


| Basic Information | |
|---|---|
| Family ID | F076077 |
| Family Type | Metagenome |
| Number of Sequences | 118 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MFTEQEKLEITIDGLRNGDIFMNEDGIPVDECGDPIFEDDQ |
| Number of Associated Samples | 77 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 82.20 % |
| % of genes near scaffold ends (potentially truncated) | 23.73 % |
| % of genes from short scaffolds (< 2000 bps) | 76.27 % |
| Associated GOLD sequencing projects | 73 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.847 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (22.034 % of family members) |
| Environment Ontology (ENVO) | Unclassified (72.034 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (80.508 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.20% β-sheet: 4.88% Coil/Unstructured: 82.93% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF01844 | HNH | 5.08 |
| PF16363 | GDP_Man_Dehyd | 2.54 |
| PF04542 | Sigma70_r2 | 1.69 |
| PF00436 | SSB | 0.85 |
| PF07394 | DUF1501 | 0.85 |
| PF03237 | Terminase_6N | 0.85 |
| PF00574 | CLP_protease | 0.85 |
| PF14279 | HNH_5 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.69 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.69 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 1.69 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 1.69 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.69 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 1.69 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.85 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 50.85 % |
| All Organisms | root | All Organisms | 49.15 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10012621 | All Organisms → Viruses → Predicted Viral | 4319 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10148704 | Not Available | 805 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10000513 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 24234 | Open in IMG/M |
| 3300000159|LPaug08P2610mDRAFT_c1022923 | Not Available | 653 | Open in IMG/M |
| 3300000199|SI39nov09_10mDRAFT_c1024112 | Not Available | 525 | Open in IMG/M |
| 3300001346|JGI20151J14362_10001632 | All Organisms → cellular organisms → Bacteria | 16213 | Open in IMG/M |
| 3300001589|JGI24005J15628_10056154 | All Organisms → Viruses → Predicted Viral | 1490 | Open in IMG/M |
| 3300001589|JGI24005J15628_10094107 | All Organisms → Viruses → Predicted Viral | 1022 | Open in IMG/M |
| 3300002231|KVRMV2_100053752 | All Organisms → cellular organisms → Bacteria | 3725 | Open in IMG/M |
| 3300003543|FS898DNA_10931955 | Not Available | 617 | Open in IMG/M |
| 3300004279|Ga0066605_10083642 | All Organisms → Viruses → Predicted Viral | 1358 | Open in IMG/M |
| 3300006027|Ga0075462_10000013 | All Organisms → cellular organisms → Bacteria | 46237 | Open in IMG/M |
| 3300006484|Ga0070744_10090812 | Not Available | 884 | Open in IMG/M |
| 3300006735|Ga0098038_1026996 | All Organisms → Viruses → Predicted Viral | 2158 | Open in IMG/M |
| 3300006735|Ga0098038_1047781 | All Organisms → Viruses → Predicted Viral | 1552 | Open in IMG/M |
| 3300006735|Ga0098038_1060359 | All Organisms → Viruses → Predicted Viral | 1356 | Open in IMG/M |
| 3300006735|Ga0098038_1192199 | Not Available | 664 | Open in IMG/M |
| 3300006737|Ga0098037_1087174 | All Organisms → Viruses → Predicted Viral | 1091 | Open in IMG/M |
| 3300006749|Ga0098042_1029056 | All Organisms → Viruses → Predicted Viral | 1579 | Open in IMG/M |
