


| Basic Information | |
|---|---|
| Family ID | F075894 |
| Family Type | Metagenome |
| Number of Sequences | 118 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MPNLKGMNVEALMKLRNQVDERLLAVAIGVGVGIALAIIGYLLHWISS |
| Number of Associated Samples | 81 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 77.12 % |
| % of genes near scaffold ends (potentially truncated) | 27.12 % |
| % of genes from short scaffolds (< 2000 bps) | 88.14 % |
| Associated GOLD sequencing projects | 76 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (64.407 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (52.542 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.085 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (62.712 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.26% β-sheet: 0.00% Coil/Unstructured: 44.74% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF00816 | Histone_HNS | 9.32 |
| PF03869 | Arc | 3.39 |
| PF13683 | rve_3 | 2.54 |
| PF13432 | TPR_16 | 1.69 |
| PF14023 | DUF4239 | 1.69 |
| PF05532 | CsbD | 0.85 |
| PF04392 | ABC_sub_bind | 0.85 |
| PF05068 | MtlR | 0.85 |
| PF13183 | Fer4_8 | 0.85 |
| PF13305 | TetR_C_33 | 0.85 |
| PF11149 | DUF2924 | 0.85 |
| PF11154 | DUF2934 | 0.85 |
| PF00589 | Phage_integrase | 0.85 |
| PF01926 | MMR_HSR1 | 0.85 |
| PF00144 | Beta-lactamase | 0.85 |
| PF04241 | DUF423 | 0.85 |
| PF08541 | ACP_syn_III_C | 0.85 |
| PF13676 | TIR_2 | 0.85 |
| PF01527 | HTH_Tnp_1 | 0.85 |
| PF03401 | TctC | 0.85 |
| PF00072 | Response_reg | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG2916 | DNA-binding protein H-NS | Transcription [K] | 9.32 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.85 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.85 |
| COG2363 | Uncharacterized membrane protein YgdD, TMEM256/DUF423 family | Function unknown [S] | 0.85 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.85 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.85 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.85 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.85 |
| COG3722 | DNA-binding transcriptional regulator, MltR family | Transcription [K] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 64.41 % |
| Unclassified | root | N/A | 35.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_100238772 | Not Available | 556 | Open in IMG/M |
| 3300000550|F24TB_10017026 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2635 | Open in IMG/M |
| 3300000550|F24TB_10440313 | Not Available | 541 | Open in IMG/M |
| 3300002911|JGI25390J43892_10025733 | All Organisms → cellular organisms → Bacteria | 1418 | Open in IMG/M |
| 3300002917|JGI25616J43925_10285531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 616 | Open in IMG/M |
| 3300005174|Ga0066680_10970535 | Not Available | 500 | Open in IMG/M |
| 3300005187|Ga0066675_10613628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 817 | Open in IMG/M |
| 3300005445|Ga0070708_100464804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1194 | Open in IMG/M |
| 3300005447|Ga0066689_10394301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium zhanjiangense | 865 | Open in IMG/M |
| 3300005467|Ga0070706_100426264 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1234 | Open in IMG/M |
