


| Basic Information | |
|---|---|
| Family ID | F076045 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 118 |
| Average Sequence Length | 45 residues |
| Representative Sequence | KEFTRSPGPFARKFCPFCACDHLWHKEDSKFLAPKVVLRPHIQQAS |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.61 % |
| % of genes from short scaffolds (< 2000 bps) | 93.22 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.305 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.186 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.271 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.373 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.05% β-sheet: 16.22% Coil/Unstructured: 79.73% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF01380 | SIS | 15.25 |
| PF06707 | DUF1194 | 5.08 |
| PF03401 | TctC | 2.54 |
| PF13406 | SLT_2 | 2.54 |
| PF01977 | UbiD | 1.69 |
| PF01471 | PG_binding_1 | 1.69 |
| PF13358 | DDE_3 | 1.69 |
| PF13467 | RHH_4 | 0.85 |
| PF00106 | adh_short | 0.85 |
| PF01557 | FAA_hydrolase | 0.85 |
| PF01614 | IclR | 0.85 |
| PF01869 | BcrAD_BadFG | 0.85 |
| PF01717 | Meth_synt_2 | 0.85 |
| PF02423 | OCD_Mu_crystall | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 2.54 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 1.69 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.85 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.85 |
| COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.31 % |
| Unclassified | root | N/A | 1.69 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_120805655 | Not Available | 718 | Open in IMG/M |
| 3300001545|JGI12630J15595_10023725 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
| 3300004114|Ga0062593_100730063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 972 | Open in IMG/M |
| 3300005332|Ga0066388_102108839 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300005332|Ga0066388_104481661 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300005332|Ga0066388_105800832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 624 | Open in IMG/M |
| 3300005339|Ga0070660_100527574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 984 | Open in IMG/M |
| 3300005435|Ga0070714_100915138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci | 852 | Open in IMG/M |
| 3300005436|Ga0070713_101357080 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 689 | Open in IMG/M |
| 3300005455|Ga0070663_100829166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 795 | Open in IMG/M |
| 3300005564|Ga0070664_100950037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 807 | Open in IMG/M |
| 3300005616|Ga0068852_100045433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3735 | Open in IMG/M |
| 3300005713|Ga0066905_100741852 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300005764|Ga0066903_106653508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 601 | Open in IMG/M |
| 3300005764|Ga0066903_107897352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 546 | Open in IMG/M |
| 3300005843|Ga0068860_102558101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 530 | Open in IMG/M |
| 3300005844|Ga0068862_100737106 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300006038|Ga0075365_10021388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4035 | Open in IMG/M |
