


| Basic Information | |
|---|---|
| Family ID | F075944 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 118 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MTDNVTLALGSVLLLGVIGFLIALREIRRDEARRRSNPSKE |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 79.66 % |
| % of genes near scaffold ends (potentially truncated) | 22.03 % |
| % of genes from short scaffolds (< 2000 bps) | 81.36 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.136 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (30.508 % of family members) |
| Environment Ontology (ENVO) | Unclassified (48.305 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.07% β-sheet: 0.00% Coil/Unstructured: 44.93% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF00753 | Lactamase_B | 4.24 |
| PF01553 | Acyltransferase | 3.39 |
| PF00291 | PALP | 3.39 |
| PF14534 | DUF4440 | 2.54 |
| PF07883 | Cupin_2 | 2.54 |
| PF12893 | Lumazine_bd_2 | 2.54 |
| PF10518 | TAT_signal | 2.54 |
| PF00072 | Response_reg | 1.69 |
| PF01734 | Patatin | 1.69 |
| PF07681 | DoxX | 1.69 |
| PF14499 | DUF4437 | 1.69 |
| PF13649 | Methyltransf_25 | 1.69 |
| PF03699 | UPF0182 | 1.69 |
| PF01841 | Transglut_core | 1.69 |
| PF12847 | Methyltransf_18 | 0.85 |
| PF00196 | GerE | 0.85 |
| PF00581 | Rhodanese | 0.85 |
| PF14257 | DUF4349 | 0.85 |
| PF04055 | Radical_SAM | 0.85 |
| PF13975 | gag-asp_proteas | 0.85 |
| PF02369 | Big_1 | 0.85 |
| PF07995 | GSDH | 0.85 |
| PF07690 | MFS_1 | 0.85 |
| PF04397 | LytTR | 0.85 |
| PF12833 | HTH_18 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG1615 | Uncharacterized membrane protein, UPF0182 family | Function unknown [S] | 1.69 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 1.69 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 1.69 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 1.69 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 1.69 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 1.69 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.14 % |
| Unclassified | root | N/A | 11.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002558|JGI25385J37094_10026287 | All Organisms → cellular organisms → Bacteria | 2067 | Open in IMG/M |
| 3300002558|JGI25385J37094_10037985 | All Organisms → cellular organisms → Bacteria | 1669 | Open in IMG/M |
| 3300002558|JGI25385J37094_10121280 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300002908|JGI25382J43887_10073415 | All Organisms → cellular organisms → Bacteria | 1846 | Open in IMG/M |
| 3300005166|Ga0066674_10212652 | Not Available | 920 | Open in IMG/M |
| 3300005172|Ga0066683_10037858 | All Organisms → cellular organisms → Bacteria | 2808 | Open in IMG/M |
| 3300005175|Ga0066673_10024501 | All Organisms → cellular organisms → Bacteria | 2829 | Open in IMG/M |
| 3300005179|Ga0066684_10705757 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 675 | Open in IMG/M |
| 3300005186|Ga0066676_11104239 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300005406|Ga0070703_10000377 | All Organisms → cellular organisms → Bacteria | 19006 | Open in IMG/M |