| 3300006749|Ga0098042_1141148 | Not Available | 594 | Open in IMG/M |
| 3300006802|Ga0070749_10003217 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 10920 | Open in IMG/M |
| 3300006921|Ga0098060_1002143 | All Organisms → cellular organisms → Bacteria | 7711 | Open in IMG/M |
| 3300006921|Ga0098060_1121013 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 734 | Open in IMG/M |
| 3300006928|Ga0098041_1072126 | All Organisms → Viruses → Predicted Viral | 1114 | Open in IMG/M |
| 3300007550|Ga0102880_1143690 | Not Available | 625 | Open in IMG/M |
| 3300007555|Ga0102817_1046842 | Not Available | 947 | Open in IMG/M |
| 3300007954|Ga0105739_1123657 | Not Available | 603 | Open in IMG/M |
| 3300009141|Ga0102884_1105063 | Not Available | 711 | Open in IMG/M |
| 3300009481|Ga0114932_10726349 | Not Available | 577 | Open in IMG/M |
| 3300009528|Ga0114920_11214363 | Not Available | 517 | Open in IMG/M |
| 3300009703|Ga0114933_10073613 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 2443 | Open in IMG/M |
| 3300009703|Ga0114933_10255128 | All Organisms → Viruses → Predicted Viral | 1173 | Open in IMG/M |
| 3300009703|Ga0114933_10436736 | Not Available | 855 | Open in IMG/M |
| 3300009703|Ga0114933_10562112 | Not Available | 737 | Open in IMG/M |
| 3300010148|Ga0098043_1021483 | All Organisms → Viruses → Predicted Viral | 2068 | Open in IMG/M |
| 3300010148|Ga0098043_1065730 | All Organisms → Viruses → Predicted Viral | 1090 | Open in IMG/M |
| 3300010148|Ga0098043_1078852 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 979 | Open in IMG/M |
| 3300010148|Ga0098043_1125053 | Not Available | 739 | Open in IMG/M |
| 3300010149|Ga0098049_1220832 | Not Available | 579 | Open in IMG/M |
| 3300010153|Ga0098059_1035305 | All Organisms → Viruses → Predicted Viral | 2023 | Open in IMG/M |
| 3300010392|Ga0118731_105162610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium | 883 | Open in IMG/M |
| 3300012952|Ga0163180_10759278 | Not Available | 755 | Open in IMG/M |
| 3300012953|Ga0163179_10530199 | Not Available | 978 | Open in IMG/M |
| 3300012954|Ga0163111_11728111 | Not Available | 624 | Open in IMG/M |
| 3300017697|Ga0180120_10247499 | Not Available | 725 | Open in IMG/M |
| 3300017720|Ga0181383_1002209 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 5523 | Open in IMG/M |
| 3300017720|Ga0181383_1095626 | Not Available | 798 | Open in IMG/M |
| 3300017720|Ga0181383_1156584 | Not Available | 611 | Open in IMG/M |
| 3300017720|Ga0181383_1165134 | Not Available | 593 | Open in IMG/M |
| 3300017753|Ga0181407_1103603 | Not Available | 715 | Open in IMG/M |
| 3300017757|Ga0181420_1018541 | All Organisms → Viruses → Predicted Viral | 2323 | Open in IMG/M |
| 3300017757|Ga0181420_1080849 | All Organisms → Viruses → Predicted Viral | 1014 | Open in IMG/M |
| 3300017757|Ga0181420_1113845 | Not Available | 826 | Open in IMG/M |
| 3300017759|Ga0181414_1117754 | Not Available | 697 | Open in IMG/M |
| 3300017763|Ga0181410_1013799 | All Organisms → Viruses → Predicted Viral | 2765 | Open in IMG/M |
| 3300017763|Ga0181410_1054988 | All Organisms → Viruses → Predicted Viral | 1213 | Open in IMG/M |
| 3300017764|Ga0181385_1160261 | Not Available | 682 | Open in IMG/M |
| 3300017773|Ga0181386_1150253 | Not Available | 712 | Open in IMG/M |
| 3300017776|Ga0181394_1029449 | All Organisms → Viruses → Predicted Viral | 1928 | Open in IMG/M |
