available | 64293 | Open in IMG/M |
| 3300013093|Ga0164296_1089718 | All Organisms → Viruses → Predicted Viral | 1315 | Open in IMG/M |
| 3300013286|Ga0136641_1000004 | Not Available | 105823 | Open in IMG/M |
| 3300019784|Ga0181359_1109558 | Not Available | 1002 | Open in IMG/M |
| 3300019784|Ga0181359_1212734 | Not Available | 614 | Open in IMG/M |
| 3300020141|Ga0211732_1110836 | Not Available | 70287 | Open in IMG/M |
| 3300020141|Ga0211732_1203246 | Not Available | 530 | Open in IMG/M |
| 3300020141|Ga0211732_1586830 | Not Available | 21272 | Open in IMG/M |
| 3300020151|Ga0211736_10000792 | Not Available | 751 | Open in IMG/M |
| 3300020151|Ga0211736_10494030 | Not Available | 6778 | Open in IMG/M |
| 3300020151|Ga0211736_10738632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter | 900 | Open in IMG/M |
| 3300020151|Ga0211736_10742269 | Not Available | 622 | Open in IMG/M |
| 3300020159|Ga0211734_11261208 | Not Available | 746 | Open in IMG/M |
| 3300020160|Ga0211733_10186239 | Not Available | 1145 | Open in IMG/M |
| 3300020160|Ga0211733_10474229 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Vibrio phage 2.275.O._10N.286.54.E11 | 755 | Open in IMG/M |
| 3300020160|Ga0211733_10928692 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4529 | Open in IMG/M |
| 3300020162|Ga0211735_11212619 | All Organisms → Viruses → Predicted Viral | 1161 | Open in IMG/M |
| 3300020172|Ga0211729_10941651 | All Organisms → Viruses → Predicted Viral | 1017 | Open in IMG/M |
| 3300020205|Ga0211731_10111229 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1769 | Open in IMG/M |
| 3300020205|Ga0211731_11127392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter | 970 | Open in IMG/M |
| 3300020205|Ga0211731_11239355 | Not Available | 568 | Open in IMG/M |
| 3300020527|Ga0208232_1042403 | Not Available | 592 | Open in IMG/M |
| 3300021139|Ga0214166_1014860 | All Organisms → Viruses → Predicted Viral | 2075 | Open in IMG/M |
| 3300021519|Ga0194048_10081474 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1262 | Open in IMG/M |
| 3300021519|Ga0194048_10171747 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Vibrio phage 2.275.O._10N.286.54.E11 | 809 | Open in IMG/M |
| 3300021952|Ga0213921_1014891 | Not Available | 1371 | Open in IMG/M |
| 3300021962|Ga0222713_10195996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter | 1356 | Open in IMG/M |
| 3300022407|Ga0181351_1070130 | Not Available | 1421 | Open in IMG/M |
| 3300023174|Ga0214921_10002396 | Not Available | 30555 | Open in IMG/M |
| 3300023184|Ga0214919_10005360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18266 | Open in IMG/M |
| 3300024346|Ga0244775_10009028 | Not Available | 9623 | Open in IMG/M |
| 3300024346|Ga0244775_10756970 | Not Available | 779 | Open in IMG/M |
| 3300024346|Ga0244775_11011447 | Not Available | 655 | Open in IMG/M |
| 3300024863|Ga0255246_1135287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Vibrio phage 2.275.O._10N.286.54.E11 | 573 | Open in IMG/M |
| 3300025389|Ga0208257_1057401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
