


| Basic Information | |
|---|---|
| Family ID | F075657 |
| Family Type | Metagenome |
| Number of Sequences | 118 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MKVALIWIVWLALVLWWLTPEMNAVKDRINEHNEQIKRIINE |
| Number of Associated Samples | 71 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 86.44 % |
| % of genes near scaffold ends (potentially truncated) | 19.49 % |
| % of genes from short scaffolds (< 2000 bps) | 72.88 % |
| Associated GOLD sequencing projects | 64 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (45.763 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (31.356 % of family members) |
| Environment Ontology (ENVO) | Unclassified (84.746 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (76.271 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 57.14% β-sheet: 0.00% Coil/Unstructured: 42.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF01764 | Lipase_3 | 20.34 |
| PF14235 | DUF4337 | 16.10 |
| PF00768 | Peptidase_S11 | 8.47 |
| PF03721 | UDPG_MGDP_dh_N | 2.54 |
| PF00147 | Fibrinogen_C | 2.54 |
| PF04377 | ATE_C | 1.69 |
| PF01192 | RNA_pol_Rpb6 | 0.85 |
| PF01258 | zf-dskA_traR | 0.85 |
| PF13501 | SoxY | 0.85 |
| PF13394 | Fer4_14 | 0.85 |
| PF00211 | Guanylate_cyc | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 8.47 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 2.54 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 2.54 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 2.54 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 2.54 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 2.54 |
| COG2935 | Arginyl-tRNA--protein-N-Asp/Glu arginylyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 1.69 |
| COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 0.85 |
| COG1758 | DNA-directed RNA polymerase, subunit K/omega | Transcription [K] | 0.85 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 54.24 % |
| Unclassified | root | N/A | 45.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002408|B570J29032_109113607 | Not Available | 599 | Open in IMG/M |
| 3300002408|B570J29032_109514806 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 827 | Open in IMG/M |
| 3300002408|B570J29032_109728078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Cuspidothrix → Cuspidothrix issatschenkoi → Cuspidothrix issatschenkoi CHARLIE-1 | 1147 | Open in IMG/M |
| 3300002835|B570J40625_100215252 | All Organisms → cellular organisms → Bacteria | 2057 | Open in IMG/M |
| 3300002835|B570J40625_100678849 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 926 | Open in IMG/M |
| 3300004481|Ga0069718_11026710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
| 3300005580|Ga0049083_10020055 | Not Available | 2412 | Open in IMG/M |
| 3300005580|Ga0049083_10058387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae | 1357 | Open in IMG/M |
| 3300005580|Ga0049083_10236329 | Not Available | 617 | Open in IMG/M |
| 3300005581|Ga0049081_10195645 | Not Available | 726 | Open in IMG/M |
| 3300005581|Ga0049081_10345507 | Not Available | 505 | Open in IMG/M |
| 3300005582|Ga0049080_10206256 | Not Available | 648 | Open in IMG/M |
| 3300005584|Ga0049082_10214381 | Not Available | 657 | Open in IMG/M |
| 3300005805|Ga0079957_1008123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8146 | Open in IMG/M |
| 3300005805|Ga0079957_1099593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1588 | Open in IMG/M |
| 3300008116|Ga0114350_1044330 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1659 | Open in IMG/M |
| 3300009151|Ga0114962_10013087 | All Organisms → cellular organisms → Bacteria | 6046 | Open in IMG/M |
| 3300009152|Ga0114980_10279578 | Not Available | 971 | Open in IMG/M |
| 3300009155|Ga0114968_10081376 | Not Available | 2012 | Open in IMG/M |
| 3300009155|Ga0114968_10148684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1392 | Open in IMG/M |