| 3300005467|Ga0070706_100723502 | Not Available | 923 | Open in IMG/M |
| 3300005468|Ga0070707_100982350 | Not Available | 810 | Open in IMG/M |
| 3300005554|Ga0066661_10835199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 539 | Open in IMG/M |
| 3300005554|Ga0066661_10905735 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300005559|Ga0066700_10354124 | Not Available | 1037 | Open in IMG/M |
| 3300005561|Ga0066699_10169781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1502 | Open in IMG/M |
| 3300006028|Ga0070717_10093656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2540 | Open in IMG/M |
| 3300006046|Ga0066652_102031194 | Not Available | 511 | Open in IMG/M |
| 3300006050|Ga0075028_100742422 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300006796|Ga0066665_11254226 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300006797|Ga0066659_10225080 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1389 | Open in IMG/M |
| 3300009038|Ga0099829_10539552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 969 | Open in IMG/M |
| 3300009090|Ga0099827_10510158 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1033 | Open in IMG/M |
| 3300010038|Ga0126315_11233225 | Not Available | 509 | Open in IMG/M |
| 3300011269|Ga0137392_10413587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1120 | Open in IMG/M |
| 3300011270|Ga0137391_10399962 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300012189|Ga0137388_10128310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2219 | Open in IMG/M |
| 3300012189|Ga0137388_10445121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1201 | Open in IMG/M |
| 3300012198|Ga0137364_10434105 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300012198|Ga0137364_10690566 | Not Available | 770 | Open in IMG/M |
| 3300012198|Ga0137364_11084512 | Not Available | 603 | Open in IMG/M |
| 3300012199|Ga0137383_10124497 | All Organisms → cellular organisms → Bacteria | 1882 | Open in IMG/M |
| 3300012199|Ga0137383_10282418 | Not Available | 1216 | Open in IMG/M |
| 3300012199|Ga0137383_10394662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1014 | Open in IMG/M |
| 3300012200|Ga0137382_10319711 | Not Available | 1085 | Open in IMG/M |
| 3300012200|Ga0137382_11324872 | Not Available | 507 | Open in IMG/M |
| 3300012201|Ga0137365_10010481 | All Organisms → cellular organisms → Bacteria | 7339 | Open in IMG/M |
| 3300012201|Ga0137365_10403371 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300012201|Ga0137365_10561255 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300012201|Ga0137365_10642798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ERR14 | 777 | Open in IMG/M |
| 3300012201|Ga0137365_10957796 | Not Available | 622 | Open in IMG/M |
| 3300012202|Ga0137363_10319745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1278 | Open in IMG/M |
| 3300012202|Ga0137363_10810589 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300012202|Ga0137363_11527491 | Not Available | 559 | Open in IMG/M |
| 3300012204|Ga0137374_10276134 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
| 3300012204|Ga0137374_10279535 | Not Available | 1381 | Open in IMG/M |