| 3300005446|Ga0066686_10211343 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300005446|Ga0066686_10505754 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300005446|Ga0066686_10992755 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300005451|Ga0066681_10827824 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 558 | Open in IMG/M |
| 3300005467|Ga0070706_100306878 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
| 3300005468|Ga0070707_100806395 | Not Available | 903 | Open in IMG/M |
| 3300005468|Ga0070707_101956818 | All Organisms → cellular organisms → Bacteria → FCB group | 554 | Open in IMG/M |
| 3300005536|Ga0070697_100053563 | All Organisms → cellular organisms → Bacteria | 3279 | Open in IMG/M |
| 3300005540|Ga0066697_10741475 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005545|Ga0070695_100750039 | All Organisms → cellular organisms → Bacteria → FCB group | 778 | Open in IMG/M |
| 3300005553|Ga0066695_10239514 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1144 | Open in IMG/M |
| 3300005553|Ga0066695_10791544 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300005556|Ga0066707_10204466 | All Organisms → cellular organisms → Bacteria | 1275 | Open in IMG/M |
| 3300005556|Ga0066707_10693781 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300005574|Ga0066694_10352158 | Not Available | 697 | Open in IMG/M |
| 3300005576|Ga0066708_10925129 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300006032|Ga0066696_10076797 | All Organisms → cellular organisms → Bacteria | 1951 | Open in IMG/M |
| 3300006034|Ga0066656_10113088 | All Organisms → cellular organisms → Bacteria | 1662 | Open in IMG/M |
| 3300006791|Ga0066653_10045363 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1807 | Open in IMG/M |
| 3300006796|Ga0066665_10398157 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1135 | Open in IMG/M |
| 3300006844|Ga0075428_100063360 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 4048 | Open in IMG/M |
| 3300006852|Ga0075433_10736613 | Not Available | 862 | Open in IMG/M |
| 3300006903|Ga0075426_10014817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5565 | Open in IMG/M |
| 3300006904|Ga0075424_100853235 | Not Available | 971 | Open in IMG/M |
| 3300007258|Ga0099793_10463633 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300009012|Ga0066710_101272698 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1140 | Open in IMG/M |
| 3300009012|Ga0066710_101664111 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 974 | Open in IMG/M |
| 3300009012|Ga0066710_102179345 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300009090|Ga0099827_11813667 | Not Available | 532 | Open in IMG/M |
| 3300009094|Ga0111539_10213474 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2248 | Open in IMG/M |
| 3300009137|Ga0066709_100116527 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3325 | Open in IMG/M |
| 3300009137|Ga0066709_100613416 | All Organisms → cellular organisms → Bacteria | 1552 | Open in IMG/M |
| 3300009156|Ga0111538_11078763 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1016 | Open in IMG/M |
| 3300009162|Ga0075423_10313843 | All Organisms → cellular organisms → Bacteria | 1643 | Open in IMG/M |