| 3300025392|Ga0208380_1059400 | Not Available | 540 | Open in IMG/M |
| 3300027114|Ga0208009_1028325 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Vibrio phage 2.275.O._10N.286.54.E11 | 1189 | Open in IMG/M |
| 3300027144|Ga0255102_1000463 | Not Available | 11289 | Open in IMG/M |
| 3300027581|Ga0209651_1049506 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
| 3300027631|Ga0208133_1113763 | Not Available | 629 | Open in IMG/M |
| 3300027642|Ga0209135_1044047 | All Organisms → Viruses → Predicted Viral | 1580 | Open in IMG/M |
| 3300027642|Ga0209135_1258537 | Not Available | 514 | Open in IMG/M |
| 3300027679|Ga0209769_1278425 | Not Available | 504 | Open in IMG/M |
| 3300027708|Ga0209188_1000003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 345369 | Open in IMG/M |
| 3300027708|Ga0209188_1268860 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
| 3300027749|Ga0209084_1015161 | Not Available | 4384 | Open in IMG/M |
| 3300027749|Ga0209084_1059543 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1801 | Open in IMG/M |
| 3300027759|Ga0209296_1084629 | Not Available | 1552 | Open in IMG/M |
| 3300027772|Ga0209768_10070312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1785 | Open in IMG/M |
| 3300027797|Ga0209107_10014103 | Not Available | 4536 | Open in IMG/M |
| 3300027798|Ga0209353_10233839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 795 | Open in IMG/M |
| 3300027969|Ga0209191_1000011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 166311 | Open in IMG/M |
| 3300027969|Ga0209191_1004660 | Not Available | 7919 | Open in IMG/M |
| 3300027969|Ga0209191_1035409 | All Organisms → Viruses → Predicted Viral | 2367 | Open in IMG/M |
| 3300028392|Ga0304729_1003048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9664 | Open in IMG/M |
| 3300028394|Ga0304730_1100877 | Not Available | 1253 | Open in IMG/M |
| 3300032092|Ga0315905_10052434 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4141 | Open in IMG/M |
| 3300033816|Ga0334980_0055037 | All Organisms → Viruses → Predicted Viral | 1678 | Open in IMG/M |
| 3300033992|Ga0334992_0057346 | All Organisms → Viruses → Predicted Viral | 2192 | Open in IMG/M |
| 3300034013|Ga0334991_0024917 | All Organisms → Viruses → Predicted Viral | 3422 | Open in IMG/M |
| 3300034061|Ga0334987_0137849 | Not Available | 1807 | Open in IMG/M |
| 3300034071|Ga0335028_0140383 | Not Available | 1547 | Open in IMG/M |
| 3300034071|Ga0335028_0355391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Vibrio phage 2.275.O._10N.286.54.E11 | 851 | Open in IMG/M |
| 3300034102|Ga0335029_0766198 | Not Available | 513 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 21.19% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 18.64% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 14.41% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.17% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 5.93% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 5.