| 3300012205|Ga0137362_10402377 | Not Available | 1186 | Open in IMG/M |
| 3300012205|Ga0137362_11173765 | Not Available | 652 | Open in IMG/M |
| 3300012206|Ga0137380_10129117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae | 2308 | Open in IMG/M |
| 3300012206|Ga0137380_10645197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 187 | 923 | Open in IMG/M |
| 3300012206|Ga0137380_10891829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 764 | Open in IMG/M |
| 3300012207|Ga0137381_10164607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1913 | Open in IMG/M |
| 3300012208|Ga0137376_10061006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3110 | Open in IMG/M |
| 3300012208|Ga0137376_10743686 | Not Available | 845 | Open in IMG/M |
| 3300012210|Ga0137378_11115919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 187 | 704 | Open in IMG/M |
| 3300012211|Ga0137377_11680685 | Not Available | 557 | Open in IMG/M |
| 3300012353|Ga0137367_10112539 | Not Available | 2002 | Open in IMG/M |
| 3300012355|Ga0137369_10463838 | Not Available | 901 | Open in IMG/M |
| 3300012356|Ga0137371_10631647 | Not Available | 821 | Open in IMG/M |
| 3300012357|Ga0137384_10162836 | All Organisms → cellular organisms → Bacteria | 1867 | Open in IMG/M |
| 3300012357|Ga0137384_10343991 | Not Available | 1236 | Open in IMG/M |
| 3300012357|Ga0137384_10670586 | Not Available | 843 | Open in IMG/M |
| 3300012358|Ga0137368_10507934 | Not Available | 776 | Open in IMG/M |
| 3300012358|Ga0137368_10693135 | Not Available | 641 | Open in IMG/M |
| 3300012359|Ga0137385_11000285 | Not Available | 690 | Open in IMG/M |
| 3300012360|Ga0137375_11333666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 539 | Open in IMG/M |
| 3300012361|Ga0137360_10431580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1114 | Open in IMG/M |
| 3300012361|Ga0137360_10838272 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300012361|Ga0137360_10965223 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300012361|Ga0137360_11699333 | Not Available | 537 | Open in IMG/M |
| 3300012362|Ga0137361_10308961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1447 | Open in IMG/M |
| 3300012362|Ga0137361_10652128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 963 | Open in IMG/M |
| 3300012362|Ga0137361_10682476 | Not Available | 939 | Open in IMG/M |
| 3300012362|Ga0137361_11178197 | Not Available | 688 | Open in IMG/M |
| 3300012532|Ga0137373_10392304 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300012582|Ga0137358_10308212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1075 | Open in IMG/M |
| 3300012918|Ga0137396_10316564 | Not Available | 1154 | Open in IMG/M |
| 3300012923|Ga0137359_10213788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1722 | Open in IMG/M |
| 3300012923|Ga0137359_10598839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 967 | Open in IMG/M |
| 3300012924|Ga0137413_10160523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1478 | Open in IMG/M |
| 3300012929|Ga0137404_10538938 | Not Available | 1044 | Open in IMG/M |
| 3300012957|Ga0164303_10472569 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 795 | Open in IMG/M |