| 3300006038|Ga0075365_10305546 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300006038|Ga0075365_10344414 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1050 | Open in IMG/M |
| 3300006038|Ga0075365_10385595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 989 | Open in IMG/M |
| 3300006042|Ga0075368_10346168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 647 | Open in IMG/M |
| 3300006046|Ga0066652_100206515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1693 | Open in IMG/M |
| 3300006058|Ga0075432_10353671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 623 | Open in IMG/M |
| 3300006606|Ga0074062_12855245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 670 | Open in IMG/M |
| 3300006606|Ga0074062_12909445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 986 | Open in IMG/M |
| 3300006847|Ga0075431_101561754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 618 | Open in IMG/M |
| 3300009101|Ga0105247_10211458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1308 | Open in IMG/M |
| 3300009174|Ga0105241_10265282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1461 | Open in IMG/M |
| 3300009174|Ga0105241_12561632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 512 | Open in IMG/M |
| 3300009177|Ga0105248_11102050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 897 | Open in IMG/M |
| 3300010047|Ga0126382_11992611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 552 | Open in IMG/M |
| 3300010048|Ga0126373_10927484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 935 | Open in IMG/M |
| 3300010147|Ga0126319_1018306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 684 | Open in IMG/M |
| 3300010147|Ga0126319_1263731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 928 | Open in IMG/M |
| 3300010358|Ga0126370_11532533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 635 | Open in IMG/M |
| 3300010359|Ga0126376_10071391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2542 | Open in IMG/M |
| 3300010362|Ga0126377_11553204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci | 736 | Open in IMG/M |
| 3300010366|Ga0126379_10339797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1527 | Open in IMG/M |
| 3300010376|Ga0126381_102159291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci | 801 | Open in IMG/M |
| 3300010376|Ga0126381_102318421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci | 771 | Open in IMG/M |
| 3300010398|Ga0126383_11750596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci | 710 | Open in IMG/M |
| 3300010398|Ga0126383_12393522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 613 | Open in IMG/M |
| 3300010399|Ga0134127_12996046 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300011119|Ga0105246_12575689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 502 | Open in IMG/M |
| 3300012361|Ga0137360_11400919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 602 | Open in IMG/M |
| 3300012469|Ga0150984_117617148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 540 | Open in IMG/M |
| 3300012469|Ga0150984_119850563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 671 | Open in IMG/M |
| 3300012896|Ga0157303_10050993 | Not Available | 849 | Open in IMG/M |
