


| Basic Information | |
|---|---|
| Family ID | F076024 |
| Family Type | Metagenome |
| Number of Sequences | 118 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MPPAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQSKKQSDDAG |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 57.63 % |
| % of genes near scaffold ends (potentially truncated) | 31.36 % |
| % of genes from short scaffolds (< 2000 bps) | 91.53 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.102 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (12.712 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.898 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.220 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.95% β-sheet: 0.00% Coil/Unstructured: 54.05% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF13302 | Acetyltransf_3 | 8.47 |
| PF01738 | DLH | 5.93 |
| PF01619 | Pro_dh | 4.24 |
| PF12796 | Ank_2 | 3.39 |
| PF00248 | Aldo_ket_red | 2.54 |
| PF07606 | DUF1569 | 2.54 |
| PF02687 | FtsX | 2.54 |
| PF13193 | AMP-binding_C | 2.54 |
| PF00106 | adh_short | 1.69 |
| PF13365 | Trypsin_2 | 1.69 |
| PF01436 | NHL | 0.85 |
| PF01979 | Amidohydro_1 | 0.85 |
| PF12680 | SnoaL_2 | 0.85 |
| PF03060 | NMO | 0.85 |
| PF00486 | Trans_reg_C | 0.85 |
| PF13565 | HTH_32 | 0.85 |
| PF03544 | TonB_C | 0.85 |
| PF13466 | STAS_2 | 0.85 |
| PF05163 | DinB | 0.85 |
| PF01740 | STAS | 0.85 |
| PF07700 | HNOB | 0.85 |
| PF05591 | T6SS_VipA | 0.85 |
| PF14681 | UPRTase | 0.85 |
| PF13692 | Glyco_trans_1_4 | 0.85 |
| PF01011 | PQQ | 0.85 |
| PF00916 | Sulfate_transp | 0.85 |
| PF00990 | GGDEF | 0.85 |
| PF12836 | HHH_3 | 0.85 |
| PF07638 | Sigma70_ECF | 0.85 |
| PF12850 | Metallophos_2 | 0.85 |
| PF08734 | GYD | 0.85 |
| PF10502 | Peptidase_S26 | 0.85 |
| PF12867 | DinB_2 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG0506 | Proline dehydrogenase | Amino acid transport and metabolism [E] | 4.24 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.85 |
| COG0659 | Sulfate permease or related transporter, MFS superfamily | Inorganic ion transport and metabolism [P] | 0.85 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.85 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.85 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.85 |
| COG2233 | Xanthine/uracil permease | Nucleotide transport and metabolism [F] | 0.85 |
| COG2252 | Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family | Nucleotide transport and metabolism [F] | 0.85 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.85 |
| COG3516 | Predicted component TssA of the type VI protein secretion system | Intracellular trafficking, secretion, and vesicular transport [U] | 0.85 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.10 % |
| Unclassified | root | N/A | 33.90 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908032|Perma_A_C_ConsensusfromContig102858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1353 | Open in IMG/M |
| 2162886012|MBSR1b_contig_8370382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 845 | Open in IMG/M |
| 3300000881|JGI10215J12807_1106018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 895 | Open in IMG/M |
| 3300000956|JGI10216J12902_101999534 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300000956|JGI10216J12902_109143830 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300000956|JGI10216J12902_117210001 | Not Available | 552 | Open in IMG/M |
| 3300004114|Ga0062593_100255900 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
| 3300004156|Ga0062589_100635118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 934 | Open in IMG/M |