| 3300009678|Ga0105252_10223249 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300010126|Ga0127482_1163675 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300010134|Ga0127484_1155391 | Not Available | 516 | Open in IMG/M |
| 3300010304|Ga0134088_10101385 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300012198|Ga0137364_10010466 | All Organisms → cellular organisms → Bacteria | 5277 | Open in IMG/M |
| 3300012198|Ga0137364_10851621 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300012199|Ga0137383_10886291 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300012200|Ga0137382_10833156 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300012201|Ga0137365_10167344 | All Organisms → cellular organisms → Bacteria | 1648 | Open in IMG/M |
| 3300012202|Ga0137363_10120033 | All Organisms → cellular organisms → Bacteria | 2027 | Open in IMG/M |
| 3300012203|Ga0137399_10134532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1958 | Open in IMG/M |
| 3300012203|Ga0137399_10530967 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 988 | Open in IMG/M |
| 3300012203|Ga0137399_10603266 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 923 | Open in IMG/M |
| 3300012203|Ga0137399_11058899 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 683 | Open in IMG/M |
| 3300012204|Ga0137374_10103572 | All Organisms → cellular organisms → Bacteria | 2675 | Open in IMG/M |
| 3300012207|Ga0137381_10259314 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1511 | Open in IMG/M |
| 3300012207|Ga0137381_11288465 | Not Available | 624 | Open in IMG/M |
| 3300012211|Ga0137377_10245721 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1719 | Open in IMG/M |
| 3300012211|Ga0137377_10620955 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300012350|Ga0137372_11237623 | Not Available | 501 | Open in IMG/M |
| 3300012359|Ga0137385_11293438 | Not Available | 592 | Open in IMG/M |
| 3300012360|Ga0137375_10365797 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300012362|Ga0137361_10220514 | All Organisms → cellular organisms → Bacteria | 1721 | Open in IMG/M |
| 3300012532|Ga0137373_10905328 | Not Available | 647 | Open in IMG/M |
| 3300012683|Ga0137398_11143382 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 534 | Open in IMG/M |
| 3300012685|Ga0137397_10171054 | All Organisms → cellular organisms → Bacteria | 1613 | Open in IMG/M |
| 3300012685|Ga0137397_10532336 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300012685|Ga0137397_11308390 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300012918|Ga0137396_10076844 | All Organisms → cellular organisms → Bacteria | 2344 | Open in IMG/M |
| 3300012918|Ga0137396_10719220 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300012922|Ga0137394_10220031 | All Organisms → cellular organisms → Bacteria | 1623 | Open in IMG/M |
| 3300012922|Ga0137394_11433913 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300012925|Ga0137419_10300026 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
| 3300012927|Ga0137416_12187473 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300012972|Ga0134077_10324427 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300012972|Ga0134077_10474691 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 551 | Open in IMG/M |