| 3300012948|Ga0126375_10889200 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300012971|Ga0126369_12451447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 607 | Open in IMG/M |
| 3300014326|Ga0157380_11447972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 739 | Open in IMG/M |
| 3300014968|Ga0157379_11057567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 776 | Open in IMG/M |
| 3300016294|Ga0182041_10310854 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
| 3300016357|Ga0182032_11661665 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300016371|Ga0182034_10516771 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300016404|Ga0182037_11231834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 658 | Open in IMG/M |
| 3300016445|Ga0182038_11478983 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300018027|Ga0184605_10420629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 593 | Open in IMG/M |
| 3300018469|Ga0190270_11490291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 725 | Open in IMG/M |
| 3300018469|Ga0190270_13188020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 519 | Open in IMG/M |
| 3300021073|Ga0210378_10410481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 502 | Open in IMG/M |
| 3300021560|Ga0126371_13461863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 533 | Open in IMG/M |
| 3300021560|Ga0126371_13659403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 518 | Open in IMG/M |
| 3300024055|Ga0247794_10302152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 539 | Open in IMG/M |
| 3300025928|Ga0207700_11955296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 513 | Open in IMG/M |
| 3300025932|Ga0207690_10338488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1187 | Open in IMG/M |
| 3300025932|Ga0207690_11315010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 604 | Open in IMG/M |
| 3300025939|Ga0207665_10672455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 813 | Open in IMG/M |
| 3300025945|Ga0207679_10166629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1810 | Open in IMG/M |
| 3300025986|Ga0207658_10788343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 862 | Open in IMG/M |
| 3300026067|Ga0207678_10043992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3865 | Open in IMG/M |
| 3300027383|Ga0209213_1003206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2775 | Open in IMG/M |
| 3300027583|Ga0209527_1096103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 665 | Open in IMG/M |
| 3300027909|Ga0209382_11582262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 649 | Open in IMG/M |
| 3300028381|Ga0268264_11503014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 684 | Open in IMG/M |
| 3300028715|Ga0307313_10276551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 522 | Open in IMG/M |
| 3300028754|Ga0307297_10208165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 685 | Open in IMG/M |
| 3300028755|Ga0307316_10274353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 615 | Open in IMG/M |
| 3300028768|Ga0307280_10113891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 909 | Open in IMG/M |
| 3300028782|Ga0307306_10055116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 997 | Open in IMG/M |