| 3300017783|Ga0181379_1047492 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1656 | Open in IMG/M |
| 3300019749|Ga0193983_1002863 | All Organisms → Viruses → Predicted Viral | 1569 | Open in IMG/M |
| 3300019751|Ga0194029_1001541 | All Organisms → Viruses → Predicted Viral | 2936 | Open in IMG/M |
| 3300019751|Ga0194029_1057948 | Not Available | 646 | Open in IMG/M |
| 3300020347|Ga0211504_1006297 | All Organisms → Viruses → Predicted Viral | 3968 | Open in IMG/M |
| 3300020377|Ga0211647_10267467 | Not Available | 539 | Open in IMG/M |
| 3300020428|Ga0211521_10425013 | Not Available | 578 | Open in IMG/M |
| 3300020428|Ga0211521_10437387 | Not Available | 568 | Open in IMG/M |
| 3300020438|Ga0211576_10000034 | Not Available | 109556 | Open in IMG/M |
| 3300020438|Ga0211576_10004185 | Not Available | 9923 | Open in IMG/M |
| 3300020438|Ga0211576_10149254 | Not Available | 1266 | Open in IMG/M |
| 3300020438|Ga0211576_10156308 | All Organisms → Viruses → Predicted Viral | 1232 | Open in IMG/M |
| 3300020439|Ga0211558_10287018 | Not Available | 773 | Open in IMG/M |
| 3300020440|Ga0211518_10097064 | All Organisms → Viruses → Predicted Viral | 1565 | Open in IMG/M |
| 3300020440|Ga0211518_10280002 | Not Available | 794 | Open in IMG/M |
| 3300020440|Ga0211518_10461393 | Not Available | 578 | Open in IMG/M |
| 3300020450|Ga0211641_10180125 | All Organisms → Viruses → Predicted Viral | 1058 | Open in IMG/M |
| 3300020451|Ga0211473_10278493 | Not Available | 860 | Open in IMG/M |
| 3300020451|Ga0211473_10408660 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 694 | Open in IMG/M |
| 3300020462|Ga0211546_10552677 | Not Available | 581 | Open in IMG/M |
| 3300020474|Ga0211547_10090042 | All Organisms → Viruses → Predicted Viral | 1614 | Open in IMG/M |
| 3300020474|Ga0211547_10174043 | All Organisms → Viruses → Predicted Viral | 1110 | Open in IMG/M |
| 3300020474|Ga0211547_10365977 | Not Available | 728 | Open in IMG/M |
| 3300021068|Ga0206684_1001719 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 8189 | Open in IMG/M |
| 3300022923|Ga0255783_10275737 | Not Available | 699 | Open in IMG/M |
| (restricted) 3300023109|Ga0233432_10179720 | All Organisms → Viruses → Predicted Viral | 1077 | Open in IMG/M |
| 3300024188|Ga0228602_1007306 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1264 | Open in IMG/M |
| 3300024188|Ga0228602_1054821 | Not Available | 643 | Open in IMG/M |
| 3300024235|Ga0228665_1059000 | Not Available | 791 | Open in IMG/M |
| (restricted) 3300024255|Ga0233438_10120422 | All Organisms → Viruses → Predicted Viral | 1166 | Open in IMG/M |
| (restricted) 3300024255|Ga0233438_10299504 | Not Available | 617 | Open in IMG/M |
| (restricted) 3300024264|Ga0233444_10009781 | All Organisms → cellular organisms → Bacteria | 7883 | Open in IMG/M |
| (restricted) 3300024264|Ga0233444_10371330 | Not Available | 598 | Open in IMG/M |
| (restricted) 3300024264|Ga0233444_10408412 | Not Available | 559 | Open in IMG/M |
| 3300024296|Ga0228629_1059085 | All Organisms → Viruses → Predicted Viral | 1034 | Open in IMG/M |
| 3300024332|Ga0228659_1142943 | Not Available | 504 | Open in IMG/M |
| 3300024335|Ga0228672_1178610 | Not Available | 530 | Open in IMG/M |
| 3300024348|Ga0244776_10090100 | All Organisms → Viruses → Predicted Viral | 2312 | Open in IMG/M |
| 3300025099|Ga0208669_1010736 | All Organisms → Viruses → Predicted Viral | 2560 | Open in IMG/M |
| 3300025099|Ga0208669_1123479 | Not Available | 523 | Open in IMG/M |