| 3300009158|Ga0114977_10378582 | Not Available | 792 | Open in IMG/M |
| 3300009159|Ga0114978_10003965 | Not Available | 12046 | Open in IMG/M |
| 3300009159|Ga0114978_10004944 | Not Available | 10706 | Open in IMG/M |
| 3300009159|Ga0114978_10039005 | All Organisms → cellular organisms → Bacteria | 3344 | Open in IMG/M |
| 3300009159|Ga0114978_10459111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 754 | Open in IMG/M |
| 3300009159|Ga0114978_10653863 | Not Available | 603 | Open in IMG/M |
| 3300009160|Ga0114981_10244563 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 978 | Open in IMG/M |
| 3300009161|Ga0114966_10149287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1523 | Open in IMG/M |
| 3300009163|Ga0114970_10105928 | Not Available | 1735 | Open in IMG/M |
| 3300009164|Ga0114975_10194443 | Not Available | 1148 | Open in IMG/M |
| 3300009164|Ga0114975_10644222 | Not Available | 563 | Open in IMG/M |
| 3300009180|Ga0114979_10172537 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1319 | Open in IMG/M |
| 3300009183|Ga0114974_10014491 | Not Available | 5660 | Open in IMG/M |
| 3300009183|Ga0114974_10223694 | All Organisms → Viruses → Predicted Viral | 1138 | Open in IMG/M |
| 3300009183|Ga0114974_10646832 | Not Available | 579 | Open in IMG/M |
| 3300009184|Ga0114976_10286642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 884 | Open in IMG/M |
| 3300009184|Ga0114976_10515887 | Not Available | 614 | Open in IMG/M |
| 3300010885|Ga0133913_10022216 | Not Available | 16954 | Open in IMG/M |
| 3300010885|Ga0133913_10129031 | Not Available | 6769 | Open in IMG/M |
| 3300010885|Ga0133913_10512210 | Not Available | 3161 | Open in IMG/M |
| 3300010885|Ga0133913_11402608 | Not Available | 1777 | Open in IMG/M |
| 3300010885|Ga0133913_13480506 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1028 | Open in IMG/M |
| 3300013004|Ga0164293_10278389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Cuspidothrix → Cuspidothrix issatschenkoi → Cuspidothrix issatschenkoi CHARLIE-1 | 1169 | Open in IMG/M |
| 3300013004|Ga0164293_10893388 | Not Available | 559 | Open in IMG/M |
| 3300013004|Ga0164293_10946739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Cuspidothrix → Cuspidothrix issatschenkoi → Cuspidothrix issatschenkoi CHARLIE-1 | 540 | Open in IMG/M |
| 3300013005|Ga0164292_10532198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
| 3300013005|Ga0164292_11060785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
| 3300017722|Ga0181347_1042814 | Not Available | 1384 | Open in IMG/M |
| 3300017722|Ga0181347_1084437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae | 921 | Open in IMG/M |
| 3300017774|Ga0181358_1033515 | Not Available | 2000 | Open in IMG/M |
| 3300020141|Ga0211732_1335865 | Not Available | 577 | Open in IMG/M |
| 3300020151|Ga0211736_10456561 | All Organisms → Viruses → Predicted Viral | 1562 | Open in IMG/M |
| 3300020151|Ga0211736_10858147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
| 3300020159|Ga0211734_10178210 | Not Available | 971 | Open in IMG/M |
| 3300020159|Ga0211734_10299021 | Not Available | 524 | Open in IMG/M |
| 3300020160|Ga0211733_10817139 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
| 3300020162|Ga0211735_10095711 | All Organisms → Viruses → Predicted Viral | 2017 | Open in IMG/M |
| 3300020162|Ga0211735_11507824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
| 3300020162|Ga0211735_11607738 | Not Available | 1012 | Open in IMG/M |
| 3300020183|Ga0194115_10013896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6968 | Open in IMG/M |
| 3300020205|Ga0211731_10066864 | Not Available | 565 | Open in IMG/M |
| 3300020205|Ga0211731_11272237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
| 3300020527|Ga0208232_1028921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Cuspidothrix → Cuspidothrix issatschenkoi → Cuspidothrix issatschenkoi CHARLIE-1 | 761 | Open in IMG/M |