| 3300004156|Ga0062589_100925048 | Not Available | 806 | Open in IMG/M |
| 3300004157|Ga0062590_101396734 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300004463|Ga0063356_100614043 | Not Available | 1473 | Open in IMG/M |
| 3300004463|Ga0063356_102128040 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300004463|Ga0063356_105278259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21 | 555 | Open in IMG/M |
| 3300004480|Ga0062592_101081452 | Not Available | 740 | Open in IMG/M |
| 3300005328|Ga0070676_11471511 | Not Available | 524 | Open in IMG/M |
| 3300005336|Ga0070680_101435040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300005364|Ga0070673_100171983 | All Organisms → cellular organisms → Bacteria | 1850 | Open in IMG/M |
| 3300005440|Ga0070705_101923488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae | 504 | Open in IMG/M |
| 3300005444|Ga0070694_101736293 | Not Available | 531 | Open in IMG/M |
| 3300005526|Ga0073909_10574162 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300005545|Ga0070695_101073988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae | 658 | Open in IMG/M |
| 3300005578|Ga0068854_101228517 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300005615|Ga0070702_100858201 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 707 | Open in IMG/M |
| 3300005836|Ga0074470_10711031 | All Organisms → cellular organisms → Bacteria | 3774 | Open in IMG/M |
| 3300005842|Ga0068858_100818891 | Not Available | 909 | Open in IMG/M |
| 3300005844|Ga0068862_101168519 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300006638|Ga0075522_10078031 | All Organisms → cellular organisms → Bacteria | 1837 | Open in IMG/M |
| 3300006852|Ga0075433_10726817 | Not Available | 869 | Open in IMG/M |
| 3300006881|Ga0068865_101953949 | Not Available | 532 | Open in IMG/M |
| 3300007004|Ga0079218_10261898 | Not Available | 1374 | Open in IMG/M |
| 3300007004|Ga0079218_13412412 | Not Available | 539 | Open in IMG/M |
| 3300009094|Ga0111539_13475017 | Not Available | 506 | Open in IMG/M |
| 3300009156|Ga0111538_10430898 | Not Available | 1671 | Open in IMG/M |
| 3300009177|Ga0105248_10082748 | All Organisms → cellular organisms → Bacteria | 3610 | Open in IMG/M |
| 3300009553|Ga0105249_10755590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquabacterium → Aquabacterium commune | 1035 | Open in IMG/M |
| 3300009777|Ga0105164_10059305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2037 | Open in IMG/M |
| 3300009811|Ga0105084_1063413 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300009813|Ga0105057_1118388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300010159|Ga0099796_10161011 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300010379|Ga0136449_102216559 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300010403|Ga0134123_11647489 | Not Available | 691 | Open in IMG/M |
| 3300011269|Ga0137392_11158806 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300011270|Ga0137391_10663676 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300011419|Ga0137446_1177853 | Not Available | 514 | Open in IMG/M |
| 3300011423|Ga0137436_1087628 | Not Available | 815 | Open in IMG/M |
| 3300011437|Ga0137429_1207743 | Not Available | 611 | Open in IMG/M |
| 3300011445|Ga0137427_10124353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1051 | Open in IMG/M |
| 3300012038|Ga0137431_1078909 | Not Available | 914 | Open in IMG/M |
| 3300012200|Ga0137382_11123639 | Not Available | 561 | Open in IMG/M |