| 3300028784|Ga0307282_10660465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 507 | Open in IMG/M |
| 3300028787|Ga0307323_10022385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2167 | Open in IMG/M |
| 3300028791|Ga0307290_10086135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1143 | Open in IMG/M |
| 3300028803|Ga0307281_10134429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 857 | Open in IMG/M |
| 3300028872|Ga0307314_10287630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 520 | Open in IMG/M |
| 3300030574|Ga0247648_1208571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 510 | Open in IMG/M |
| 3300031058|Ga0308189_10059520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1092 | Open in IMG/M |
| 3300031092|Ga0308204_10255977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 569 | Open in IMG/M |
| 3300031549|Ga0318571_10191503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci | 727 | Open in IMG/M |
| 3300031573|Ga0310915_10366964 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300031573|Ga0310915_10582210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci | 793 | Open in IMG/M |
| 3300031573|Ga0310915_10774431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci | 675 | Open in IMG/M |
| 3300031668|Ga0318542_10107327 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300031680|Ga0318574_10238031 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300031682|Ga0318560_10332814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci | 819 | Open in IMG/M |
| 3300031719|Ga0306917_10621586 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300031747|Ga0318502_10094942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1646 | Open in IMG/M |
| 3300031747|Ga0318502_10366662 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300031764|Ga0318535_10279136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci | 747 | Open in IMG/M |
| 3300031765|Ga0318554_10329360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci | 868 | Open in IMG/M |
| 3300031768|Ga0318509_10147904 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300031770|Ga0318521_10571403 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300031794|Ga0318503_10055366 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300031795|Ga0318557_10405817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 626 | Open in IMG/M |
| 3300031831|Ga0318564_10216728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci | 851 | Open in IMG/M |
| 3300031894|Ga0318522_10063256 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
| 3300031894|Ga0318522_10277400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 635 | Open in IMG/M |
| 3300031912|Ga0306921_10453640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1493 | Open in IMG/M |
| 3300031941|Ga0310912_10440425 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300031946|Ga0310910_11204288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 587 | Open in IMG/M |
| 3300032010|Ga0318569_10410532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 631 | Open in IMG/M |
| 3300032044|Ga0318558_10007479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3974 | Open in IMG/M |