| 3300012985|Ga0164308_10748512 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300012988|Ga0164306_10788043 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300015264|Ga0137403_10118197 | All Organisms → cellular organisms → Bacteria | 2644 | Open in IMG/M |
| 3300015374|Ga0132255_102536120 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300018027|Ga0184605_10314363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 709 | Open in IMG/M |
| 3300018028|Ga0184608_10136897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1048 | Open in IMG/M |
| 3300018054|Ga0184621_10248140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 635 | Open in IMG/M |
| 3300018469|Ga0190270_10530062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1130 | Open in IMG/M |
| 3300018481|Ga0190271_12703707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 187 | 596 | Open in IMG/M |
| 3300021078|Ga0210381_10393863 | Not Available | 511 | Open in IMG/M |
| 3300022756|Ga0222622_11381181 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300025910|Ga0207684_10136922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2103 | Open in IMG/M |
| 3300025910|Ga0207684_10436167 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300025910|Ga0207684_11298420 | Not Available | 599 | Open in IMG/M |
| 3300025922|Ga0207646_11497578 | Not Available | 584 | Open in IMG/M |
| 3300026304|Ga0209240_1102967 | Not Available | 1017 | Open in IMG/M |
| 3300026310|Ga0209239_1002106 | All Organisms → cellular organisms → Bacteria | 11888 | Open in IMG/M |
| 3300026310|Ga0209239_1176967 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300026319|Ga0209647_1122296 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
| 3300026319|Ga0209647_1122706 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300026490|Ga0257153_1006639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2277 | Open in IMG/M |
| 3300026551|Ga0209648_10111553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2223 | Open in IMG/M |
| 3300026551|Ga0209648_10316315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1104 | Open in IMG/M |
| 3300027748|Ga0209689_1028168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3373 | Open in IMG/M |
| 3300027903|Ga0209488_10199425 | All Organisms → cellular organisms → Bacteria | 1507 | Open in IMG/M |
| 3300027903|Ga0209488_10858783 | Not Available | 639 | Open in IMG/M |
| 3300028708|Ga0307295_10169829 | Not Available | 611 | Open in IMG/M |
| 3300028716|Ga0307311_10156936 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300028768|Ga0307280_10352956 | Not Available | 543 | Open in IMG/M |
| 3300028784|Ga0307282_10104490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1317 | Open in IMG/M |
| 3300028811|Ga0307292_10098312 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300028878|Ga0307278_10004298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → Pelomonas saccharophila | 6876 | Open in IMG/M |
| 3300028878|Ga0307278_10315571 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300028885|Ga0307304_10102802 | Not Available | 1144 | Open in IMG/M |
| 3300032180|Ga0307471_101017088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 996 | Open in IMG/M |