| 3300012211|Ga0137377_10277940 | All Organisms → cellular organisms → Bacteria | 1607 | Open in IMG/M |
| 3300012231|Ga0137465_1200949 | Not Available | 598 | Open in IMG/M |
| 3300012361|Ga0137360_11873520 | Not Available | 505 | Open in IMG/M |
| 3300012363|Ga0137390_11971126 | Not Available | 510 | Open in IMG/M |
| 3300012683|Ga0137398_10076772 | All Organisms → cellular organisms → Bacteria | 2051 | Open in IMG/M |
| 3300012685|Ga0137397_10487961 | Not Available | 918 | Open in IMG/M |
| 3300012917|Ga0137395_10501290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae | 874 | Open in IMG/M |
| 3300012925|Ga0137419_10548484 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300012943|Ga0164241_10415532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 965 | Open in IMG/M |
| 3300014326|Ga0157380_10428159 | Not Available | 1264 | Open in IMG/M |
| 3300014326|Ga0157380_10622582 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300014326|Ga0157380_12518345 | Not Available | 580 | Open in IMG/M |
| 3300014968|Ga0157379_10212502 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1751 | Open in IMG/M |
| 3300015200|Ga0173480_10480802 | Not Available | 739 | Open in IMG/M |
| 3300015372|Ga0132256_102716240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300015373|Ga0132257_101393956 | Not Available | 892 | Open in IMG/M |
| 3300017997|Ga0184610_1176113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae | 709 | Open in IMG/M |
| 3300018027|Ga0184605_10425564 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300018061|Ga0184619_10531476 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300018071|Ga0184618_10418122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae | 566 | Open in IMG/M |
| 3300018073|Ga0184624_10178080 | Not Available | 943 | Open in IMG/M |
| 3300018075|Ga0184632_10441152 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 541 | Open in IMG/M |
| 3300018422|Ga0190265_10470769 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1365 | Open in IMG/M |
| 3300018422|Ga0190265_12804147 | Not Available | 582 | Open in IMG/M |
| 3300018429|Ga0190272_10575042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 980 | Open in IMG/M |
| 3300018469|Ga0190270_11088105 | Not Available | 832 | Open in IMG/M |
| 3300018476|Ga0190274_10427077 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
| 3300018476|Ga0190274_11533698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
| 3300018481|Ga0190271_12317582 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300019361|Ga0173482_10281961 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300020059|Ga0193745_1062761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
| 3300021078|Ga0210381_10181184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300021080|Ga0210382_10010385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3148 | Open in IMG/M |
| 3300021080|Ga0210382_10014796 | All Organisms → cellular organisms → Bacteria | 2726 | Open in IMG/M |
| 3300021080|Ga0210382_10043179 | All Organisms → cellular organisms → Bacteria | 1748 | Open in IMG/M |
| 3300021080|Ga0210382_10125329 | Not Available | 1087 | Open in IMG/M |
| 3300021432|Ga0210384_11309672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300021478|Ga0210402_11495051 | Not Available | 603 | Open in IMG/M |
| 3300022756|Ga0222622_11054440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300022756|Ga0222622_11247074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae | 547 | Open in IMG/M |
| 3300025173|Ga0209824_10050662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1598 | Open in IMG/M |