| 3300025101|Ga0208159_1006873 | All Organisms → Viruses → Predicted Viral | 3325 | Open in IMG/M |
| 3300025101|Ga0208159_1009774 | All Organisms → Viruses → Predicted Viral | 2633 | Open in IMG/M |
| 3300025132|Ga0209232_1204079 | Not Available | 602 | Open in IMG/M |
| 3300025138|Ga0209634_1006755 | All Organisms → cellular organisms → Bacteria | 7282 | Open in IMG/M |
| 3300025138|Ga0209634_1079955 | All Organisms → Viruses → Predicted Viral | 1505 | Open in IMG/M |
| 3300025138|Ga0209634_1277644 | Not Available | 590 | Open in IMG/M |
| 3300025696|Ga0209532_1016607 | All Organisms → Viruses → Predicted Viral | 3652 | Open in IMG/M |
| 3300025892|Ga0209630_10489342 | Not Available | 511 | Open in IMG/M |
| 3300027406|Ga0208965_1095932 | Not Available | 591 | Open in IMG/M |
| 3300028136|Ga0228608_1071395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 990 | Open in IMG/M |
| 3300028197|Ga0257110_1092336 | All Organisms → Viruses → Predicted Viral | 1275 | Open in IMG/M |
| 3300028197|Ga0257110_1186084 | Not Available | 812 | Open in IMG/M |
| 3300028197|Ga0257110_1249579 | Not Available | 662 | Open in IMG/M |
| 3300029448|Ga0183755_1104354 | Not Available | 549 | Open in IMG/M |
| 3300031519|Ga0307488_10002899 | All Organisms → cellular organisms → Bacteria | 14439 | Open in IMG/M |
| 3300031519|Ga0307488_10008972 | All Organisms → cellular organisms → Bacteria | 8133 | Open in IMG/M |
| 3300031519|Ga0307488_10153336 | All Organisms → Viruses → Predicted Viral | 1611 | Open in IMG/M |
| 3300031766|Ga0315322_10814560 | Not Available | 575 | Open in IMG/M |
| 3300032047|Ga0315330_10311079 | Not Available | 991 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 22.03% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 17.80% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 12.71% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 5.93% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 5.08% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 4.24% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.39% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 2.54% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 2.54% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.54% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.54% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.54% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.69% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.69% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.69% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.69% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.85% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.85% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.85% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.85% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.85% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.85% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.85% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.85% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.85% |
| Diffuse Hydrothermal Flow Volcanic Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent | 0.85% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000159 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2008 P26 10m | Environmental | Open in IMG/M |
| 3300000199 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 10m | Environmental | Open in IMG/M |