| 3300033551|Ga0247830_10461417 | Not Available | 996 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 52.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.17% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.63% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.63% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.54% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.69% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.85% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.85% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.85% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1002387721 | 3300000364 | Soil | MPNLKLEALMKLRNQVDERLVAVAIGVGVAIALAII |
| F24TB_100170265 | 3300000550 | Soil | MPTLKGMNVEALIKLRNQVDERLLTVAIGVGVGIVLAIIGYL |
| F24TB_104403132 | 3300000550 | Soil | MASLKGMNVEALMKLRVDERLLDVAIGVGGAIALAIIGYL |
| JGI25390J43892_100257332 | 3300002911 | Grasslands Soil | MPNVKGMNVQALMKLQVDERLLAVAIGVGGAIALAIIGYLLHWISS* |
| JGI25616J43925_102855311 | 3300002917 | Grasslands Soil | MPSLKGINVEALMKLRDQVDERVLFVAIGLGVGIALAIIG |
| Ga0066680_109705352 | 3300005174 | Soil | MAARDPTDRRIIMPNLKGMNVEALMKLRNQVDERLLAVAIGVGVGIALAIIGYLLHWISS |
| Ga0066675_106136281 | 3300005187 | Soil | MPNLKGMNVEALMKLRNQVDERLVFAAIGLGVGIALAIIGYLLGWISS* |
| Ga0070708_1004648042 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNLKGMNVEALMKQVDERVLFVAIGLGVGIALAIIGYLLHWISS* |
| Ga0066689_103943011 | 3300005447 | Soil | MANLKGMNVEALMKLRDQVDEGLLGVAIGVGVGIALAIIGYLL |
| Ga0070706_1004262642 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MPTLKGMNVEALMKLRNQVDEWLPTVAIELGVGIALAIIGYLLHWISA* |
| Ga0070706_1007235023 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNLKGMNVEALMKLRNQIDEWGVTVAIGVGVGIALAIIGYLLHLI* |
| Ga0070707_1009823501 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNLKRMNVEALMNLRNQVDERLLFVAIGLGVGIALAIIGYLLHWISS* |
| Ga0066661_108351991 | 3300005554 | Soil | MPSLKGMNVEALMKLRNQVDERLLAVAIGVGVGIALAIIGYLLHWISS* |
| Ga0066661_109057351 | 3300005554 | Soil | MPNVKGMNVQALMKLQVDERLLAVAIGVGGAIALAIIG |
| Ga0066700_103541243 | 3300005559 | Soil | MPNLKGMNVEALMKLRNQVDERLLAVAIGVGVGIALAIIGYLLHWISA* |
| Ga0066699_101697811 | 3300005561 | Soil | MPNLKGMNVEALMKLRNQVDERLLAVAIGVGVGIALAIIGYLLHWISS* |
| Ga0070717_100936566 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNLKGMNVEALMKLRNQVDERLLTVAIGVGVGIALAIIGYLLHWISS* |
| Ga0066652_1020311942 | 3300006046 | Soil | MPNLKGMNVEALMKLRNQVDERLVFAAIGLGVGIALAII |
| Ga0075028_1007424222 | 3300006050 | Watersheds | MPNLKGMNVEALMKLRNQVDERLLFVAIGVGVGIALAIIGYLLHWISS* |
| Ga0066665_112542261 | 3300006796 | Soil | HRRTPCQILNGINIEALRKLRNQVDERLLAVAIGVGVGIALPIIGYLLHWISA* |
| Ga0066659_102250802 | 3300006797 | Soil | MPNLKGMNVEALMKLRNQVDKRLLAVAIGVGVGIALAIIGYLLHWISS* |
| Ga0099829_105395522 | 3300009038 | Vadose Zone Soil | MPSLKGINVEALMKLRDQVDERVLFVAIGLGVGIALAIIGYLLHWISA* |
| Ga0099827_105101581 | 3300009090 | Vadose Zone Soil | MPNLKGMNVEALMKLRNQVDERLLFVAIGLGVGIALAIIGYLLHWISS* |
| Ga0126315_112332251 | 3300010038 | Serpentine Soil | MANLKGMNVEALMKLRNQVDEKFLAVAIGVGGAIALAIIGYLLHWISS* |
| Ga0137392_104135872 | 3300011269 | Vadose Zone Soil | MANLKGMNVEALMNLRNQVDERLLTVAIGVGVAIALAIIGYLLHWISS* |