| 3300012976|Ga0134076_10050945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1562 | Open in IMG/M |
| 3300014154|Ga0134075_10185172 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300014154|Ga0134075_10587835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300015241|Ga0137418_10121234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2331 | Open in IMG/M |
| 3300015359|Ga0134085_10239891 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300015359|Ga0134085_10354087 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300015359|Ga0134085_10533639 | Not Available | 540 | Open in IMG/M |
| 3300017654|Ga0134069_1128175 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 839 | Open in IMG/M |
| 3300017654|Ga0134069_1228753 | Not Available | 641 | Open in IMG/M |
| 3300017656|Ga0134112_10415630 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300017656|Ga0134112_10435714 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300018071|Ga0184618_10000176 | All Organisms → cellular organisms → Bacteria | 14487 | Open in IMG/M |
| 3300018071|Ga0184618_10169094 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 902 | Open in IMG/M |
| 3300018431|Ga0066655_10111170 | All Organisms → cellular organisms → Bacteria | 1555 | Open in IMG/M |
| 3300018433|Ga0066667_11515956 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300018468|Ga0066662_10166740 | All Organisms → cellular organisms → Bacteria | 1691 | Open in IMG/M |
| 3300018482|Ga0066669_11098122 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300018482|Ga0066669_11570241 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300018482|Ga0066669_12270111 | Not Available | 517 | Open in IMG/M |
| 3300019879|Ga0193723_1176491 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300019883|Ga0193725_1004415 | All Organisms → cellular organisms → Bacteria | 4069 | Open in IMG/M |
| 3300019998|Ga0193710_1000860 | All Organisms → cellular organisms → Bacteria | 3398 | Open in IMG/M |
| 3300024330|Ga0137417_1057728 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300025885|Ga0207653_10001722 | All Organisms → cellular organisms → Bacteria | 6993 | Open in IMG/M |
| 3300026296|Ga0209235_1227896 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300026297|Ga0209237_1286916 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300026298|Ga0209236_1211603 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300026301|Ga0209238_1062545 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1319 | Open in IMG/M |
| 3300026316|Ga0209155_1057381 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1497 | Open in IMG/M |
| 3300026320|Ga0209131_1015192 | All Organisms → cellular organisms → Bacteria | 4705 | Open in IMG/M |
| 3300026323|Ga0209472_1292700 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 520 | Open in IMG/M |
| 3300026538|Ga0209056_10144326 | All Organisms → cellular organisms → Bacteria | 1837 | Open in IMG/M |
| 3300026550|Ga0209474_10075174 | All Organisms → cellular organisms → Bacteria | 2335 | Open in IMG/M |
| 3300027882|Ga0209590_10025364 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3054 | Open in IMG/M |