| 3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300003543 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS898_N3Area_DNA | Environmental | Open in IMG/M |
| 3300004279 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300007550 | Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3 | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007954 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_0.2um | Environmental | Open in IMG/M |
| 3300009141 | Estuarine microbial communities from the Columbia River estuary - metaG 1550A-3 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009528 | Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaG | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300019749 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLT_4-5_MG | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300020377 | Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556007-ERR599065) | Environmental | Open in IMG/M |
| 3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300020440 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043) | Environmental | Open in IMG/M |
| 3300020450 | Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020462 | Marine microbial communities from Tara Oceans - TARA_B100001559 (ERX556040-ERR598986) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300021068 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015 | Environmental | Open in IMG/M |
| 3300022923 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300024188 | Seawater microbial communities from Monterey Bay, California, United States - 2D | Environmental | Open in IMG/M |
| 3300024235 | Seawater microbial communities from Monterey Bay, California, United States - 79D | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300024296 | Seawater microbial communities from Monterey Bay, California, United States - 36D | Environmental | Open in IMG/M |
| 3300024332 | Seawater microbial communities from Monterey Bay, California, United States - 73D | Environmental | Open in IMG/M |
| 3300024335 | Seawater microbial communities from Monterey Bay, California, United States - 90D | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025696 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027406 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_07_M0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300028136 | Seawater microbial communities from Monterey Bay, California, United States - 9D | Environmental | Open in IMG/M |
| 3300028197 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
| 3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_100126217 | 3300000116 | Marine | MFTEQEKLEITIDGLRNGDVFMNEDGVPVDECGDPIFEDDQ* |
| DelMOSpr2010_101487043 | 3300000116 | Marine | MFTEQEKLEITIDGLRNGDIFMNEDGIPVDEYGDPIFEDDQ* |
| DelMOWin2010_1000051320 | 3300000117 | Marine | MFTEQEKMEMIIEGIRNGDVFMKDGIAVDEYGDPIFEEDADAQN* |
| LPaug08P2610mDRAFT_10229232 | 3300000159 | Marine | MFTEQDKLEITIDGLRNGDIFMNEDGIPVDEHGDPIFEDDQ* |
| SI39nov09_10mDRAFT_10241123 | 3300000199 | Marine | MFTEQEKLEITIDGLRNGDIFMSEDGIPVDECGDPIFEDDQ* |
| JGI20151J14362_1000163218 | 3300001346 | Pelagic Marine | MFDEQDKLEITIDGLRNGDIFRNEDGVPVDECGDPIFEDDQ* |
| JGI24005J15628_100561544 | 3300001589 | Marine | VLTILYNREKEITMFNEQEKLEITIDGLRNGDIFMNEDGIPVDEYGDPIFEDDQ* |
| JGI24005J15628_100941073 | 3300001589 | Marine | MFTEQEKLEITIDGLRNGDIFMNENNVPVDECGDPIFEDDKK* |