| 3300032064|Ga0318510_10079726 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300032091|Ga0318577_10433572 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300033550|Ga0247829_11005987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 693 | Open in IMG/M |
| 3300034150|Ga0364933_128268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 650 | Open in IMG/M |
| 3300034151|Ga0364935_0012711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2174 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 5.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.08% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 4.24% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.54% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.54% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.69% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.69% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.69% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.85% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.85% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.85% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300030574 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
| 3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1208056551 | 3300000956 | Soil | RRSAGPFTRKFCPFCACEHDWYREDSKFLSPKLEPRARVQQAS* |
| JGI12630J15595_100237252 | 3300001545 | Forest Soil | GSPGPFARKYCPFCACEHVWYKEDTKFLAAKSVTRPKVQQAS* |
| Ga0062593_1007300631 | 3300004114 | Soil | PKEFTRSPGPFKRKFCPFCACDHLWHKEDSKFLALKAPPRLGIQQAS* |
| Ga0066388_1021088392 | 3300005332 | Tropical Forest Soil | KDFVRSPGPFTRKFCPFCSCDHLWHREDSKFVAPKPAPRRGIQQAS* |
| Ga0066388_1044816612 | 3300005332 | Tropical Forest Soil | MGMDVDPKEFTRSPGPFARKFCPFCACDHLWHKEDSKFLAPKVVLRPHIQQAS* |
| Ga0066388_1058008322 | 3300005332 | Tropical Forest Soil | FMGMDADPKDFVRSPGPFTRKFCPFCACDHLWHREDSKFVAPKPAPRRGIQQAS* |
| Ga0070660_1005275742 | 3300005339 | Corn Rhizosphere | EFARSPGPFKRKFCPFCACDHLWHKEDSKFLAPKAPPRIGIQQAS* |
| Ga0070714_1009151381 | 3300005435 | Agricultural Soil | KEFTRSPGPFTRKFCPFCACDHLWHKEDSKFLAPRPMLRSHIQQAS* |
| Ga0070713_1013570802 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | KEFAQTQGPFMRKFCPFCACEHWWHKEDSKFLASSAADGLRIQQAS* |
| Ga0070663_1008291662 | 3300005455 | Corn Rhizosphere | DVDPKEFTRSPGPFKRKFCPFCACDHLWHKEDSKFLALKAPPRLGIQQAS* |
| Ga0070664_1009500372 | 3300005564 | Corn Rhizosphere | KRKFCPFCACDHLWHKEDSKFLAPKVAPGPRIQQAS* |
| Ga0068852_1000454331 | 3300005616 | Corn Rhizosphere | FKRKFCPFCACDHLWHKEDSKFLAPKAPPRIGIQQAS* |
| Ga0066905_1007418521 | 3300005713 | Tropical Forest Soil | PKDFTRSRGPFTRKFCPFCACDHLWLREDSKFLAPKPVPRRGIQQAS* |
| Ga0066903_1066535081 | 3300005764 | Tropical Forest Soil | RKFCPFCACDHLWHKEDSKFLAPKVVLRPNIQQAS* |
| Ga0066903_1078973522 | 3300005764 | Tropical Forest Soil | VDPKEFTRSPGPFARKFCPFCACDHLWHKEDSKFLAPKVVLRPNIQQAS* |
| Ga0068860_1025581011 | 3300005843 | Switchgrass Rhizosphere | RKFCPFCACDHLWHKEDSKFLAPKVAPGPRIQQAS* |
| Ga0068862_1007371063 | 3300005844 | Switchgrass Rhizosphere | KFCPFCACDHLWHKEDSKFLAPKAPPRIGIQQAS* |
| Ga0075365_100213881 | 3300006038 | Populus Endosphere | LDVDPKEFTRSPGPFKRKFCPFCACDHLWHKEDSKFLAPKAPPRIGIQQAS* |
| Ga0075365_103055461 | 3300006038 | Populus Endosphere | FTRSTGPFKRKFCPFCACDHLWHKEDSKFLAPKAPPRLGIQQAS* |