| Ga0137391_103999623 | 3300011270 | Vadose Zone Soil | MPNLKGMNVEALMKLRNQVDERLLFVAIGLGVGIALAIIGYLLHWISA* |
| Ga0137388_101283104 | 3300012189 | Vadose Zone Soil | MPNLQGMNVEALMKLRNQVDERLLTVAIGLGVGIALAIIGYLLHWISS* |
| Ga0137388_104451213 | 3300012189 | Vadose Zone Soil | MPNLKGMNVEALMKLRNQVDERLLAVAIGVGGAIVLAIIG |
| Ga0137364_104341051 | 3300012198 | Vadose Zone Soil | MNVQALMKLQVDERLLAVAIGVGGAIALAIIGYLLHWISS* |
| Ga0137364_106905662 | 3300012198 | Vadose Zone Soil | MNVEALMKLRDQVDERVLFVAIGLGVGIALTIIGYLLHLISA* |
| Ga0137364_110845122 | 3300012198 | Vadose Zone Soil | MPNPKGINVEALMKLRNQIYERHLAVAIGVGVGIALAIICYLLHWISA* |
| Ga0137383_101244972 | 3300012199 | Vadose Zone Soil | MTINLKGIEALIKHERFVTVAIGVGLGIALAIIGYLLGWISS* |
| Ga0137383_102824182 | 3300012199 | Vadose Zone Soil | MPNLKGMNVEALMNLRDQVDEWLPTVGIGVVVGIALAIIGYLLHLI* |
| Ga0137383_103946622 | 3300012199 | Vadose Zone Soil | MPNLKGMNVEALMKLRDQVDERVLFVAIGLGVGIALAIIGYLLHWISA* |
| Ga0137382_103197112 | 3300012200 | Vadose Zone Soil | MPSLKGINVEALMKLRDQVDERVLFVAIGLGVGIALAIIGYLLHWISA |
| Ga0137382_113248721 | 3300012200 | Vadose Zone Soil | LMKLQVDERLLAVAIGVGGAIALAIIGYLLHWISS* |
| Ga0137365_1001048113 | 3300012201 | Vadose Zone Soil | MPNPKGINVEALMKLRNQIDERHLAVAIGVGVGIALAIIGYLLHLISA* |
| Ga0137365_104033713 | 3300012201 | Vadose Zone Soil | MPNLKGMNLQALTKLQVDERLLAVAIGVGGAIAFSIIGYLLHWISS* |
| Ga0137365_105612551 | 3300012201 | Vadose Zone Soil | MPNLKGINVEALMNLRNQIDERHLALAIGVGVGIALAIIGYLLHWISS* |
| Ga0137365_106427981 | 3300012201 | Vadose Zone Soil | MPNPKGINVEALMKLRNQVDERLLAVAIGVGVGIALAIIGYLLHWISA* |
| Ga0137365_109577961 | 3300012201 | Vadose Zone Soil | RLRNQVDERHLAVAIGIGVGIALTIIGYLLHLISS* |
| Ga0137363_103197452 | 3300012202 | Vadose Zone Soil | MPSLKGMNVEALMKLRNQVDERLLAVAIGVGGAIVLAIIGYLLHLISA* |
| Ga0137363_108105892 | 3300012202 | Vadose Zone Soil | MNFEALMKLRNQVDERLLGVAIGVGVGIALAIIGYLLHLISS* |
| Ga0137363_115274911 | 3300012202 | Vadose Zone Soil | MANLKGMNVEALMKLRNQVDEWLLTVAIGVGVGLALAIIGYLLGWISA* |
| Ga0137374_102761343 | 3300012204 | Vadose Zone Soil | MPNPKGINVEALMKLRNQVDERHLAVAIGVGVGIALAIIGYLLHWISS* |
| Ga0137374_102795352 | 3300012204 | Vadose Zone Soil | MPNLKGMNVEALMRLRNQVDERHLAVAIGVGGAIALTIIGYLLHLIST* |
| Ga0137362_104023771 | 3300012205 | Vadose Zone Soil | MKLRDQVDERLVFAAIGVGVGIALAIIGYLLGWISS* |
| Ga0137362_111737651 | 3300012205 | Vadose Zone Soil | SQSHSRTEEETMTINLKGIEALMKHERFLPVVIGLGVGIALAIIGYLLGWISA* |
| Ga0137380_101291174 | 3300012206 | Vadose Zone Soil | LTQRALPVIMPSLKGMNVEALMKLRNQVDERLLGVAIGVGVGIALAIIGYLLHWISS* |
| Ga0137380_106451972 | 3300012206 | Vadose Zone Soil | MPNLKGINVEALMKLRNQVDERLLAVAIGVGVGIALAIIGYLLHWISA* |
| Ga0137380_108918293 | 3300012206 | Vadose Zone Soil | MPNLKGMNVEALMKLRNQVDERLLGVAIGVGVGIALA |
| Ga0137381_101646071 | 3300012207 | Vadose Zone Soil | IMPNLKGMNVEALMKLRNQVDERLLAVAIGVGVGIALAIIGYLLHWISS* |
| Ga0137376_100610061 | 3300012208 | Vadose Zone Soil | MANLKGMNVEALMKLRNQVDERVLFVAIGVGVGIALAI |
| Ga0137376_107436862 | 3300012208 | Vadose Zone Soil | MPNLKGMNVEALMKLRNQVDERLLTVAIGLGVGIALAIIGYLLHWISS* |
| Ga0137378_111159191 | 3300012210 | Vadose Zone Soil | MKLRNQVDERLLAVAIGVGVGIALAIIGYLLHWISA* |
| Ga0137377_116806852 | 3300012211 | Vadose Zone Soil | MANLKGMNVEALMKLRNQVDERVLFVAIGVGVGIALAIIGYLLHWISS* |