| KVRMV2_1000537523 | 3300002231 | Marine Sediment | MFTEQEKMEMIIEGIRNGDVFMKDGIAVDEYGDPIFEEDTK* |
| FS898DNA_109319551 | 3300003543 | Diffuse Hydrothermal Flow Volcanic Vent | MFTEQEKLEITIDGLRNGDIFMQDGIPVDECGDPIFEDDKNE* |
| Ga0066605_100836423 | 3300004279 | Marine | MFKFTEQDKLEITIDGLRNGDIFMSEDGIPVDECGDPIFEDDQ* |
| Ga0075462_100000139 | 3300006027 | Aqueous | MDDILYSREKEIIMFTEQEKLEITIDGLRNGDIFMNEDGIPVDECGDPIFEDDQ* |
| Ga0070744_100908123 | 3300006484 | Estuarine | EKEITMFTEQEKLEITIDGLRNGDIFMSEDGIPVDEYGDPIFEDDK* |
| Ga0098038_10269962 | 3300006735 | Marine | MFTEQEKMEMIVEGIQNGDVFMRDGIAVDEYGDPIFEEDANAQN* |
| Ga0098038_10477814 | 3300006735 | Marine | MFTEQEKLEITIDGLRSGDIFMNEDGVPVDEYGDPIFEDDQ* |
| Ga0098038_10603593 | 3300006735 | Marine | MFTEQEKLEITIDGLRNGDIFMSEDGIPVDEHGDPIFEDDQ* |
| Ga0098038_11921991 | 3300006735 | Marine | EKEIIMFTEQEKLEITIDGLRSGDIFMNEDGIPVDEYGDPIFEDDQ* |
| Ga0098037_10871744 | 3300006737 | Marine | MFTEQEKLEITIDGLRSGDIFMNEDGIPVDEYGDPIFEDDQ* |
| Ga0098042_10290564 | 3300006749 | Marine | MFTEQEKLEITIDGLRNGDIFMSEDGIPVDEYGDPIFEDDQ* |
| Ga0098042_11411483 | 3300006749 | Marine | MFSEQEKLEITIDGLRNGDIFMKDGIPVDECGDPIFEEDADAQN* |
| Ga0070749_1000321723 | 3300006802 | Aqueous | MFTEQEKLEITIDGLRNGDIFMNEDGIPVDECGDPIFEDDQ* |
| Ga0098060_10021434 | 3300006921 | Marine | MFTEQEKLEITIDGLRSGDIFMSEDGIPVDECGDPIFEDDQ* |
| Ga0098060_11210133 | 3300006921 | Marine | MFTEQEKMEMIIEGIRNGDVFMKNGIAVDEYDDPIFEEDAE* |
| Ga0098041_10721264 | 3300006928 | Marine | MDDILYSREKEIIMFTEQEKLEITIDGLRSGDIFMNEDGIPVDEYGDPIFEDDQ* |
| Ga0102880_11436901 | 3300007550 | Estuarine | MFDEQDKLEITIDGLRNGDIFMNEDGIPVDEYGDPIFEDDQ* |
| Ga0102817_10468424 | 3300007555 | Estuarine | MFTEQEKLEITIDGLRNGDIFMNENNVPVDECGDPIFEEDNNE* |
| Ga0105739_11236572 | 3300007954 | Estuary Water | MFSEQEKLEITIDGLRNGDIFMNEDGIPVDEHGDPIFEDDK* |
| Ga0102884_11050633 | 3300009141 | Estuarine | DDICYSREKEITMFTEQEKLEITIDGLRNGDIFMSEDGIPVDEYGDPIFEDDQ* |
| Ga0114932_107263492 | 3300009481 | Deep Subsurface | MTEQEKLEITVEGLFNGYIIMVDDVACDMWGDPIFEDDQ* |
| Ga0114920_112143633 | 3300009528 | Deep Subsurface | MFTEQEKLEITIDGLRNGDIFMNENNVPVDECGDPIFEDDKNE* |
| Ga0114933_100736133 | 3300009703 | Deep Subsurface | MKMFTEQEKMEMIIEGIRNGDVFMKDGIAVDEYGDPIFEEDTK* |
| Ga0114933_102551281 | 3300009703 | Deep Subsurface | MFTEQEKMEMIIEGVRNGDVFMKDGIAVDEYGDPIFEEDVKE* |
| Ga0114933_104367363 | 3300009703 | Deep Subsurface | MFTEQEKMEMIIEGIRNGDVFMKDGIAVDEYGDPIFEEDANAQN* |
| Ga0114933_105621123 | 3300009703 | Deep Subsurface | MFTEQEKLEITIDGLRNGDIFLNEDGVPVDECGDPIFEDDA* |
| Ga0098043_10214837 | 3300010148 | Marine | MFNEQEKLEITIDGLRSGDIFMNEDGIPVDEYGDPIFEDDQ* |
| Ga0098043_10657304 | 3300010148 | Marine | KLEITIDGLRNGDIFMSEDGIPVDEYGDPIFEDDQ* |
| Ga0098043_10788524 | 3300010148 | Marine | MFTEQEKLEITIDGLRNGDIFMSEDGIPVDEYGDPIFEDD |
| Ga0098043_11250533 | 3300010148 | Marine | TEQEKLEITIDGLRNGDIFMSEDGIPVDEHGDPIFEDDQ* |
| Ga0098049_12208322 | 3300010149 | Marine | MFTEQEKLEITIDGLRSGDIFMSEDGIPVDEYGDPIFEDDQ* |
| Ga0098059_10353055 | 3300010153 | Marine | QEKLEITIDGLRSGDIFMSEDGIPVDEYGDPIFEDDQ* |
| Ga0118731_1051626104 | 3300010392 | Marine | MFTEQEKLEITIEGIQNGDVFMVDGVACDQCGDPIFEDDQ* |
| Ga0163180_107592781 | 3300012952 | Seawater | MFTEQEKLEITVEGLFNGYILMVDGVACDEWGDPIFEEDAQ* |
| Ga0163179_105301993 | 3300012953 | Seawater | MFTEQEKLEITIDGLRNGDIFLNEDGVPVDEYGDPIFEDDQ* |
| Ga0163111_117281113 | 3300012954 | Surface Seawater | MMIDFTEQDKMEIIVEGLANGDIFMNEDGVAVDTWGDPIFE |