| 3300025311|Ga0209343_10004692 | All Organisms → cellular organisms → Bacteria | 16833 | Open in IMG/M |
| 3300025553|Ga0208080_1040405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1293 | Open in IMG/M |
| 3300025885|Ga0207653_10167321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
| 3300025938|Ga0207704_11468226 | Not Available | 585 | Open in IMG/M |
| 3300025941|Ga0207711_10219973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1736 | Open in IMG/M |
| 3300025941|Ga0207711_11144502 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 719 | Open in IMG/M |
| 3300026089|Ga0207648_11050348 | Not Available | 763 | Open in IMG/M |
| 3300027903|Ga0209488_10677463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae | 741 | Open in IMG/M |
| 3300027903|Ga0209488_11218884 | Not Available | 506 | Open in IMG/M |
| 3300028784|Ga0307282_10472038 | Not Available | 609 | Open in IMG/M |
| 3300028812|Ga0247825_10055548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2633 | Open in IMG/M |
| 3300028828|Ga0307312_10332568 | Not Available | 992 | Open in IMG/M |
| 3300030006|Ga0299907_10144604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1965 | Open in IMG/M |
| 3300031538|Ga0310888_10201957 | Not Available | 1093 | Open in IMG/M |
| 3300031740|Ga0307468_100193664 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300031908|Ga0310900_10289782 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300031908|Ga0310900_10585820 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300031940|Ga0310901_10532776 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300031949|Ga0214473_10078954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3849 | Open in IMG/M |
| 3300032000|Ga0310903_10812758 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300032075|Ga0310890_10622714 | Not Available | 837 | Open in IMG/M |
| 3300032122|Ga0310895_10566541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300032163|Ga0315281_10890473 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300033412|Ga0310810_11399178 | Not Available | 535 | Open in IMG/M |
| 3300033811|Ga0364924_157068 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300034128|Ga0370490_0266337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300034178|Ga0364934_0093928 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300034257|Ga0370495_0001257 | All Organisms → cellular organisms → Bacteria | 8091 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.71% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.78% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 5.08% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.08% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 4.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.24% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.39% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.39% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.39% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.54% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.54% |
| Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 1.69% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.69% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.69% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.69% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.69% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.69% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.69% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.85% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.85% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.85% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.85% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.85% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.85% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908032 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_all | Environmental | Open in IMG/M |