| Ga0137367_101125395 | 3300012353 | Vadose Zone Soil | MNVEALMKLRNQVDERLLTVAIGVGVGIALAIIGYLLHWISS* |
| Ga0137369_104638383 | 3300012355 | Vadose Zone Soil | MPNLKGMNVEALMRLRNQVDERHLAVAIGVGGAIALTIIGYLL |
| Ga0137371_106316472 | 3300012356 | Vadose Zone Soil | MNVEALMKLRNQVDERLLAVAIGVGVGIALAIIGYLLHWISS* |
| Ga0137384_101628362 | 3300012357 | Vadose Zone Soil | MPNPKGINIEALMKLRDQVDERVLFVAIGLGVGIALTIIGYLLHLISA* |
| Ga0137384_103439913 | 3300012357 | Vadose Zone Soil | MPNLKGMNVEALMNLRDQVVEWLPTVGIGVVVGIALAIIGYLLHLI* |
| Ga0137384_106705862 | 3300012357 | Vadose Zone Soil | MPNLKGMNVEALMRLRNQVDERHLAVAIGVGVGIALTISGYLLHLISS* |
| Ga0137368_105079341 | 3300012358 | Vadose Zone Soil | MANLKGINVEPLMKLLNQVDERLLAVAIGVGVAIALAIIGYLLHWISS* |
| Ga0137368_106931351 | 3300012358 | Vadose Zone Soil | MPNLKGMNVEALMKLRNQVDERLLTVAIGVGVGIALAIIGYLLH |
| Ga0137385_110002851 | 3300012359 | Vadose Zone Soil | MPNLKGMNVEALMKLRNQVDERLLTVAIGVGVGIALAIIGYLLGLIGS* |
| Ga0137375_113336662 | 3300012360 | Vadose Zone Soil | LRRRSIMPNLKGMNVEALMRLRNQVDERHLAVAIGVGGAIALTIIGYLLHLIST* |
| Ga0137360_104315801 | 3300012361 | Vadose Zone Soil | MPSLKGMNVEALMKLRDQVDERVFFVAIGLGVGIALAIIGYLLH |
| Ga0137360_108382721 | 3300012361 | Vadose Zone Soil | MTINLKGIEALMKHEGFVTVAIGLGVGIALAIIGYLLGWISS* |
| Ga0137360_109652231 | 3300012361 | Vadose Zone Soil | MNVEALMKLRNQVDERVLFVAIGLGVGIALAIIGYLLHWISS* |
| Ga0137360_116993331 | 3300012361 | Vadose Zone Soil | MPNLKGMNVEALMKLRNQVDERLLGVAIGVGVGIALAIIGYLLHLISS* |
| Ga0137361_103089612 | 3300012362 | Vadose Zone Soil | MPSLKGMNVEALMKLRDQVDERVFFVAIGLGVGIALAIIGYLLHLISS* |
| Ga0137361_106521282 | 3300012362 | Vadose Zone Soil | MPINLKGIEALIKHERLLTVAIGLGVGIALAIIGYLLNWIIS* |
| Ga0137361_106824761 | 3300012362 | Vadose Zone Soil | MPNLKGINVEALMKLRNQVDERHLAVAIGIGVGIALTIIGYLLHWIS |
| Ga0137361_111781972 | 3300012362 | Vadose Zone Soil | MANLKGMNVEALMNLRNQVDERLLTVAIGVGVAIALAIIGYLLHWINSQHFR* |
| Ga0137373_103923043 | 3300012532 | Vadose Zone Soil | MPNLKGMNVEALMKLRNQVDERLLTVAIGVGVGIVLAIIGYLLHWISS* |
| Ga0137358_103082123 | 3300012582 | Vadose Zone Soil | MNVEALMKLRNQVDERLLAVAIGVGGAIVLAIIGYLLHLISA* |
| Ga0137396_103165641 | 3300012918 | Vadose Zone Soil | MPNLKGMNLEALMKLRNQVDERLLAVAIGVGGAIVLAIIGYLLHLISA* |
| Ga0137359_102137883 | 3300012923 | Vadose Zone Soil | MPNLKGMNVEALMKLRNQVDERLLAVAIGVGGAIVLAIIGYLLHLISA* |
| Ga0137359_105988392 | 3300012923 | Vadose Zone Soil | MNVEALMKLRDQVDERVLFVAIGLGVGIALAIIGYLLHWISA* |
| Ga0137413_101605232 | 3300012924 | Vadose Zone Soil | MMQSLKGMNIEALMKLRNQVDERHLSVAIGVGGAIALAIIGYLLQWISS* |
| Ga0137404_105389381 | 3300012929 | Vadose Zone Soil | MNVEALMKLRNQVDEKFLAGAIGVGGAIVLAIIGYLLHWISS* |
| Ga0164303_104725692 | 3300012957 | Soil | MPNLKGMNVEALMKLRNQVDERLLFVAIGLGVGIALAIIGYLLHLISS* |
| Ga0164308_107485121 | 3300012985 | Soil | MKLRNQVDESLLTVAIGVGVAIALAIIGYLLHWISS* |
| Ga0164306_107880432 | 3300012988 | Soil | LKGIEALIKHERLLTVAIGLGVGIALAIIGYLLNWISS* |
| Ga0137403_101181975 | 3300015264 | Vadose Zone Soil | TMTINLKGIEALMKHERFLPVVIGLGVGIALAIIGYLLHWISS* |
| Ga0132255_1025361201 | 3300015374 | Arabidopsis Rhizosphere | MPNLKGVNVEALMKLRNQVDERLLFVAIGLGVGIALAIIGYLLHWISS* |
| Ga0184605_103143632 | 3300018027 | Groundwater Sediment | MPNLKGMNIEALMKLRNQVDERHLSVAIGVGVAIALAIIGYLLQWISS |