| Ga0180120_102474992 | 3300017697 | Freshwater To Marine Saline Gradient | MDDILYSRGKEIIMFKFTEQEKLEITIDGLRNGDIFMNEDGIPVDEHGDPIFEDDK |
| Ga0181383_100220913 | 3300017720 | Seawater | MFTEQEKMEMIVEGIRNGDVFMKDGIAVDEYGDPIFEEDANAQN |
| Ga0181383_10956261 | 3300017720 | Seawater | MFTEQEKLEITIDGLRNGDIFMQDGIPVDEYGDPIFEDDQ |
| Ga0181383_11565842 | 3300017720 | Seawater | MFTEQEKLEITIDGLRNGDIFMSEDGVPVDEYGDPIFEDDQ |
| Ga0181383_11651342 | 3300017720 | Seawater | MFTEQEKLEITIDGLRNGDIFMNEDGVPVDEYGDPIFEEDA |
| Ga0181407_11036032 | 3300017753 | Seawater | MFTEQEKLEITIDGLRNGDIFMIEDGIPVDEYGDPIFEDDQ |
| Ga0181420_10185413 | 3300017757 | Seawater | MFTEQEKLEITIDGLRNGDIFMNEDGVPVDEYGDPIFEEDVK |
| Ga0181420_10808492 | 3300017757 | Seawater | MFTEQEKLEITIDGLRNGDIFMSEDGIPVDECGDPIFEDDNK |
| Ga0181420_11138455 | 3300017757 | Seawater | MFTEQEKLEITIEGIQNGDVFMVDGVACDQCGDPIFE |
| Ga0181414_11177541 | 3300017759 | Seawater | MFSEQEKLEITIDGLRNGDIFMQDGIPVDEYGDPIFEDDQ |
| Ga0181410_10137992 | 3300017763 | Seawater | MFTEQEKLEITIDGLRNGDIFMSEDGIPVDECGDPIFEDDKNE |
| Ga0181410_10549881 | 3300017763 | Seawater | MFTEQEKLEITIDGLRNGDIFMNENNVPVDECGDPIFED |
| Ga0181385_11602613 | 3300017764 | Seawater | MFKFTEQEKLEITIDGLRNGDIFMSEDGIPVDECGDPIFEDDKNE |
| Ga0181386_11502531 | 3300017773 | Seawater | KEIIMFTEQEKLEITIDGLRNGDIFMNEDGIPVDEYGDPIFEDDQ |
| Ga0181394_10294491 | 3300017776 | Seawater | RSWLMFTEQEKLEITIDGLRNGDIFMKDGIPVDEYGDPIFEDDANDQD |
| Ga0181379_10474924 | 3300017783 | Seawater | MFTEQEKLAITIDGLRNGDIFMNEDGIPVDECGDPIFEEDVE |
| Ga0193983_10028634 | 3300019749 | Sediment | MDDILYSREKEIIMFTEQEKLEITIDGLRNGDIFMNEDGIPVDECGDPIFEDDQ |
| Ga0194029_10015412 | 3300019751 | Freshwater | MFTEQEKLEITIDGLRNGDIFMNEDGIPVDECGDPIFEDDQ |
| Ga0194029_10579482 | 3300019751 | Freshwater | MFTEQEKMEMIIEGIRNGDVFMKDGIAVDEYGDPIFEEDADAQN |
| Ga0211504_10062974 | 3300020347 | Marine | MFTEQEKLEITIDGLRNGDIFMNEDGVPVDEHGDPIFEDDQ |
| Ga0211647_102674672 | 3300020377 | Marine | MFNEQEKIEITIEGIQNGDIFMKDGIAVDEYGDPIFEEDTND |
| Ga0211521_104250132 | 3300020428 | Marine | MFTEQEKLEITVEGLFNGYIIMVDDVACDMWGDPIF |
| Ga0211521_104373871 | 3300020428 | Marine | MFTEQEKLEITIDGLRNGDIFMQDGIPVDEYGDPIFEEDQE |
| Ga0211576_10000034109 | 3300020438 | Marine | MFTEQEKLEITIDGLRNGDIFMSEDGIPVDECGDPIFEDDKK |
| Ga0211576_100041857 | 3300020438 | Marine | MFSEQEKLEITIDGLRNGDIFMQDGIPVDEYGDPIFEEDQE |
| Ga0211576_101492543 | 3300020438 | Marine | MFTEQEKLEITIDGLRNGDIFMNENNVPVDECGDPIFEDDKNE |
| Ga0211576_101563081 | 3300020438 | Marine | MFTEQEKLEITIDGLRNGDIFMSEDGIPVDEYGDPIFEDDQ |
| Ga0211558_102870182 | 3300020439 | Marine | MDDILYSRGKEIIMFNEQEKLEITIEGIQNGDIFMSEDGVPVDECGDPIFEEDAE |
| Ga0211518_100970645 | 3300020440 | Marine | MFNEQEKLEITIDGLRSGDIFMSEDGIPVDECGDPIFEDDQ |
| Ga0211518_102800022 | 3300020440 | Marine | MFTEQEKLEITIDGLRNGDIFMSEDGIPVDEYGDPIFEDDA |
| Ga0211518_104613931 | 3300020440 | Marine | MFTEQEKLEITVEGLFNGYIIMVDDVACDMWGDPI |
| Ga0211641_101801253 | 3300020450 | Marine | MFTEQEKLEITIDGLRNGDIFMNEDGVPVDECGDPIFEDDQ |
| Ga0211473_102784933 | 3300020451 | Marine | MFTEQEKLEITVEGLFNGYIIMVDDVACDMWGDPIFEEDAQ |
| Ga0211473_104086602 | 3300020451 | Marine | MFTEQEKMEMIVEGIQNGDVFMRDGIAVDEYGDPIFEEDANAQN |
| Ga0211546_105526771 | 3300020462 | Marine | MFTEQEKLEITIDGLRSGDIFMNEDGIPVDECGDPIFEDDQ |
| Ga0211547_100900426 | 3300020474 | Marine | MFTEQEKLEITIDGLRNGDIFMNEDGVPVDEYGDPIFEDDQ |
| Ga0211547_101740432 | 3300020474 | Marine | MFTEQEKLEIVIDGLRNGDIFMKDGIPVDEYGDPIFEDDKNEQQ |
| Ga0211547_103659771 | 3300020474 | Marine | MFTEQEKLEITIDGLRNGDIFLNEDGVPVDEYGDPIFEDDQ |