| 3300028536|Ga0137415_10080553 | All Organisms → cellular organisms → Bacteria | 3115 | Open in IMG/M |
| 3300031199|Ga0307495_10016715 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1178 | Open in IMG/M |
| 3300031226|Ga0307497_10277452 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300032180|Ga0307471_100375265 | All Organisms → cellular organisms → Bacteria | 1541 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 30.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 18.64% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 16.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 12.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.24% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.69% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300010126 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010134 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300019998 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m1 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25385J37094_100262873 | 3300002558 | Grasslands Soil | MTDNVTLALGSVLLLGVIGFLIALREIRRDEARRRSNPSKE* |
| JGI25385J37094_100379853 | 3300002558 | Grasslands Soil | MMSNLLMAFGGVLLLGVIGFLIALREIRRDEARRRSNQSKQ* |
| JGI25385J37094_101212802 | 3300002558 | Grasslands Soil | MMDNVTLALGSVLFLGIIGFLIALREIRRDEARRRSNPSKE* |
| JGI25382J43887_100734151 | 3300002908 | Grasslands Soil | MTDNVTLALGSVLVLGIVGFLIALREIRRDEARRRSNPSKE* |
| Ga0066674_102126522 | 3300005166 | Soil | MWINIAVGFGGVLLLGVIAFLVALREIRRDEARRRSNPSKE* |
| Ga0066683_100378583 | 3300005172 | Soil | MTDNVTLALGIVLLLGIIGFLIALREIRRDEARRRSNPSKE* |
| Ga0066673_100245014 | 3300005175 | Soil | MTDNVTLALGSVLLLGIIGFLIALREIRRDEARRRSNPTKE* |
| Ga0066684_107057571 | 3300005179 | Soil | MIDNVTLALGSVLLLGVIGFLIALRAVRRDEARRRSNQSKE* |
| Ga0066676_111042392 | 3300005186 | Soil | MTDNVTLALGSVLLLGIIGFLIALREIRRDEARRRSNPSKE* |
| Ga0070703_100003772 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MDDVTLALGSVLLLGVIGVLIALREIRRDEARRRSNPSKE* |
| Ga0066686_102113432 | 3300005446 | Soil | VWVNIAVGFGGVLLLGVIGFVVALREIRRDEARRRSNQTKE* |
| Ga0066686_105057543 | 3300005446 | Soil | PVWVNIAVGFGGVLLLGVIGFVVALREIRREEARRRSGTAKD* |
| Ga0066686_109927552 | 3300005446 | Soil | MSSDILVAFGGVGLLGLIAFLVALHLIRRDEARRRSNPSKE* |
| Ga0066681_108278242 | 3300005451 | Soil | WINIAVGFGGVLLLGVIAFLVALREIRRDEARRRSNPSKE* |
| Ga0070706_1003068782 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MDDVTLALGSVLLLGVIGFLIALREIRRDEARRRSNPSKE* |
| Ga0070707_1008063951 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDSVTLALGSVLLLGIIGFLIALREIRRDEARRRSNPSKE* |
| Ga0070707_1019568182 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MMDDVTLALGSVLLLGAIGFLVALHEIRRDEARRRSNSSKE* |
| Ga0070697_1000535633 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MMDSVTLALGSVLLLGVIGFLIALREIRRDEARRRSNPSKE* |
| Ga0066697_107414753 | 3300005540 | Soil | DPVSSDVLVAFGGIGFLGLVASLVALHLIRRDEVRRRSNQSKE* |
| Ga0070695_1007500392 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VSSDVLIAFGGIGFLGLVASLVALHLIRRDEARRRSNPSKE* |
| Ga0066695_102395141 | 3300005553 | Soil | DNVTLALGSVLLLGVIGFLIALREIRRDEARRRSNPSKE* |