| 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009777 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water | Environmental | Open in IMG/M |
| 3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
| 3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011419 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2 | Environmental | Open in IMG/M |
| 3300011423 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2 | Environmental | Open in IMG/M |
| 3300011437 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2 | Environmental | Open in IMG/M |
| 3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
| 3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012231 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2 | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025173 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water (SPAdes) | Environmental | Open in IMG/M |
| 3300025311 | Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025553 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
| 3300034128 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| 3300034257 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Perma_A_C_03717140 | 2124908032 | Soil | ILGGMPPAPKLSKSERAAARLKKKKSGPSAVKRAAARQALHSKKPSDDVG |
| MBSR1b_0922.00003650 | 2162886012 | Miscanthus Rhizosphere | GILGGMPPAPKMSKSERIAARLKKKKSGPSAVKRAAARQALQTKKQSDEAP |
| JGI10215J12807_11060182 | 3300000881 | Soil | MPKAPKMTLTERAAARLKKKKSGPSAMKRAAARQALQKKTDA* |
| JGI10216J12902_1019995342 | 3300000956 | Soil | MPPAPKLSKADRAAARLKKKKSGPSAMKRAAARQALQSKKSPDDPGSGDTPEAPK* |
| JGI10216J12902_1091438301 | 3300000956 | Soil | MAKAPKMTPTERAAARLKKKKTGPSAVKRATARQALQKKTDE* |
| JGI10216J12902_1172100012 | 3300000956 | Soil | MTPTERAAARLKKKSGPSALKRAKAREALQKKTDA* |
| Ga0062593_1002559002 | 3300004114 | Soil | MPPAPKMSKSERIAARLKKKKSGPSAVKRAAARQALQTKKQSDEAP* |
| Ga0062589_1006351182 | 3300004156 | Soil | MPKAPKMTLTERAAARLKKKKSGPSAVKRATARQALQKKTDA* |
| Ga0062589_1009250482 | 3300004156 | Soil | MPPAPKLSKAERAAARLKKKKSGPSAMKRAAARQALQTKKPSDDAG* |
| Ga0062590_1013967342 | 3300004157 | Soil | MSKSERAAARLKKKKSGPSAVKRAAARQALQTKKGTDEGA* |
| Ga0063356_1006140432 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VWRSYTCLMAKAPKMTPTERAAARLKKKKSGPSALKRAKAREALQKKTDA* |
| Ga0063356_1021280402 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MASAPKLSKSERAALRLKKKKSGPSAVKRATARQALQPKKESDESA* |
| Ga0063356_1052782592 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MATAPKLSKSEREAARLKKKKSGPSAVKRATARQALQTKKPAEEGG* |
| Ga0062592_1010814522 | 3300004480 | Soil | MPPAPKLSKAERAAARLKKKKSGPSAMKRAAARHALQTKKPSDEAG* |
| Ga0070676_114715112 | 3300005328 | Miscanthus Rhizosphere | MPPAPKLSKAERAAARLKKKKSGPSAMKRAAARQALQTKKPSDEAG* |
| Ga0070680_1014350401 | 3300005336 | Corn Rhizosphere | HRGILGGMPPAPKMSKSERIAARLKKKKSGPSAVKRAAARQALQTKKQSDEAP* |
| Ga0070673_1001719833 | 3300005364 | Switchgrass Rhizosphere | MSKSERVAARLKKKKSGPSAVKRATARQALQTKKGTDEGS* |
| Ga0070705_1019234882 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | DRAAARLKKKKSGPSAVKRAAARQALQTKKSSEDAEPSAGG* |
| Ga0070694_1017362932 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MPPAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQSKKT |
| Ga0073909_105741622 | 3300005526 | Surface Soil | MPAAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQTKKGTDEGA* |
| Ga0070695_1010739881 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | RAAARLKKKKSGPSAVKRAAARQALQSKKPSDDAEPSASG* |
| Ga0068854_1012285172 | 3300005578 | Corn Rhizosphere | MSKSERAAARLKKKKSGPSAVKRAAARQALQAKKGTDEGS* |
| Ga0070702_1008582011 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKSERVAARLKKKKSGPSAVKRATARQALQTKKSTDEGS* |
| Ga0074470_107110313 | 3300005836 | Sediment (Intertidal) | MSKTERAAARLKKKKSGPSAMKRAAARASLQTKKSDDAAAG* |
| Ga0068858_1008188912 | 3300005842 | Switchgrass Rhizosphere | MPAAPKMSKSERVAARLKKKKSGPSAVKRATARQALQTKK |
| Ga0068862_1011685192 | 3300005844 | Switchgrass Rhizosphere | MSKSERIAARLKKKKSGPSAVKRAAARQALQTKKQSDEAP* |
| Ga0075522_100780313 | 3300006638 | Arctic Peat Soil | MASTAKLTKAERAAARLKKKKSGPSAMKRIAARAALQTKKSDEPAS* |
| Ga0075433_107268172 | 3300006852 | Populus Rhizosphere | MPPAPKLSKSERAAARLKKKKSGPSAMKRAAARQALQSKKQSDDAAGSEG* |
| Ga0068865_1019539491 | 3300006881 | Miscanthus Rhizosphere | MSKADKAAARLKKKKSGPSAVKRATARQALQTKKPAD |
| Ga0079218_102618982 | 3300007004 | Agricultural Soil | KLSKSERAAARLKKKKSGPSAVKRAAARQALQTKKPADTPGEG* |
| Ga0079218_134124121 | 3300007004 | Agricultural Soil | MPPAPKLSKSERAAARLKKKKSGPSAVKRTAARQALQPKKPEDAGG* |
| Ga0111539_134750172 | 3300009094 | Populus Rhizosphere | MPSAPKLSKSDRAAARLKKKKSGPSAVKRAAARQALQ |
| Ga0111538_104308982 | 3300009156 | Populus Rhizosphere | MAKAPKMTVTERAAARLKKKKSGPSAVKRATARQALQKKTDA* |
| Ga0105248_100827481 | 3300009177 | Switchgrass Rhizosphere | PAPKMSKSERAAARLKKKKSGPSAVKRAAARQALQAKKGTDEGS* |
| Ga0105249_107555902 | 3300009553 | Switchgrass Rhizosphere | MASAPKLTKSERIAARLKKKKSGPSAVKRAAARQALQPKKQEDAGG* |
| Ga0105164_100593051 | 3300009777 | Wastewater | MPPATKLSKSERAAARLKKKKSGPSAMKRAAARQALQSKKHSDDVT* |
| Ga0105084_10634132 | 3300009811 | Groundwater Sand | MSPATKLSKSERAAARLKKKKSGPSAMKRAAARQALQSKK |
| Ga0105057_11183881 | 3300009813 | Groundwater Sand | MPPAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQSKKESGDAA* |
| Ga0099796_101610112 | 3300010159 | Vadose Zone Soil | MPPAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQSKKSSEDADPSASG* |
| Ga0136449_1022165592 | 3300010379 | Peatlands Soil | MPSIPKLSKSERAAAHLKKKKSGPSAMKRAAARQALQTKKSPDGAA* |
| Ga0134123_116474893 | 3300010403 | Terrestrial Soil | MASAPKLSKSERIAARLKKKKSGPSAVKRATARQALQPKKQEDAGG* |
| Ga0137392_111588062 | 3300011269 | Vadose Zone Soil | MPSVPKLSKTERAAARLKKKKSGPSAMKRIAARAALQTKKSDDAAS* |
| Ga0137391_106636762 | 3300011270 | Vadose Zone Soil | MASVPKLSKSERAAARLKKKKSGPSAMKRIAARAALQTKKSDDAAS* |
| Ga0137446_11778532 | 3300011419 | Soil | MPSAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQAKKQSDATGEGGLPPNP* |
| Ga0137436_10876282 | 3300011423 | Soil | MPPAPKLSKAERAAARLKKKKSGPSAMKRAAARQALQTKKESDAPG |
| Ga0137429_12077432 | 3300011437 | Soil | MPSAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQAKKQSDATG |
| Ga0137427_101243532 | 3300011445 | Soil | MPPAPKLSKSERAAARLKKKKSGPSAMKRAAARQALQSKKSSEDPGSGDTPEAPK* |
| Ga0137431_10789092 | 3300012038 | Soil | MAKAPKTTLTERAAARLKKKKSGPSALKRAKAREALQKKTDA* |
| Ga0137382_111236392 | 3300012200 | Vadose Zone Soil | VYRVRGILVGMPAAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQSKKSSEDAEPSTSG* |
| Ga0137377_102779401 | 3300012211 | Vadose Zone Soil | MNTVQTRGILGGMPPAPKLSKSEREAARLKKKKSGPSALKRAAARQA |
| Ga0137465_12009491 | 3300012231 | Soil | KLSKAERAAARLKKKKSGPSAMKRAAARQALQTKKPSDDAG* |
| Ga0137360_118735203 | 3300012361 | Vadose Zone Soil | KKKKSGPSAVKRAAARQALQSKKSSEGADPSASG* |