| 3300020548|Ga0208856_1031184 | Not Available | 736 | Open in IMG/M |
| 3300020574|Ga0208221_1077061 | Not Available | 596 | Open in IMG/M |
| 3300021519|Ga0194048_10185311 | Not Available | 774 | Open in IMG/M |
| 3300021961|Ga0222714_10491018 | Not Available | 632 | Open in IMG/M |
| 3300021963|Ga0222712_10374873 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 871 | Open in IMG/M |
| 3300023174|Ga0214921_10072754 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2788 | Open in IMG/M |
| 3300023179|Ga0214923_10038325 | Not Available | 3857 | Open in IMG/M |
| 3300023184|Ga0214919_10000852 | Not Available | 51784 | Open in IMG/M |
| 3300023184|Ga0214919_10004006 | Not Available | 21740 | Open in IMG/M |
| 3300023184|Ga0214919_10034006 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5229 | Open in IMG/M |
| 3300023184|Ga0214919_10084582 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2782 | Open in IMG/M |
| 3300023184|Ga0214919_10164416 | Not Available | 1734 | Open in IMG/M |
| 3300023184|Ga0214919_10641151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
| 3300023184|Ga0214919_10737496 | Not Available | 550 | Open in IMG/M |
| 3300023184|Ga0214919_10796146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
| 3300027608|Ga0208974_1001303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9823 | Open in IMG/M |
| 3300027627|Ga0208942_1107546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 787 | Open in IMG/M |
| 3300027649|Ga0208960_1121119 | Not Available | 682 | Open in IMG/M |
| 3300027733|Ga0209297_1227246 | Not Available | 726 | Open in IMG/M |
| 3300027749|Ga0209084_1062408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1746 | Open in IMG/M |
| 3300027754|Ga0209596_1041174 | Not Available | 2497 | Open in IMG/M |
| 3300027756|Ga0209444_10078074 | Not Available | 1408 | Open in IMG/M |
| 3300027756|Ga0209444_10153207 | Not Available | 880 | Open in IMG/M |
| 3300027759|Ga0209296_1086623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1529 | Open in IMG/M |
| 3300027759|Ga0209296_1161511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 996 | Open in IMG/M |
| 3300027759|Ga0209296_1324484 | Not Available | 603 | Open in IMG/M |
| 3300027763|Ga0209088_10244046 | Not Available | 749 | Open in IMG/M |
| 3300027782|Ga0209500_10004308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9458 | Open in IMG/M |
| 3300027782|Ga0209500_10015200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4605 | Open in IMG/M |
| 3300027969|Ga0209191_1046345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2008 | Open in IMG/M |
| 3300031758|Ga0315907_10011116 | Not Available | 8892 | Open in IMG/M |
| 3300031758|Ga0315907_10127334 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2170 | Open in IMG/M |
| 3300031951|Ga0315904_10532684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1028 | Open in IMG/M |
| 3300033992|Ga0334992_0129309 | All Organisms → Viruses → Predicted Viral | 1320 | Open in IMG/M |
| 3300033996|Ga0334979_0263217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Cuspidothrix → Cuspidothrix issatschenkoi → Cuspidothrix issatschenkoi CHARLIE-1 | 992 | Open in IMG/M |
| 3300034021|Ga0335004_0435897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
| 3300034062|Ga0334995_0363503 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 921 | Open in IMG/M |
| 3300034062|Ga0334995_0787278 | Not Available | 523 | Open in IMG/M |
| 3300034071|Ga0335028_0019887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4678 | Open in IMG/M |
| 3300034082|Ga0335020_0350077 | Not Available | 717 | Open in IMG/M |
| 3300034082|Ga0335020_0411763 | Not Available | 650 | Open in IMG/M |
| 3300034093|Ga0335012_0031707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3106 | Open in IMG/M |
| 3300034093|Ga0335012_0144364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Cuspidothrix → Cuspidothrix issatschenkoi → Cuspidothrix issatschenkoi CHARLIE-1 | 1299 | Open in IMG/M |