| Ga0066695_107915442 | 3300005553 | Soil | MTDNVTLALGSVLLLGIIGFLIALREIRRDEARRRSNPSK |
| Ga0066707_102044662 | 3300005556 | Soil | MTDSVTLALGSILLLGIIGFLIALREIRRDEARRRSNPSKE* |
| Ga0066707_106937811 | 3300005556 | Soil | LVAFGGIGFLGLVASLVALHLIRRDEVRRRSNQSKE* |
| Ga0066694_103521581 | 3300005574 | Soil | GRMMGNVLMAFGGVLLLGVIGFLIALREIRRDEARRRSNPSKE* |
| Ga0066708_109251291 | 3300005576 | Soil | MIDNVTLALGSVLLLGVIGFLIALRAIRRDEARRRSNQS |
| Ga0066696_100767972 | 3300006032 | Soil | MIDDVTLALGSVLLLGVIGFLIALHLIRRDEARRRSNQSKE* |
| Ga0066656_101130882 | 3300006034 | Soil | VWVNIAVGFGGVLLLGVIGFVVALREIRREEARRRSGTAKD* |
| Ga0066653_100453633 | 3300006791 | Soil | NVTLALGSVLLLGIIGFLIALREIRRDEARRRSNPTKE* |
| Ga0066665_103981571 | 3300006796 | Soil | HSSRDRCGWRGEGRMMSNLLMAFGGVLLLGVIGFLIALREIRRDEARRRSNQTKE* |
| Ga0075428_1000633605 | 3300006844 | Populus Rhizosphere | MSNVLMAFGGVLFLGVIGFLIALREIRRDEARRRSNPSKE* |
| Ga0075433_107366131 | 3300006852 | Populus Rhizosphere | RDVLIAFGGIGLLGLVASLVALHLIRRDEARRRSNPSKE* |
| Ga0075426_100148173 | 3300006903 | Populus Rhizosphere | MMDNVTLALGSVLLLGIIGFPIALREIRRDEARRRSNPSKE* |
| Ga0075424_1008532354 | 3300006904 | Populus Rhizosphere | LIAFGGIGLLGLVASLVALHLIRRDEARRRSNPSKE* |
| Ga0099793_104636331 | 3300007258 | Vadose Zone Soil | MMDNVTLALGSVLLLGIIGFLIALREIRRDEARRRSNPSKE* |
| Ga0066710_1012726982 | 3300009012 | Grasslands Soil | MTDNVTLALGSVLLLGIIGFLIALREIRRDEARRRSNQSKE |
| Ga0066710_1016641113 | 3300009012 | Grasslands Soil | MTDNVTLALGGLLLLGVIGFLIALREIRRDEARRRSNPSKE |
| Ga0066710_1021793452 | 3300009012 | Grasslands Soil | MMSNLLMAFGGVLFLGVIGFLIALREIRRDEARRRSNQTKE |
| Ga0099827_118136672 | 3300009090 | Vadose Zone Soil | MTDNVILALGSVLLLGIIGFLVALREIRRDEARRRSNQTKE* |
| Ga0111539_102134741 | 3300009094 | Populus Rhizosphere | MAFGGVLFLGVIGFLIALREIRRDEARRRSNPSKE* |
| Ga0066709_1001165275 | 3300009137 | Grasslands Soil | MMDNVTLALGSVLLLGVIGFLIALREIRRDEARRRSNPSKE* |
| Ga0066709_1006134162 | 3300009137 | Grasslands Soil | MTDNVTLALGSVLLLGIIGFLIALREIRRDEARRRSNQTKE* |
| Ga0111538_110787632 | 3300009156 | Populus Rhizosphere | MAFGGVLLLGVIGFLIALREIRRDEARRRSNPSKE* |
| Ga0075423_103138431 | 3300009162 | Populus Rhizosphere | SRGDAPVSRDVLIAFGGIGLLGLVASLVALHLIRRDEARRRSNPSKE* |
| Ga0105252_102232492 | 3300009678 | Soil | VSSDIVVAFGGVGFLGLVAFLVALHLIRRDEARRRSNQSKE* |
| Ga0127482_11636752 | 3300010126 | Grasslands Soil | VTLALGSVLLLGIIGFLIALREIRRDEARRRSNQTKE* |
| Ga0127484_11553912 | 3300010134 | Grasslands Soil | RMMGNVLMAFGGVLLLGVIGFLIALREIRRDEARRRSNPSKE* |
| Ga0134088_101013852 | 3300010304 | Grasslands Soil | MAFGGVLFLGVIGFLIALREIRRDEARRRSNQTKE* |
| Ga0137364_100104666 | 3300012198 | Vadose Zone Soil | MTDNVTLALGSVLLLGIIGFLIALREIRRDEARRRSNSSKE* |
| Ga0137364_108516213 | 3300012198 | Vadose Zone Soil | MIDNVILALGGVLLLGVIGFLIALREIRRDEARRRSNPSKE* |
| Ga0137383_108862911 | 3300012199 | Vadose Zone Soil | VWVNIAVGFGGVLLLGVIGFVVALGEIRREEARRRSGTAKD* |
| Ga0137382_108331562 | 3300012200 | Vadose Zone Soil | MTDDVTLALGSVLLLGVIGFLIALREIRRDEARRRSNQSQE* |
| Ga0137365_101673442 | 3300012201 | Vadose Zone Soil | MSSDVLVAFGGIVFLGLVASLVALHLIRRDEARRRANQTKE* |
| Ga0137363_101200333 | 3300012202 | Vadose Zone Soil | MDNVTLALGSVLLLGVIGFLIALREIGRDEARRRSNPSKE* |