| Ga0075365_103444143 | 3300006038 | Populus Endosphere | LDVDPKEFTRSPGPFKRKFCPFCACDHLWHKEDSKFLAPKAPPRVGIQQAS* |
| Ga0075365_103855951 | 3300006038 | Populus Endosphere | PGPFTRKFCPFCACDHLWHREDSKFLAPKPAPRRGIQQAS* |
| Ga0075368_103461682 | 3300006042 | Populus Endosphere | PGPFKRKFCPFCACDHLWHKEDSKFLAPKAPPRVGIQQAS* |
| Ga0066652_1002065151 | 3300006046 | Soil | DVDPKEFTRSPGPFTRKFCPFCACDHLWHKEDSKFLAPRPMLRSHIQQAS* |
| Ga0075432_103536712 | 3300006058 | Populus Rhizosphere | EFTRSPGPFARKFCPFCACDHLWHKEDSKFLAPKVAPGPRIQQAS* |
| Ga0074062_128552452 | 3300006606 | Soil | KFCPFCACDHLWHKEDSKFLAPKPPSRLGIQQAS* |
| Ga0074062_129094451 | 3300006606 | Soil | DPKEFTRSPGPFARKFCPFCACDHLWHKEDSKFLAPKTAPRPRILQAS* |
| Ga0075431_1015617541 | 3300006847 | Populus Rhizosphere | KFCPFCACDHLWHKEDTKFLKPKAMPRPHIQRAS* |
| Ga0105247_102114581 | 3300009101 | Switchgrass Rhizosphere | TRKFCPFCACEHDWYREDSKFLSPKLEPRARVQQAS* |
| Ga0105241_102652821 | 3300009174 | Corn Rhizosphere | KRKFCPFCACDHLWHKEDSKFLAPKPPSRLGIQQAS* |
| Ga0105241_125616321 | 3300009174 | Corn Rhizosphere | KRKFCPFCACDHLWHREDSKFLAPKVPPRLGIQQAS* |
| Ga0105248_111020502 | 3300009177 | Switchgrass Rhizosphere | PGPFKRKFCPFCACDHLWHKEDSKFLAPKSPPRLGIQQAS* |
| Ga0126382_119926112 | 3300010047 | Tropical Forest Soil | DPKEFTRSPGPFTRKFCPFCACDHLWHKEDSKFLAPKAALRSHIQQAS* |
| Ga0126373_109274842 | 3300010048 | Tropical Forest Soil | SPGPFARKFCPFCACDHLWHKEDSKFLAPKVVLRPNIQQAS* |
| Ga0126319_10183061 | 3300010147 | Soil | RTPGPFTRKFCPFCACEHLWHKEDSKFLAPKLAVKLGVQQAS* |
| Ga0126319_12637313 | 3300010147 | Soil | ADPKEFTRSPGPFARKFCPFCACDHLWHKEDSKFLAPKGAPRLRIQQAS* |
| Ga0126370_115325331 | 3300010358 | Tropical Forest Soil | KEFTRSPGPFARKFCPFCACDHLWHKEDSKFLAPKVVLRPHIQQAS* |
| Ga0126376_100713913 | 3300010359 | Tropical Forest Soil | MGMDVDPKEFTRSPGPFTRKFCPFCACDHLWHKEDSKFLAPKAALRSHIQQAS* |
| Ga0126377_115532041 | 3300010362 | Tropical Forest Soil | MGMDVDPKEFTRSPGPFTRKFCPFCACDHLWHKEDSKFLAPKAAPSHIQQAS* |
| Ga0126379_103397973 | 3300010366 | Tropical Forest Soil | TRKFCPFCACDHLWHKEDSKFLAPKAALRSHIQQAS* |
| Ga0126381_1021592912 | 3300010376 | Tropical Forest Soil | KFCPFCACDHLWHKEDSKFLAPKVVLRPNIQQAS* |
| Ga0126381_1023184211 | 3300010376 | Tropical Forest Soil | MGMDVDPKEFTRSPGPFTRKFSPFCACDHLWHREDSKFLAPKAVLRPHIQQAG* |
| Ga0126383_117505962 | 3300010398 | Tropical Forest Soil | RKFCPFCACDHLWHKEDSKFLAPKAVLRPHIQQAS* |
| Ga0126383_123935222 | 3300010398 | Tropical Forest Soil | PFARKFCPFCACDHLWHKEDSKFLAPKAALRPHIQQAS* |
| Ga0134127_129960462 | 3300010399 | Terrestrial Soil | RSAGPFTRKFCPFCACEHDWYREDSKFLSPKLEPRARVQQAS* |
| Ga0105246_125756891 | 3300011119 | Miscanthus Rhizosphere | DPKEFARSPGPFKRKFCPFCACDHLWHKEDSKFLAPKSPPRLGIQQAS* |
| Ga0137360_114009191 | 3300012361 | Vadose Zone Soil | RSTGAFARKFCPFCACDHLWHKEDSKFLAPKTAAGQRIQRAS* |
| Ga0150984_1176171482 | 3300012469 | Avena Fatua Rhizosphere | KFCPFCACDHLWHKEDSKFLAPKAPPRLGIQQAS* |
| Ga0150984_1198505631 | 3300012469 | Avena Fatua Rhizosphere | PGPFKRKFCPFCACDHLWHKEDSKFLAPKAPPRLGIQQAS* |
| Ga0157303_100509931 | 3300012896 | Soil | PFTRKFCPFCACEHDWYREDSKFLSPKLEPRARVQQAS* |
| Ga0126375_108892002 | 3300012948 | Tropical Forest Soil | DPKEFTRSPGPFARKFCPFCACDHLWHKEDSKFLAPKAVLRPHIQQAS* |
| Ga0126369_124514472 | 3300012971 | Tropical Forest Soil | DVDPKEFTRSPGPFARKFCPFCACDHLWHKEDSKFLAPKVVLRPNIQQAS* |