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 4.24% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 4.24% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.54% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.69% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.69% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.69% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.69% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.69% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.85% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.85% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.85% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.85% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300004124 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006118 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300007597 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012345 | Freshwater microbial communities from Burnt River, Ontario, Canada - S22 | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
| 3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021139 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024863 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025389 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025392 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027144 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027642 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J14230_100473212 | 3300001282 | Freshwater | MKYITNKFDSIRLPVEDGLLEWLQAKYPASKYHIKEL* |
| B570J29032_1090300362 | 3300002408 | Freshwater | MKYITNKFDSIRLPVEEGLLEWLQARYPASKYYIKELG* |
| B570J29032_1092399702 | 3300002408 | Freshwater | MRYITNKFDSVRLPVEEGLLEWLQTQYPASKYFIMEL* |
| Ga0066178_102019953 | 3300004124 | Freshwater Lake | ATGVCTAMRYITNKFDSVRLPVEEGLLEWLQEQYPASKYFIKEVE* |
| Ga0070374_1000107916 | 3300005517 | Freshwater Lake | MRYITNKFDSVRLPIEEGLLEWLQAKYPASKYYIKEI* |
| Ga0070374_100060652 | 3300005517 | Freshwater Lake | MKYITNKFDSIRLPVEEGLLEWLQAKYPASKYHIKELE* |
| Ga0070374_100455814 | 3300005517 | Freshwater Lake | MRYITNKFDSVRLPVEEGLLEWLQAQYPASKYHIKELE* |
| Ga0070374_101198565 | 3300005517 | Freshwater Lake | MRYITNKFDSVRLPVEEGLLEWLQEQYPASKYFIKEVE* |
| Ga0070374_104694602 | 3300005517 | Freshwater Lake | MKYITNKFDSVRLPVEEGLLEWLQAKYPASKYYIKE* |
| Ga0068876_107078631 | 3300005527 | Freshwater Lake | TTTRVCTTMKYITNKFDSIRLPVEEGLLEWLQAKYPASKYFIKET* |
| Ga0049083_102291512 | 3300005580 | Freshwater Lentic | MKYITNRYDSIRLPYEEGLLEWLQKQYPLSKYQVKELADGN* |
| Ga0049081_100064702 | 3300005581 | Freshwater Lentic | MKYITNKFENIRLPVEEGLLEWLQENYPASKYFIKEI* |
| Ga0049080_101932971 | 3300005582 | Freshwater Lentic | MRYITNKFDSVRLPVEEGLLEWLQAKYPASKYYIKELE* |
| Ga0049082_100534415 | 3300005584 | Freshwater Lentic | MKYITNKFDSIRLPIEPGLLEWLQQNYPASQYYIKEQ* |
| Ga0049082_101342561 | 3300005584 | Freshwater Lentic | MRYITNKFDSVRLPVEEGLLEWLQAQYPASEYHIKEA* |
| Ga0078894_100295241 | 3300005662 | Freshwater Lake | MRYITNKFESIRLPVEEGLLEWLQERYPASKYYIKEI* |
| Ga0078894_101694282 | 3300005662 | Freshwater Lake | MKYITNKFDSVRLPVEEGLLEWLQAKYPASKYYIKEI* |
| Ga0078894_107691401 | 3300005662 | Freshwater Lake | TTMRYITNKFDSVRLPVEEGLLEWLQVQYPASKYFIKEI* |
| Ga0078894_111098592 | 3300005662 | Freshwater Lake | MKYITNKFESIRLPVEAGLLEWLQAKYPASKYVIKEI* |