| Ga0137390_119711262 | 3300012363 | Vadose Zone Soil | MPSVPKLSKSERAAARLKKKKSGPSAMKRIAARAALQTKKSDDAAS* |
| Ga0137398_100767723 | 3300012683 | Vadose Zone Soil | MPAAPKLSKSERAARLKKKKSGPSAVKRAAARQALQSKKSSEDADPSASG* |
| Ga0137397_104879612 | 3300012685 | Vadose Zone Soil | PKLSKSERAAARLKKKKSGPSAVKRAAARQALQSKKQQDDVR* |
| Ga0137395_105012902 | 3300012917 | Vadose Zone Soil | YRVRGILVGMPAAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQSKKSSEDADPSASG |
| Ga0137419_105484842 | 3300012925 | Vadose Zone Soil | MPAAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQSKKSSEDAEPSASG* |
| Ga0164241_104155323 | 3300012943 | Soil | MAKAPKMTKTERAAARLKKKKSGPSALKRAAARKDLQ |
| Ga0157380_104281592 | 3300014326 | Switchgrass Rhizosphere | MPPAPKLSKAERAAARLKKKKSGPSAMKRAAARQALQSKKSSDDAGSGDTPEAPK* |
| Ga0157380_106225822 | 3300014326 | Switchgrass Rhizosphere | MPKAPKMTLTERAAARLKKKKSGPSAVKRATARQALQKKTDE* |
| Ga0157380_125183452 | 3300014326 | Switchgrass Rhizosphere | MAKAPKMTPTERAAARLKKKKSGPSALKRAKAREGLQKKTNA* |
| Ga0157379_102125022 | 3300014968 | Switchgrass Rhizosphere | MAKAPRLSKSERIAGRLKKKTSGASAMKRAAARKELHAKKESADA* |
| Ga0173480_104808022 | 3300015200 | Soil | DRAAARLKKKKSGPSAMKRAAARQALQSKKSSDEAGSGESPEATK* |
| Ga0132256_1027162402 | 3300015372 | Arabidopsis Rhizosphere | AARLKKKKSGPSAVKRAAARQALQTKKSADEGERPS* |
| Ga0132257_1013939561 | 3300015373 | Arabidopsis Rhizosphere | MPSAPKLSKSDRAAARLKKKKSGPSAVKRAAARQALQAKKSSDEAGSGESPEATK* |
| Ga0184610_11761131 | 3300017997 | Groundwater Sediment | PKLSKSDRAAARLKKKKSGPSAVKRAAARQALQSKKSSEDADPSASG |
| Ga0184605_104255642 | 3300018027 | Groundwater Sediment | MPPAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQPKKNSDDVA |
| Ga0184619_105314761 | 3300018061 | Groundwater Sediment | LIGILGGMPPAPKVSKSERAAARLKKKKSGPSAVKRATARQALQTKKPTDEAG |
| Ga0184618_104181222 | 3300018071 | Groundwater Sediment | GILVGMPPAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQSKKTSDDGEPSANG |
| Ga0184624_101780802 | 3300018073 | Groundwater Sediment | MAKAPKMTVTERAAARLKKKKSGPSAVKRATARQALQKKTDA |
| Ga0184632_104411522 | 3300018075 | Groundwater Sediment | MPPAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQSKKQSDDAG |
| Ga0190265_104707692 | 3300018422 | Soil | MPSAPKLSKSERAAARLKKKKSGPSAVKRATARQALHAKKQPDAPGEGG |
| Ga0190265_128041472 | 3300018422 | Soil | MAKAPKMTPTERAAARLKKKKSGPSAVKRATARQALQKKTDA |
| Ga0190272_105750423 | 3300018429 | Soil | MPSAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQTKKPSEEVG |
| Ga0190270_110881051 | 3300018469 | Soil | MPSAPKLSKSERAAARLKKKKSGPSAMKRAAARQALQAKKQSDASGEGG |
| Ga0190274_104270772 | 3300018476 | Soil | MPPAPKLSKAERAAARLKKKKSGPSAMKRAAARQALQSKKSSDDPGSGDTPEAPK |
| Ga0190274_115336982 | 3300018476 | Soil | MPSAPKLSKSERAAARLKKKKSGPSAMKRAAARQALQSKKSSDEPGSGDAPDASK |
| Ga0190271_123175822 | 3300018481 | Soil | MPKAPKMTLTERAAARLKKKKTGPSAVKRATARQALQKKTDA |
| Ga0173482_102819611 | 3300019361 | Soil | MPSTPKLSKSDRAAARLKKKKSGPSAMKRAAARQALQSKKSSDEAGSGESPEATK |
| Ga0193745_10627612 | 3300020059 | Soil | MSKSERAAARLKKKKSGPSAVKRAAARQALQTKKGTDEGA |
| Ga0210381_101811842 | 3300021078 | Groundwater Sediment | MSKSERAAARLKKKKSGPSAVKRAAARQALQTKKGTDESA |
| Ga0210382_100103853 | 3300021080 | Groundwater Sediment | MPPAPKLSKSDRAAARLKKKKSGPSAVKRATARQALQTKKPSEEGE |
| Ga0210382_100147963 | 3300021080 | Groundwater Sediment | MPPTVKAPKVSKSDRAAARLKKKKSGPSAVKRAAARQALQTKKPSDAAG |
| Ga0210382_100431792 | 3300021080 | Groundwater Sediment | MPAAPKLSKSDRAAARLKKKKSGPSAVKRAAARQALQTKKPSEDGEPSASG |