| Ga0157380_114479721 | 3300014326 | Switchgrass Rhizosphere | FKRKFCPFCACDHLWHKDDSNFLAPKAPPRIGIQQAS* |
| Ga0157379_110575671 | 3300014968 | Switchgrass Rhizosphere | KFCPFCACDHLWHKEDSKFLAPKSPPRLGIQQAS* |
| Ga0182041_103108542 | 3300016294 | Soil | MGTDVDPKEFTRSPGPFARKFCPFCACDHLWHKEDSKFLAPKAVLRPHIQQAN |
| Ga0182032_116616652 | 3300016357 | Soil | MFMGMDVDPKEFTRSLGPFARKFCPFCACDHLWHKEDSKFLAS |
| Ga0182034_105167711 | 3300016371 | Soil | PKEFTRSPGPFARKFCPFCACDHLWHKEDSKFLANEVVLRPHIQQAS |
| Ga0182037_112318341 | 3300016404 | Soil | DPKRFTGSKGAFARTFCPFCACDHDWYKEDSKFLASKSPSHSDIQQAS |
| Ga0182038_114789831 | 3300016445 | Soil | KEFTRSLGPFARKFCPFCACDHLWHKEDSKFLAPKAVLRPHIQQAS |
| Ga0184605_104206291 | 3300018027 | Groundwater Sediment | GPFTRKFCPFCACEHLWHKEDSKFLAPKLAVKLGVQQAS |
| Ga0190270_114902911 | 3300018469 | Soil | PFKRKFCPFCACDHLWHKEDSKFLAPKAPPRLGIQQAS |
| Ga0190270_131880201 | 3300018469 | Soil | SPGPFKRKFCPFCACDHLWHKEDSKFLAPKAPPRIGIQQAS |
| Ga0210378_104104811 | 3300021073 | Groundwater Sediment | DVDPRDFERSRGPFARKFCPFCSCEHFWHKEDSKFLASKPVARQGFQQAS |
| Ga0126371_134618631 | 3300021560 | Tropical Forest Soil | DVDPKEFTRSPGPFARKFCPFCACDHLWHKEDSKFLAPKVVLRPNIQQAS |
| Ga0126371_136594031 | 3300021560 | Tropical Forest Soil | PFARKFCPFCACDHLWHKEDSKFLAPKVVLRPNIQQAS |
| Ga0247794_103021521 | 3300024055 | Soil | DADPKEFRRSAGPFTRKFCPFCACEHDWYREDSKFLSPKLEPRARVQQAS |
| Ga0207700_119552961 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | PKEFAQTQGPFMRKFCPFCACEHWWHKEDSKFLASSAADGLRIQQAS |
| Ga0207690_103384881 | 3300025932 | Corn Rhizosphere | KEFARSPGPFKRKFCPFCACDHLWHKEDSKFLAPKAPPRIGIQQAS |
| Ga0207690_113150101 | 3300025932 | Corn Rhizosphere | GLDVDPKEFARSPGPFKRKFCPFCACDHLWHKEDSKFLAPKAPPRIGIQQAS |
| Ga0207665_106724551 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MGMDVDPKEFTRSLGPFARKFCPFCACDHLWHKEDSKFLAPKAALRPHIQQAS |
| Ga0207679_101666291 | 3300025945 | Corn Rhizosphere | ADPKEFTRSPGPFARKFCPFCACDHLWHKEDSKFLAPKVAPGPRIQQAS |
| Ga0207658_107883431 | 3300025986 | Switchgrass Rhizosphere | VDPKEFTRSPGPFKRKFCPFCACDHLWHKEDSKFLALKAPPRLGIQQAS |
| Ga0207678_100439921 | 3300026067 | Corn Rhizosphere | GPFKRKFCPFCACDHLWHKEDSKFLAPKAPPRIGIQQAS |
| Ga0209213_10032061 | 3300027383 | Forest Soil | DPKEFTRSGGPFARKFCPFCACDHLWHKEDSKFLASKVAPRLHIQQAG |
| Ga0209527_10961032 | 3300027583 | Forest Soil | MFMGMDVDPKEFTGSPGPFARKYCPFCACEHVWYKEDTKFLAAKSVT |
| Ga0209382_115822621 | 3300027909 | Populus Rhizosphere | PFARKFCPFCACDHLWHKEDSKFLAPKAVLRPHIQQAS |
| Ga0268264_115030141 | 3300028381 | Switchgrass Rhizosphere | EFTRSPGPFARKFCPFCACDHLWHKEDSKFLAPKVAPGPRIQQAS |
| Ga0307313_102765511 | 3300028715 | Soil | GPFARKFCPFCACDHLWHKEDSKFLAPKGAPRLRIQQAS |
| Ga0307297_102081651 | 3300028754 | Soil | KEFTRSPGPFARKFCPFCACDHLWHKEDSKFLAPKGAPRPRILQAS |
| Ga0307316_102743531 | 3300028755 | Soil | PFKRKFCPFCACDHLWHKEDSKFLAPKAPPRIGIQQAS |
| Ga0307280_101138911 | 3300028768 | Soil | EFTRSPGPFARKFCPFCACDHLWHKEDSKFLAPKGAPRLRIQQAS |
| Ga0307306_100551161 | 3300028782 | Soil | GMDVDPKEFTRSPGPFKRKFCPFCACDHLWHKEDSKFLAPKAPPRIGIQQAS |
| Ga0307282_106604651 | 3300028784 | Soil | SPGPFKRKFCPFCACDHLWHKEDSKFLAPKPPPRVGIQQAS |
| Ga0307323_100223851 | 3300028787 | Soil | PFARKFCPFCACDHLWHKEDSKFLAPKTAPRPRILQAS |
| Ga0307290_100861351 | 3300028791 | Soil | GMDADPKEFTRSPGPFARKFCPFCACDHLWHKEDSKFLAPKGAPRPRILQAS |