| Ga0137399_101345321 | 3300012203 | Vadose Zone Soil | MTDNVTLALGSVLLLGVIGFLIALREIRRDEARRRSNQTKE* |
| Ga0137399_105309672 | 3300012203 | Vadose Zone Soil | VTSNVVLAFGGVLFLALIGFLVALREIRRDEARRRSNQTKE* |
| Ga0137399_106032662 | 3300012203 | Vadose Zone Soil | MIDNVTLALGSILLLGIIGFVIALREIRRDEARRRSHQTKE* |
| Ga0137399_110588992 | 3300012203 | Vadose Zone Soil | VSSDVLVAFGGIAFLGLVASLVALHLIRRDEARRRSNPSKE* |
| Ga0137374_101035725 | 3300012204 | Vadose Zone Soil | MTDSVTLALGSVLLLGIIGFLIALREIRRNEARRRSNQTKE* |
| Ga0137381_102593142 | 3300012207 | Vadose Zone Soil | VWVNIAVGFGGVLLLGVIGFVVALREIRRDEARRRSNQSKE* |
| Ga0137381_112884652 | 3300012207 | Vadose Zone Soil | DNVTLALGSVLLLGIIGFLIALREIRRDEARRRSNPSKE* |
| Ga0137377_102457212 | 3300012211 | Vadose Zone Soil | MWVNIAVGFGGVLLLGVIGFVVALREIRRDEARRRSNQSKQ* |
| Ga0137377_106209551 | 3300012211 | Vadose Zone Soil | VSSDVLVAFGGVGLLGLIAFLIDLHLIRRDEARRR |
| Ga0137372_112376231 | 3300012350 | Vadose Zone Soil | MTDSVTLALGSVLLLGIIGFLIALREIRRNEARRR |
| Ga0137385_112934382 | 3300012359 | Vadose Zone Soil | MSSDNLVAFGGVGLLGLIAFLVALHLIRRDEARRRSNPSKE* |
| Ga0137375_103657973 | 3300012360 | Vadose Zone Soil | RCGSRGEGPVWVNIAVGFGGVLLLGVIGFVVALREIRRDEARRRSNQSKE* |
| Ga0137361_102205143 | 3300012362 | Vadose Zone Soil | MDNVTLALGSVLLLGVIGFLIALREIRRDEARRRSNPSKE* |
| Ga0137373_109053282 | 3300012532 | Vadose Zone Soil | MWINIAVGFGGVLLLGAIAFLVALREIRRDEARRRSNPSKE* |
| Ga0137398_111433822 | 3300012683 | Vadose Zone Soil | MWVNIAVGFGGVLLLGIIAFVVALREIRRDEARRRANQSKE* |
| Ga0137397_101710541 | 3300012685 | Vadose Zone Soil | RFGWRGEERVTSNVVLAFGGVLFLALIGFLVALREIRRDEARRRSNQTKE* |
| Ga0137397_105323363 | 3300012685 | Vadose Zone Soil | MAFGGVLFLGIIGFLIALREIRRDETRRRSNSSKD* |
| Ga0137397_113083902 | 3300012685 | Vadose Zone Soil | MTDNVTLALGSVLLLGIIGFLIALREIRRDEARRRSNSSKD* |
| Ga0137396_100768445 | 3300012918 | Vadose Zone Soil | MIDNVTLALGSILLLGIIGFLFALRAIRRDEARRRSHQTKE* |
| Ga0137396_107192201 | 3300012918 | Vadose Zone Soil | MTDNVTLALGSVLLLGVIGFLIALREIRRAEARRRSNPSKE* |
| Ga0137394_102200314 | 3300012922 | Vadose Zone Soil | WRGEERVTSNVVLAFGGVLFLALIGFLVALREIRRDEARRRSNQTKE* |
| Ga0137394_114339132 | 3300012922 | Vadose Zone Soil | MAFGGVLFLGIIGFLIALREIRRDETRRRSNLSKD* |
| Ga0137419_103000263 | 3300012925 | Vadose Zone Soil | MIDNVTLALGSILLLGIIGFLFALRAIRRDEARRRSNQTKE* |
| Ga0137416_121874732 | 3300012927 | Vadose Zone Soil | VSGDVLIAFGGIAFLGLVAALVALHLIRRDEARRRSNQTKE* |
| Ga0134077_103244271 | 3300012972 | Grasslands Soil | VSSDIIVAFGGVGLLGLIAFLVALHLIRRDEARRRSNQSKE* |
| Ga0134077_104746912 | 3300012972 | Grasslands Soil | MTDNVTLALGIVLLLGIIGFLIALREIRRDEARRRSNQTKE* |
| Ga0134076_100509453 | 3300012976 | Grasslands Soil | MTYNVTLALGIVLLLGIIGFLIALREIRRDEARRRSNPSKE* |
| Ga0134075_101851722 | 3300014154 | Grasslands Soil | VSSDIIVAFGGVGLLGLIAFLVALHLIRRDEARRRSNPSKE* |
| Ga0134075_105878351 | 3300014154 | Grasslands Soil | SPMWINIAVGFGGVLLLGVIAFLVALREIRRDEARRRSNPSKE* |
| Ga0137418_101212342 | 3300015241 | Vadose Zone Soil | MIDNVFLALGGVLLLGVIGFLIALREIRRDEARRRSNPSKESLR* |
| Ga0134085_102398913 | 3300015359 | Grasslands Soil | MWINIAVGFGGVLLLGVIAFLVALREIRRDEARRRSKPSKE* |