| Ga0078894_111766551 | 3300005662 | Freshwater Lake | TRVCTTMKYITNKFESIRLPVEDGLLEWLQTKYPASKYYIKEV* |
| Ga0078894_112840742 | 3300005662 | Freshwater Lake | MKYITNKFESIRLPVEEGLLEWLQERYPASKYYIKEI* |
| Ga0007859_10098612 | 3300006118 | Freshwater | MKYITNKFDSVRLPYAEDLLEWLQQTYPHSKYHVKEIHYGN* |
| Ga0070744_100025714 | 3300006484 | Estuarine | MRYITNKFDSVRLPVEEGLLEWLQTQYPASKYFIKEI* |
| Ga0070744_100263065 | 3300006484 | Estuarine | MKYITNKFDSIQLPIEPGLLEWLQAQYPASKYQIVETGDHNDNN* |
| Ga0070744_100480082 | 3300006484 | Estuarine | MKYITNKFDSVRLPVEEGLLEWLQMQYPASKYFIKEI* |
| Ga0079301_11991802 | 3300006639 | Deep Subsurface | MRYITNKFDSVRLPVEEGLLEWLQEKYPASKYFIKEI* |
| Ga0102919_11715211 | 3300007597 | Estuarine | HQTTTRVCTTMRYITNKFDSVRLPVEEGLLEWLQARYPASKYHIKEA* |
| Ga0108970_116379905 | 3300008055 | Estuary | MRYITNKFDSIRLPIEEGLLEWLQQTYPASKYYVKEI* |
| Ga0114340_10706582 | 3300008107 | Freshwater, Plankton | MKYITNKFDSIRLPVEEGLLEWLQEKYPASKYFIKEI* |
| Ga0114341_1001029911 | 3300008108 | Freshwater, Plankton | MKYITNKFDSIRLPVEEGLLEWLQAKYPASKYFIKET* |
| Ga0102829_12772472 | 3300009026 | Estuarine | MKYITNKFESIRLPVEEGLLEWLQAQYPASKYHIKEA* |
| Ga0114962_1001126814 | 3300009151 | Freshwater Lake | MKYITNKFDNVRFPVEPGLLEWLRENYPASKYIIKEIK* |
| Ga0114962_100218184 | 3300009151 | Freshwater Lake | MRYITNKFDSIRLPVEPGLLEWLQETYPASKYFIKDIE* |
| Ga0114962_102057882 | 3300009151 | Freshwater Lake | MKYITNKFDSIRLPVEPGLLEWLQENYPASKYIIKEIK* |
| Ga0114962_105424792 | 3300009151 | Freshwater Lake | MRYITNKFESIRLPVEPGLLEWLQETYPASKYFIKDIE* |
| Ga0114980_100319479 | 3300009152 | Freshwater Lake | MRYITNKFDSVRLPVEEGLLEWLQAQYPASKYHIKEA* |
| Ga0114975_100000842 | 3300009164 | Freshwater Lake | MKYITNKFDSVRLPVEPGLLEWLQEQYPASKYFIKET* |
| Ga0114975_1000036245 | 3300009164 | Freshwater Lake | MRYITNKFESIRLPVEAGLLEWLQENYPASKYYIKEI* |
| Ga0114975_100045074 | 3300009164 | Freshwater Lake | MNSRYITNKFDSIRLPVEEGLLEWLQKQYPASKYFIKEIQ* |
| Ga0114975_1001248410 | 3300009164 | Freshwater Lake | MRYITNKFDSIRLPVEPGLLEWLQETYPASKYFIKDTINEMV* |
| Ga0114979_1002023210 | 3300009180 | Freshwater Lake | MRYITNKFDSIRLPVEPGLLEWLQETYPASKYFIK |
| Ga0114979_101705195 | 3300009180 | Freshwater Lake | VCTTMRYITNKFDSIRLPVDPGLLEWLQERYPASKYFIKET* |
| Ga0114959_100974086 | 3300009182 | Freshwater Lake | MKYITNKFENIRLPVEDGLLEWLQEIYPASKYFIKEI* |
| Ga0114959_101757462 | 3300009182 | Freshwater Lake | MKYITNKFDSIRLPCEEGMLEWLQETYPNSEYRIVEA* |
| Ga0114967_100773522 | 3300010160 | Freshwater Lake | MNKIKYITNKFESIRLPVEDGLLEWLQEQYPASKYFIKDTANEMV* |
| Ga0133913_106767322 | 3300010885 | Freshwater Lake | MYITNRYENIRLPVEPGLLEWLQANYPNSLYYIKEIENVR* |
| Ga0157139_10152973 | 3300012345 | Freshwater | MRYITNKFESIRFPVEEGLLEWLQENYPASKYYIKEM* |
| Ga0157203_100160610 | 3300012663 | Freshwater | MKYITNKFDSVRLPVEPGLLEWLQVKYPASKYFIKET* |
| Ga0157203_10435582 | 3300012663 | Freshwater | MKYITNKFDSVRLPVEEGLLEWLQAKYPASKYFIKEI* |
| Ga0157210_100003956 | 3300012665 | Freshwater | MKYITNKFESIRFPVEEGLLEWLQENYPASKYYIKEI* |
| Ga0157210_10000551 | 3300012665 | Freshwater | YQTTTRVCTTMKYITNKFDSVRLPVEEGLLEWLQAKYPASKYFIKET* |