| Ga0206684_100171916 | 3300021068 | Seawater | MFTEQEKLEITIEGIQNGDVFMVDGVACDQCGDPIFEDDA |
| Ga0255783_102757372 | 3300022923 | Salt Marsh | MFTEQEKLEITIDGLRNGDIFMNEDGIPVDEYGDPIFEDDQ |
| (restricted) Ga0233432_101797202 | 3300023109 | Seawater | MFKFTEQDKLEITIDGLRNGDIFMSEDGIPVDECGDPIFEDDQ |
| Ga0228602_10073065 | 3300024188 | Seawater | MFTEQEKLEITIDGLRNGDIFMNEDGIPVDEYGDPIFEDDKNE |
| Ga0228602_10548213 | 3300024188 | Seawater | MFTEQEKLEITIDGLRNGDIFMSEDGIPVDEHGDPIFEDDQ |
| Ga0228665_10590003 | 3300024235 | Seawater | MFTEQEKLEITIYGLRNGDIFMSEDGIPVDECGDPIFEDDQ |
| (restricted) Ga0233438_101204222 | 3300024255 | Seawater | MFDEQAKLEITIEGIQNGDVFMVDGVACDQCGDPIFEDDA |
| (restricted) Ga0233438_102995041 | 3300024255 | Seawater | FTEQEKLEITIDGLRNGDIFMNEDGIPVDECGDPIFEDDQ |
| (restricted) Ga0233444_1000978120 | 3300024264 | Seawater | MFDEQAKLEITIEGIQNGDVFMVNGIACDECGDPIFEEDRE |
| (restricted) Ga0233444_103713302 | 3300024264 | Seawater | MFTEQEKLEITIDGLRNGDIFMSEDGIPVDECGDPIFE |
| (restricted) Ga0233444_104084123 | 3300024264 | Seawater | ICYSREKEITMFTEQEKLEITIDGLRNGDIFMSEDGIPVDECGDPIFEDDQ |
| Ga0228629_10590851 | 3300024296 | Seawater | MVLTILYNREKEITMFTEQEKLEITIDGLRNGDIFMSEDGIPVDECGDPIFE |
| Ga0228659_11429433 | 3300024332 | Seawater | ITMFTEQEKLEITIDGLRNGDIFMSEDGIPVDEYGDPIFEDDQ |
| Ga0228672_11786102 | 3300024335 | Seawater | MFTEQEKLEITIDGLRNGDIFMSEDGIPVDEHGDPIFEDDQXKKYIRK |
| Ga0244776_100901002 | 3300024348 | Estuarine | MFTEQEKLEITIDGLRNGDIFMNENNVPVDECGDPIFEEDNNE |
| Ga0208669_10107364 | 3300025099 | Marine | MFTEQEKLEITIDGLRSGDIFMSEDGIPVDECGDPIFEDDQ |
| Ga0208669_11234792 | 3300025099 | Marine | MFTEQEKMEMIIEGIRNGDVFMKNGIAVDEYDDPIFEEDAE |
| Ga0208159_10068733 | 3300025101 | Marine | MFSEQEKLEITIDGLRNGDIFMKDGIPVDECGDPIFEEDADAQN |
| Ga0208159_10097749 | 3300025101 | Marine | MFTEQEKLEITIDGLRSGDIFMNEDGIPVDEYGDPIFEDDQ |
| Ga0209232_12040793 | 3300025132 | Marine | MFTEQEKLEITIDGLRNGDIFMKDGIPVDEYGDPIFEDDAN |
| Ga0209634_10067558 | 3300025138 | Marine | MFTEQEKLEITIDGLRNGDIFMQDGIPVDECGDPIFEDDKNE |
| Ga0209634_10799553 | 3300025138 | Marine | MFTEQEKLEITIDGLRNGDIFMNENNVPVDECGDPIFEDDKK |
| Ga0209634_12776443 | 3300025138 | Marine | QEKLEITIDGLRNGDIFMNEDGIPVDEHGDPIFEDDQ |
| Ga0209532_10166074 | 3300025696 | Pelagic Marine | MFDEQDKLEITIDGLRNGDIFRNEDGVPVDECGDPIFEDDQ |
| Ga0209630_104893422 | 3300025892 | Pelagic Marine | MFNEQEKLEITIDGLRNGDIFMNEDGVPVDECGDPIFEDDQ |
| Ga0208965_10959321 | 3300027406 | Marine | MFTEQEKLEITIEGIQNGDVFMVDGVACDQCGDPIFEDD |
| Ga0228608_10713951 | 3300028136 | Seawater | MFTEQEKLEITIDGLRNGDIFMSEDGIPVDECGDPIFEDDQ |
| Ga0257110_10923362 | 3300028197 | Marine | MFNEQEKLEITIDGLRNGDIFMNEDGIPVDEYGDPIFEDDA |
| Ga0257110_11860843 | 3300028197 | Marine | MFDEQEKLEITIDGLRNGDIFMSEDGIPVDEHGDPIFEDDQXKKYIKKY |
| Ga0257110_12495793 | 3300028197 | Marine | EKLEITIDGLRNGDIFMNENNVPVDECGDPIFEDDKK |
| Ga0183755_11043543 | 3300029448 | Marine | MFNEQEKLEITIEGIQNGDIFMNDDGVPVDECGDPIFEDDKNE |
| Ga0307488_100028996 | 3300031519 | Sackhole Brine | MFTEQEKLEITIDGLRNGDIFMNENNVPVDECGDPIFEDDNNE |
| Ga0307488_1000897215 | 3300031519 | Sackhole Brine | MFNEQEKLEITIDGLRNGDIFMSEDGIPVDECGDPIFEDDA |
| Ga0307488_101533363 | 3300031519 | Sackhole Brine | MFTEQDKLEITIDGLRNGDIFMSEDGIPVDECGDPIFEDDQ |
| Ga0315322_108145602 | 3300031766 | Seawater | MFTEQEKLEITIEGIQNGDVFMVNGVACDECGDPIFEDDQ |
| Ga0315330_103110793 | 3300032047 | Seawater | MFTEQEKLEITVEGLFNGYIIMVDGVACDMWGDPIFEDDQ |
| ⦗Top⦘ |