| Ga0184608_101368972 | 3300018028 | Groundwater Sediment | MPNLKGMNIEALMKLRNQVDERHLSVAIGVGGAIALAIIGYLLHWISS |
| Ga0184621_102481402 | 3300018054 | Groundwater Sediment | MPNLKGMNIEALMKLRNQVDERHLSVAIGVGVEIALAIIGYLLHWISS |
| Ga0190270_105300622 | 3300018469 | Soil | MANLKGMNIEPLMKLRNQVDERHLSVAIGVGGAIALAIIGYLLHWISS |
| Ga0190271_127037072 | 3300018481 | Soil | MPNLKGMNIEALMKLRNQVDERHLSVAIGVGGAIALAIIGYLLQWISS |
| Ga0210381_103938632 | 3300021078 | Groundwater Sediment | MPNLKGMNVEALMKLRNQVDERHLSVAIGVGGAIALAIIGYLLHWISS |
| Ga0222622_113811811 | 3300022756 | Groundwater Sediment | MPSLKGMNIEALMKLRNQVDERHLSVAIGVGGAIALAIIGYLLQWISS |
| Ga0207684_101369222 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNLKGMNVEALMKLRNQIDEWGVTVAIGVGVGIALAIIGYLLHLI |
| Ga0207684_104361672 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPTLKGMNVEALMKLRNQVDEWLPTVAIELGVGIALAIIGYLLHWISA |
| Ga0207684_112984202 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | IMTINLRGIEALIKHERFVTVAIGLGVGIALAIIGYVLGWISA |
| Ga0207646_114975781 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VEALMNLRNQVDERLLFVAIGLGVGIALAIIGYLLHWISS |
| Ga0209240_11029672 | 3300026304 | Grasslands Soil | MANLKGMNVEALMNLRNQVDERLLTVAIGVGVAIALAIIGYLLHWINSQHFR |
| Ga0209239_10021063 | 3300026310 | Grasslands Soil | MPNVKGMNVQALMKLQVDERLLAVAIGVGGAIALAIIGYLLHWISS |
| Ga0209239_11769672 | 3300026310 | Grasslands Soil | MPNLKGMNVEALLKLRNQVDERLLFVAIGLGVGIALAII |
| Ga0209647_11222962 | 3300026319 | Grasslands Soil | MIINLKGIEALIKHERLLTVAIGLGVGIALAIIGYLLHLISA |
| Ga0209647_11227062 | 3300026319 | Grasslands Soil | MPNLKGMNVEALMKLRNQVDERLLFVAIGLGVGIALAIIGYLLHWISS |
| Ga0257153_10066396 | 3300026490 | Soil | MPSLKGMNVEALMKLRNQVDERLLAVAIGVGGAIFLAIIGYLLHLISA |
| Ga0209648_101115534 | 3300026551 | Grasslands Soil | MPNLTGMNVEALMKLRDQVDERVLFVAIGLGVGIALAIIGYLLHWISA |
| Ga0209648_103163151 | 3300026551 | Grasslands Soil | MANLKGMNVEALMNLRNQVDERLLTVAIGVGVAIAL |
| Ga0209689_10281681 | 3300027748 | Soil | MPNLKGMNVEALMKLRNQVDERLLAVAIGVGVGIALAIIGYLLHWISS |
| Ga0209488_101994252 | 3300027903 | Vadose Zone Soil | MPNLKGMNVEALMKLRNQVDERLLAVAIGVGGAIVLAIIGYLLHLISA |
| Ga0209488_108587832 | 3300027903 | Vadose Zone Soil | MKLRDQVDERLVFAAIGVGVGIALAIIGYLLGWISS |
| Ga0307295_101698291 | 3300028708 | Soil | MPNLKGMNVEALMKLRNQVDERHLSVAIGVGGAIALAIIGYLLQWISS |
| Ga0307311_101569361 | 3300028716 | Soil | IRALRRSIMPNLKGMNVEALMKLRNQVDERHLSVAIGVGGAIALAIIGYLLHWISS |
| Ga0307280_103529563 | 3300028768 | Soil | MPSLKGMNIEALMKLRNQVDERHLAVAIGVDVAIALAIIGYLLQWISS |
| Ga0307282_101044901 | 3300028784 | Soil | PNLKGMNIEALMKLRNQVDERHLSVAIGVGVAIALAIIGYLLQWISS |
| Ga0307292_100983121 | 3300028811 | Soil | EALMKLRNQVDERHLSVAIGVGGAIALAIIGYLLHWISS |
| Ga0307278_100042982 | 3300028878 | Soil | MKLRNQVDERLLAVAIGVGVGIALAIIGYLLHWISS |
| Ga0307278_103155711 | 3300028878 | Soil | MPNLKGINVEALMNLRNQIDERHLALAIGVGVGIALAIIGYLLHWISS |
| Ga0307304_101028023 | 3300028885 | Soil | VEIIMPSLKGMNIEALMKLRNQVDERHLSVAIGVGGAIALAIIGYLLQWISS |
| Ga0307471_1010170882 | 3300032180 | Hardwood Forest Soil | MSSPSLKGMNVEALMKLRDQVDERVFFVAIGLGVGIALAIIGYLLHWISS |
| Ga0247830_104614171 | 3300033551 | Soil | GMNIEALMKLRNQVDERHLGVAIGVGVAIALTIIGYLLQWISS |
| ⦗Top⦘ |