| Ga0157210_10070522 | 3300012665 | Freshwater | MKYITNKFESIRLPVEEGLLEWLQEQYPASKYFIKEV* |
| Ga0157210_10153605 | 3300012665 | Freshwater | TRVCTTMKYITNKFESIRLPVEEGLLEWLQEKYPASKYYIKEV* |
| Ga0164293_101025415 | 3300013004 | Freshwater | MKYITNKFDSIRFPCEDGLLEWLQATYPASKYYIKEI* |
| Ga0164294_100001493 | 3300013006 | Freshwater | MRYITNKFDSVRLPVEEGLLEWLQAKYPASKYYIKEQE* |
| Ga0164296_10897182 | 3300013093 | Freshwater | MKYITNKFDSVRLPYAEDLLEWLQKTYPHSKYHVKEIHYGN* |
| Ga0136641_100000461 | 3300013286 | Freshwater | MRYITNKFDSIRLPVESGLLEWLQAQYPASKYYIKEN* |
| Ga0181359_11095582 | 3300019784 | Freshwater Lake | MRYITNKFDSVRLPVEEGLLEWLQEQYPASKYFIKEVE |
| Ga0181359_12127343 | 3300019784 | Freshwater Lake | MRYITNKFDSVRLPVEEGLLEWLQAKYPASKYYIKEV |
| Ga0211732_111083612 | 3300020141 | Freshwater | MRYITNKFESIRLPVEDGLLEWLQENYPNSKYYIKED |
| Ga0211732_12032461 | 3300020141 | Freshwater | RVCTTMRYITNKFDSVRLPVEEGLLEWLQERYPASKYFIKELE |
| Ga0211732_15868302 | 3300020141 | Freshwater | MKYITNKFDSVRLPVEEGLLEWLQEKYPASKYFIKET |
| Ga0211736_100007921 | 3300020151 | Freshwater | MKYITNKFDSIRLPIEEGLLEWLQERYPASKYFIKET |
| Ga0211736_104940302 | 3300020151 | Freshwater | MRYITNKFDSIRLPIEEGLLEWLQEKYPASKYFIKET |
| Ga0211736_107386321 | 3300020151 | Freshwater | MRYITNKFDSIRLPIEEGLLEWLQAKYPASKYYIKEI |
| Ga0211736_107422691 | 3300020151 | Freshwater | MRYITNKFDSVRLPVEDGLLEWLQAQYPASKYFIKELE |
| Ga0211734_112612081 | 3300020159 | Freshwater | MKYITNKFDSIRLPIEEGLLEWLQERYPASKYHIKETQ |
| Ga0211733_101862391 | 3300020160 | Freshwater | AMKYITNKFDNIRLPIEPGLLEWLQQNYPASQYYIKET |
| Ga0211733_104742292 | 3300020160 | Freshwater | MRYITNKFDSVRLPVEEGLLEWLQERYPASKYFIKET |
| Ga0211733_109286922 | 3300020160 | Freshwater | MRYITNKFDSIRLPIEEGLLEWLQAKYPASKYFIKEI |
| Ga0211735_112126191 | 3300020162 | Freshwater | TTRVCTPMRYITNKFDSIRLPIEEGLLEWLQAKYPASKYFIKEI |
| Ga0211729_109416511 | 3300020172 | Freshwater | TTTRVCTPMRYITNKFDSIRLPIEEGLLEWLQEKYPASKYFIKET |
| Ga0211731_101112295 | 3300020205 | Freshwater | MKYITNKFDSIRLPYEADLLEWLQQQYPFSKYQVKEI |
| Ga0211731_111273922 | 3300020205 | Freshwater | MKYITNKFDSVRLPIEEGLLEWLQAKYPASKYFIKEI |
| Ga0211731_112393551 | 3300020205 | Freshwater | MKYITNKFDSIRLPIEEGLLEWLQEKYPASKYHIKETQ |
| Ga0208232_10424032 | 3300020527 | Freshwater | MRYITNKFDSVRLPVEEGLLEWLQTQYPASKYFIMEL |
| Ga0214166_10148603 | 3300021139 | Freshwater | MKYITNKFDSVRLPYTEDLLEWLQQTYPHSKYHVKEIHYGN |
| Ga0194048_100814742 | 3300021519 | Anoxic Zone Freshwater | MKYITNKFENIRLPVEEGLLEWLQENYPASKYFIKEI |
| Ga0194048_101717472 | 3300021519 | Anoxic Zone Freshwater | MKYITNKFDSVRLPAEPGLLEWLQENYPASKYIIKEIK |
| Ga0213921_10148914 | 3300021952 | Freshwater | MKYITNKFESIRLPVEAGLLEWLQAKYPASQYYIKEI |
| Ga0222713_101959965 | 3300021962 | Estuarine Water | MRYITNKFDSVRLPVEEGLLEWLQAKYPASKYFIKEI |
| Ga0181351_10701303 | 3300022407 | Freshwater Lake | MKYITNKFDSVRLPVEEGLLEWLQAKYPASKYYIKE |
| Ga0214921_1000239650 | 3300023174 | Freshwater | MKYITNKFDNIRLPYAKDLLEWLQQTYPHSQYQVKD |
| Ga0214919_1000536029 | 3300023184 | Freshwater | MYITNRYENIRLPVEPGLLEWLQANYPNSLYYIKEIENVR |
| Ga0244775_1000902811 | 3300024346 | Estuarine | MRYITNKFDSVRLPVEEGLLEWLQTQYPASKYFIKEI |