| Ga0307281_101344291 | 3300028803 | Soil | RSPGPFKRKFCPFCACDHLWHKEDSKFLAPKAPPRIGIQQAS |
| Ga0307314_102876302 | 3300028872 | Soil | FTASPGPFKRKFCPFCACDHLWHKEDSKFLAPKAPPRIGIQQAS |
| Ga0247648_12085711 | 3300030574 | Soil | ADPRDFERSRGPFARKFCPFCSCEHFWHKEDSKFLAPKPVARHGFQQAS |
| Ga0308189_100595201 | 3300031058 | Soil | RSPGPFARKFCPFCACDHLWHKEDSKFLAPKVAPRLRIQQAS |
| Ga0308204_102559772 | 3300031092 | Soil | EFARSPGPFKRKFCPFCACDHLWHKEDSKFLAPKAPPRIGIQQAS |
| Ga0318571_101915031 | 3300031549 | Soil | MFMGMDVDPKEFTRSPGPFARKFCPFCACDHLWHKEDSKFLANEVVLRPHIQQAS |
| Ga0310915_103669642 | 3300031573 | Soil | MFMGMDVDPKEFTRSLGPFARKFCPFCACDHLWHKEDSKFLASKAVLRPHIQQAS |
| Ga0310915_105822102 | 3300031573 | Soil | MFMGMDVDPKEFTRSPGPFARKFCPFCACDHLWHKEDSKFLAPKVVLRPHIQQAS |
| Ga0310915_107744311 | 3300031573 | Soil | RKFCPFCGCDHLWHKEDSKFLAPKVVLRPNIQQAS |
| Ga0318542_101073271 | 3300031668 | Soil | PGPFARKFCPFCACDHLWHKEDSKFLAPKVVLRPNIQQAS |
| Ga0318574_102380311 | 3300031680 | Soil | FMGMDVDPKEFTRSPGPFARKFCPFCACDHLWHKEDSKFLASKVVLRPHIQQAS |
| Ga0318560_103328141 | 3300031682 | Soil | GMDVDPKAFTRSPGPFARKFCPFCACDHLWHKEDSKFLASKVVLRPHIQQAS |
| Ga0306917_106215861 | 3300031719 | Soil | MFMGMDVDPKEFTRSLGPFARKFCPFCACDHLWHKEDSKFLASKAVLRPHIQ |
| Ga0318502_100949423 | 3300031747 | Soil | FMGMDVDPKEFTRSLGPFARKFCPFCACDHLWHKEDSKFLASKAALRPHIQQAS |
| Ga0318502_103666622 | 3300031747 | Soil | MFMGMDVDPKEFTRSLGPFARKFCPFCACDHLWHKEDSKFLASKAVL |
| Ga0318535_102791361 | 3300031764 | Soil | IFMGMDVYPKEFTRSPGPFARKFCPFCACDHLWHKEDSKFLAPKVVLRPHIQQAS |
| Ga0318554_103293601 | 3300031765 | Soil | VDPKEFTRSPGPFARKFCPFCACDHLWHKEDSKFLANEVVLRPHIQQAS |
| Ga0318509_101479042 | 3300031768 | Soil | NEFTRSPGPFTRKFCPFCACDHLWHKEDSKFLAPKAALRSHIQQAS |
| Ga0318521_105714031 | 3300031770 | Soil | PKEFTRSPGPFARKFCPFCACDHLWHKEDSKFLAPKVVLRPHIQQAS |
| Ga0318503_100553661 | 3300031794 | Soil | EFTRSLGPFARKFCPFCACDHLWHKEDSKFLASKAALRPHIQQAS |
| Ga0318557_104058171 | 3300031795 | Soil | MFMGMDVDPKEFTRSLGPFARKFCPFCACDHLWHKEDSKFLAPKVVLRPHIQQAS |
| Ga0318564_102167281 | 3300031831 | Soil | MFMGMDVDPKEFTRSPGPFARKFCPFCACDHLWHKEDSKFLASKAALRPHIQQAS |
| Ga0318522_100632561 | 3300031894 | Soil | MFMGMDVDPKEFTRSLGPFARKFCPFCACDHLWHKEDSKFLASKAALRPHIQQAS |
| Ga0318522_102774002 | 3300031894 | Soil | VYPKEFTRSPGPFARKFCPFCACDHLWHKEDSKFLAPKVVLRPHIQQAS |
| Ga0306921_104536401 | 3300031912 | Soil | DVDPKEFTHSPGPFTRKFCPFCACDHLWHKEDSKFLAPKAAPRSHIQQAS |
| Ga0310912_104404251 | 3300031941 | Soil | GMDVDPKEFTRSPGPFARKFCPFCACDHLWHKEDSKFLAPKVVLRPHIQQAS |
| Ga0310910_112042882 | 3300031946 | Soil | RSLGPFARKFCPFCACDHLWHKEDSKFLAPKAALRPHIQQAS |
| Ga0318569_104105322 | 3300032010 | Soil | FTRSLGPFARKFCPFCACDHLWHKEDSKFLASKAALRPHIQQAS |
| Ga0318558_100074795 | 3300032044 | Soil | FMGMDVDPKEFTRSPGPFARKFCPFCGCDHLWHKEDSKFLAPKVVLRPNIQQAS |
| Ga0318510_100797262 | 3300032064 | Soil | PFTRKFCPFCACDHLWHKEDSKFLAPKAALRSHIQQAS |
| Ga0318577_104335721 | 3300032091 | Soil | MFMGMDVDPKEFTRSLGPFARKFCPFCACDHLWHKEDSKFLASKAVLR |
| Ga0247829_110059871 | 3300033550 | Soil | RKFCPFCACDHLWHKEDSKFLAPKAPPRIGIQQAS |
| Ga0364933_128268_470_637 | 3300034150 | Sediment | MFMGMDVDPKEFTASPGPFKRKFCPFCACDHLWHKEDSKFLAPKAPPRIGIQQAS |
| Ga0364935_0012711_2043_2174 | 3300034151 | Sediment | TRTFGPFARKFCPFCACEHFWHKEDSKFLTPKTGAHSHVQQAS |
| ⦗Top⦘ |