| Ga0210382_101253292 | 3300021080 | Groundwater Sediment | MPPAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQSKKTSEDGEPSANG |
| Ga0210384_113096723 | 3300021432 | Soil | ASCRQRYTRCMASIAKLSKTERAAARLKKKKTGPSAMKRIAARAALQTKKSDEPAS |
| Ga0210402_114950512 | 3300021478 | Soil | MASIVKLSKTERAAARLKKKKTGPSAMKRIAARAALQTKKSDEPAS |
| Ga0222622_110544401 | 3300022756 | Groundwater Sediment | MASVPKLSKSDRAAARLKKKKSGPSAVKRAAARQALQTKKGTDEGA |
| Ga0222622_112470742 | 3300022756 | Groundwater Sediment | PTPKTGQGVYGVRGILVGMPPAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQSKKTSDDGEPSANG |
| Ga0209824_100506621 | 3300025173 | Wastewater | MPPATKLSKSERAAARLKKKKSGPSAMKRAAARQALQSKKHSDDVT |
| Ga0209343_100046925 | 3300025311 | Groundwater | MPPAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQSKQPS |
| Ga0208080_10404053 | 3300025553 | Arctic Peat Soil | VRGILGGMPPAPKLSKSERAAARLKKKKSGPSAVKRAATRQALHSKKPSDDVG |
| Ga0207653_101673212 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKSERIAARLKKKKSGPSAVKRAAARQALQTKKQSDEAP |
| Ga0207704_114682261 | 3300025938 | Miscanthus Rhizosphere | MSKADKAAARLKKKKSGPSAMKRAAARQALQTKKPSDESA |
| Ga0207711_102199731 | 3300025941 | Switchgrass Rhizosphere | MSKSERVAARLKKKKSGPSAVKRATARQALQTKKSTDEGS |
| Ga0207711_111445023 | 3300025941 | Switchgrass Rhizosphere | KSERVAARLKKKKSGPSAVKRATARQALQTKKSTDEGS |
| Ga0207648_110503481 | 3300026089 | Miscanthus Rhizosphere | MPPAPKMSKADKAAARLKKKKSGPSAVKRATARQALQTKKPADDAG |
| Ga0209488_106774632 | 3300027903 | Vadose Zone Soil | GILVGMPPAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQSKKSSEDADPSASG |
| Ga0209488_112188842 | 3300027903 | Vadose Zone Soil | ILGVMPSAPKLSKSERAAARLKKKKSGPSAMKRATARQALQTKKDTA |
| Ga0307282_104720382 | 3300028784 | Soil | MPPAPKMSKSERAAARLKKKKSGPSAVKRAAARQALQTKKGTDEGA |
| Ga0247825_100555482 | 3300028812 | Soil | MATAPKLSKSEREAARLKKKKSGPSAVKRATARQALQTKKPAEEGG |
| Ga0307312_103325681 | 3300028828 | Soil | MPPAPKMSKSERAAARLKKKKSGPSAVKRAAARQALQTKKGAD |
| Ga0299907_101446042 | 3300030006 | Soil | MATAPKLSKSEREAARLKKKKSGPSAVKRATARQALQPKKQSDDAG |
| Ga0310888_102019571 | 3300031538 | Soil | MPSTPKLSKSDRAAARLKKKKSGPSAMKRAAARQALQSKKS |
| Ga0307468_1001936642 | 3300031740 | Hardwood Forest Soil | MPPAPKLSKAERAAARLKKKKSGPSAMKRAAARQALQTKKPSEEAG |
| Ga0310900_102897823 | 3300031908 | Soil | MPAAPKLSKSQRAEARLKKKKSGPSAMKRAAARKAL |
| Ga0310900_105858201 | 3300031908 | Soil | MPKAPKMTLTERAAARLKKKKSGPSAVKRATARQALQKKTDE |
| Ga0310901_105327761 | 3300031940 | Soil | TPKLSKSDRAAARLKKKKSGPSAMKRAAARQALQSKKSSDEAGSGESPEATK |
| Ga0214473_100789545 | 3300031949 | Soil | MPPAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQSKKD |
| Ga0310903_108127582 | 3300032000 | Soil | MPPAPKLSKAERAAARLKKKKSGPSAMKRAAARQALQSKKSSDEAGSGESPEATK |
| Ga0310890_106227141 | 3300032075 | Soil | MPSTPKLSKSDRAAARLKKKKSGPSAMKRAAARQALQSKKSSDEAGSGES |
| Ga0310895_105665411 | 3300032122 | Soil | MPPAPKLSKADRAAARLKKKKSGPSAMKRAAARQALQSKKSSDDP |
| Ga0315281_108904732 | 3300032163 | Sediment | MAQAPKLSKSDRAAARLKKKKSGPSAVKRAAARQSLQSKKPEDVG |
| Ga0310810_113991782 | 3300033412 | Soil | MPPAPKLSKAERAAARLKKKKSGPSAMKRAAARQALQTKKPSDDAG |
| Ga0364924_157068_105_245 | 3300033811 | Sediment | MPPAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQSKKHSDDVG |
| Ga0370490_0266337_395_535 | 3300034128 | Untreated Peat Soil | MPSAPKLSKSERAAARLKKKKSGPSAMKRAAARQALQTKKQSDAPG |
| Ga0364934_0093928_856_999 | 3300034178 | Sediment | MPPAPKLSKSERVAARLKKKKSGPSAVKRAAARQALQSKKDSAGGKS |
| Ga0370495_0001257_4969_5130 | 3300034257 | Untreated Peat Soil | MPSAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQSKKPSDEPGSGDTPNP |
| ⦗Top⦘ |