| Ga0134085_103540872 | 3300015359 | Grasslands Soil | VSSDVLVAFGGVGLLGLIAFLIDLHLIRRDEARRRANQSKE* |
| Ga0134085_105336391 | 3300015359 | Grasslands Soil | MTDNVTLALGSVLLLGIIGFLIALREIRRDEARRRSNQSKE* |
| Ga0134069_11281752 | 3300017654 | Grasslands Soil | MMSNVLMAFGGVLLLGVIGFLIALREIRRDEARRRSNPSKE |
| Ga0134069_12287532 | 3300017654 | Grasslands Soil | MSLSLGSVLLLGVIGFLIALREIRRDEARRRSNQSKE |
| Ga0134112_104156301 | 3300017656 | Grasslands Soil | MMSNLLMAFGGVLLLGVIGFLIALREIRRDEARRRSNQTKE |
| Ga0134112_104357141 | 3300017656 | Grasslands Soil | VWVNIAVGFGGVLLLGVIGFVVALREIRREEACHRSGTAKD |
| Ga0184618_100001767 | 3300018071 | Groundwater Sediment | MSSDIFVAFGGVGFLGLIAFLVALHLIRRDEARRRSNQSKE |
| Ga0184618_101690942 | 3300018071 | Groundwater Sediment | MIDNVILALGGVLLLGIIGFLIALREIRRAEARRRSNPSKE |
| Ga0066655_101111702 | 3300018431 | Grasslands Soil | MTDNVTLALGIVLLLGIIGFLIALREIRRDEARRRSNPSKE |
| Ga0066667_115159562 | 3300018433 | Grasslands Soil | MTDNVTLALGSVLLLGIIGFLIALREIRRDEARRRSNQTKE |
| Ga0066662_101667402 | 3300018468 | Grasslands Soil | MTDNVTLALGSVLLLGVIGFLIALREIRRDEARRRSNPSKE |
| Ga0066669_110981222 | 3300018482 | Grasslands Soil | MMDNVTLALGSVLLLGVIGFLIALREIRRDEARRRSNPSKE |
| Ga0066669_115702412 | 3300018482 | Grasslands Soil | MTDNVTLALGSVLLLGIIGFLIALREIRRDEARRRSNPTKE |
| Ga0066669_122701112 | 3300018482 | Grasslands Soil | MWINIAVGFGGVLLLGVIAFLVALREIRRDEARRRSNPSKE |
| Ga0193723_11764911 | 3300019879 | Soil | MTINLVIGFGGVAVLGLIAFLVALHLIRRDEARRRADRAKE |
| Ga0193725_10044156 | 3300019883 | Soil | MIDNVILALGGVLLLGVIGFLIALREIRRDEARRRSNPSKE |
| Ga0193710_10008601 | 3300019998 | Soil | LDRCGWRGEGSMIDNVILALGGVLLLGVIGFLIALREIRRDEARRRSNPSKE |
| Ga0137417_10577282 | 3300024330 | Vadose Zone Soil | MMDNVTLALGSVLLLGIIGFLIALREIRRDEARRRSNPSKE |
| Ga0207653_100017229 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MDDVTLALGSVLLLGVIGVLIALREIRRDEARRRSNPSKE |
| Ga0209235_12278961 | 3300026296 | Grasslands Soil | MMDDVTLALGSVLLLGVIGFLIALREIRRDEARRRSNPSKE |
| Ga0209237_12869163 | 3300026297 | Grasslands Soil | VWVNIAVGFGGVLLLGVIGFVVALREIRREEARRRSGTAKD |
| Ga0209236_12116032 | 3300026298 | Grasslands Soil | MMDNVTLALGSVLFLGIIGFLIALREIRRDEARRRSNPSKE |
| Ga0209238_10625453 | 3300026301 | Grasslands Soil | MAFGGVLLLGVIGFLIALREIRRDEARRRSNQSKQ |
| Ga0209155_10573811 | 3300026316 | Soil | GEGRMTDNVTLALGSVLLLGIIGFLIALREIRRDEARRRSNPTKE |
| Ga0209131_10151922 | 3300026320 | Grasslands Soil | MMDNVTLALGSVLLLGVIGFLIGLREIRRDEARRRSNPSKE |
| Ga0209472_12927002 | 3300026323 | Soil | TDNVTLALGSVLLLGIIGFLIALREIRRDEARRRSNPSKE |
| Ga0209056_101443263 | 3300026538 | Soil | MTDNVTLALGSVLLLGIIGFLIALREIRRDEARRRSNSSKE |
| Ga0209474_100751742 | 3300026550 | Soil | MIDDVTLALGSVLLLGVIGFLIALHLIRRDEARRRSNQSKE |
| Ga0209590_100253642 | 3300027882 | Vadose Zone Soil | MAFGGVLFLGVIGFLIALREIRRDEARRRSNQTKE |
| Ga0137415_100805533 | 3300028536 | Vadose Zone Soil | MIDNVTLALGSILLLGIIGFLFALRAIRRDEARRRSNQTKE |
| Ga0307495_100167152 | 3300031199 | Soil | MTDNVTLALGSVLLLGIIGFVIALREIRRDEARRRSNPSKE |
| Ga0307497_102774522 | 3300031226 | Soil | MTDNVTLALGSVLLLGIIGFLIALREIRRDEARRRSNPSKE |
| Ga0307471_1003752653 | 3300032180 | Hardwood Forest Soil | MMDSVTLALGSVLLLGVIGFLIALRAIRRDEARRRSNPSKE |
| ⦗Top⦘ |