| Ga0244775_107569702 | 3300024346 | Estuarine | MKYITNKFDSVRLPVEEGLLEWLQMQYPASKYFIKEI |
| Ga0244775_110114472 | 3300024346 | Estuarine | MRYITNKFDSVRLPVEEGLLEWLQARYPASKYHIKEA |
| Ga0255246_11352872 | 3300024863 | Freshwater | MRYITNKFDSVRLPIEEGLLEWLQAKYPASKYYIKEI |
| Ga0208257_10574011 | 3300025389 | Freshwater | NKFDSVRLPYAEDLLEWLQQTYPHSKYHVKEIHYGN |
| Ga0208380_10594001 | 3300025392 | Freshwater | MKYITNKFDSVRLPYAEDLLEWLQQTYPHSKYHVKEIHYGN |
| Ga0208009_10283252 | 3300027114 | Deep Subsurface | MRYITNKFDSVRLPVEEGLLEWLQEKYPASKYFIKEI |
| Ga0255102_100046317 | 3300027144 | Freshwater | MRYITNKFDSVRLPIEEGLLEWLQAKYPASKYYIK |
| Ga0209651_10495062 | 3300027581 | Freshwater Lake | MRYITNKFDSVRLPVEEGLLEWLQAQYPASKYHIKELE |
| Ga0208133_11137631 | 3300027631 | Estuarine | MKYITNKFESVRLPVEAGLLEWLQAKYPASKYVIKEL |
| Ga0209135_10440472 | 3300027642 | Freshwater Lake | MKYITNKFDSIRLPVEEGLLEWLQAKYPASKYHIKELE |
| Ga0209135_12585372 | 3300027642 | Freshwater Lake | MKYITNKFDSVRLPVEDGLLEWLQAKYPASKYHIKE |
| Ga0209769_12784253 | 3300027679 | Freshwater Lake | TTTRVRATMKYITNKFDSIRLPVEEGLLEWLQAKYPASKYHIKELE |
| Ga0209188_1000003153 | 3300027708 | Freshwater Lake | MKYITNKFDNVRFPVEPGLLEWLRENYPASKYIIKEIK |
| Ga0209188_12688601 | 3300027708 | Freshwater Lake | MKYITNKFENIRLPVEDGLLEWLQEIYPASKYFIKEI |
| Ga0209084_10151619 | 3300027749 | Freshwater Lake | MRYITNKFDSIRLPVEPGLLEWLQETYPASKYFIKDIE |
| Ga0209084_10595432 | 3300027749 | Freshwater Lake | MKYITNKFDSIRLPVEPGLLEWLQENYPASKYIIKEIK |
| Ga0209296_10846293 | 3300027759 | Freshwater Lake | MRYITNKFDSVRLPVEEGLLEWLQAQYPASKYHIKEA |
| Ga0209768_100703127 | 3300027772 | Freshwater Lake | ATRVCAEMRYITNKFDSVRLPIEEGLLEWLQAKYPASKYYIKEI |
| Ga0209107_100141032 | 3300027797 | Freshwater And Sediment | MMYITNKFDSIRLPVEPGLLEWLQQNYPASQYYIKEQ |
| Ga0209353_102338391 | 3300027798 | Freshwater Lake | SGIQQTMRYITNKFDSIRFPCEEGLLEWLQATYPASKYYIKEI |
| Ga0209191_100001179 | 3300027969 | Freshwater Lake | MRYITNKFESIRLPVEAGLLEWLQENYPASKYYIKEI |
| Ga0209191_100466011 | 3300027969 | Freshwater Lake | MRYITNKFDSIRLPVDPGLLEWLQERYPASKYFIKEI |
| Ga0209191_10354094 | 3300027969 | Freshwater Lake | MRYITNKFDSIRLPVEPGLLEWLQETYPASKYFIKDTINEMV |
| Ga0304729_10030486 | 3300028392 | Freshwater Lake | MYITNRYDTIRLPVEPGLLEWLQANYPNSLYRIKEIENVR |
| Ga0304730_11008773 | 3300028394 | Freshwater Lake | MNKIKYITNKFESIRLPVEDGLLEWLQVRYPASKYFIKDTANEMV |
| Ga0315905_100524345 | 3300032092 | Freshwater | MRYITNKFDSIRFPCEEGLLEWLQATYPASKYYIKEI |
| Ga0334980_0055037_887_1000 | 3300033816 | Freshwater | MKYITNKFDSVRLPVEAGLLEWLQAKYPASKYHIKEL |
| Ga0334992_0057346_1411_1527 | 3300033992 | Freshwater | MKYITNKFDSIRLPVEEGLLEWLQARYPASKYYIKELG |
| Ga0334991_0024917_962_1075 | 3300034013 | Freshwater | MKYITNKFESVRLPVEEGLLEWLQAKYPASKYVIKEL |
| Ga0334987_0137849_1633_1749 | 3300034061 | Freshwater | MKYITNKFDSVRLPVEEGLLEWLQAKYPASKYFIKELV |
| Ga0335028_0140383_1181_1294 | 3300034071 | Freshwater | MKYITNKFESIRLPVEAGLLEWLQEHYPASKYYIKEI |
| Ga0335028_0355391_502_615 | 3300034071 | Freshwater | MKYITNKFESIRLPVEAGLLEWLQAKYPASKYVIKEI |
| Ga0335029_0766198_249_362 | 3300034102 | Freshwater | MKYITNKFESIRLPVEEGLLEWLQQTYPASQYYIKEI |
| ⦗Top⦘ |