| 3300034093|Ga0335012_0354601 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 729 | Open in IMG/M |
| 3300034095|Ga0335022_0272825 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 973 | Open in IMG/M |
| 3300034101|Ga0335027_0171531 | All Organisms → Viruses → Predicted Viral | 1570 | Open in IMG/M |
| 3300034101|Ga0335027_0840282 | Not Available | 528 | Open in IMG/M |
| 3300034102|Ga0335029_0021691 | All Organisms → cellular organisms → Bacteria | 4880 | Open in IMG/M |
| 3300034102|Ga0335029_0677637 | Not Available | 563 | Open in IMG/M |
| 3300034106|Ga0335036_0779847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
| 3300034117|Ga0335033_0242607 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 951 | Open in IMG/M |
| 3300034122|Ga0335060_0308684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 863 | Open in IMG/M |
| 3300034166|Ga0335016_0764950 | Not Available | 505 | Open in IMG/M |
| 3300034279|Ga0335052_0193609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Cuspidothrix → Cuspidothrix issatschenkoi → Cuspidothrix issatschenkoi CHARLIE-1 | 1174 | Open in IMG/M |
| 3300034283|Ga0335007_0014058 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6361 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 31.36% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 30.51% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.32% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 8.47% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 4.24% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.39% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.39% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.54% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.69% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.69% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.85% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.85% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.85% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020548 | Freshwater microbial communities from Lake Mendota, WI - 13JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020574 | Freshwater microbial communities from Lake Mendota, WI - 26JUN2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027649 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
| 3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29032_1091136072 | 3300002408 | Freshwater | MRVALIWIIWLALVLWWLTPEMNSVKDQINEHNEQIKRIINE* |
| B570J29032_1095148062 | 3300002408 | Freshwater | MKVILIWIVWLGLVLYWLTPEMNSVKDRINEHNEQIKRIINE* |
| B570J29032_1097280782 | 3300002408 | Freshwater | MKIAIIWIVWLGLVLYWLTPEMNSVKDRINEHNEQIKRALNE* |
| B570J40625_1002152522 | 3300002835 | Freshwater | MKVAIIWIIWLALVLWWLTPEMNSVKDKINEHNEQIKRIINE* |
| B570J40625_1006788492 | 3300002835 | Freshwater | MDATMKILVIWCVWLALVLWWLTPELNHVRDQINEHNEQIRRALNE* |
| Ga0069718_110267102 | 3300004481 | Sediment | MDAPMRVALIWCAWLASVLWWLTPELNHVRDQINEHNEQVRKAINE* |
| Ga0049083_100200552 | 3300005580 | Freshwater Lentic | MRVALIWIIWLALVLWWLSPGFDGVRDNVSEHNTQIERTINE* |
| Ga0049083_100583871 | 3300005580 | Freshwater Lentic | MRVALIWILWLALVVWWLSSGFDGVRDNVTEHNAQIERTINE* |
| Ga0049083_102363292 | 3300005580 | Freshwater Lentic | MRVALIWIVWLALVLWWLTPELNEIKDKINEHNAQIERTINE* |
| Ga0049081_101956452 | 3300005581 | Freshwater Lentic | MKVVLIWIVWLALVLWWLTPELNEIKDNINEHTAQIEKTINE* |
| Ga0049081_103455072 | 3300005581 | Freshwater Lentic | MRVAVIWIVWLALVLWWLTPELNSVKDKINEHTAQIEKTINE* |
| Ga0049080_102062562 | 3300005582 | Freshwater Lentic | MRVALIWIVWLALVLWWLTPELNEIKDNINEHAAQIEKTINE* |
| Ga0049082_102143812 | 3300005584 | Freshwater Lentic | MRVALIWIIWLALVLWWLSPGFDGIRDNVTEHNTQI |
| Ga0079957_10081238 | 3300005805 | Lake | MRLVIIWIVWLALVVWWLSPSIEGVRDRINEHNAQIEKTLNE* |
| Ga0079957_10995932 | 3300005805 | Lake | MDAFMKTIVIWGVWLALVLWWLTPEINHVKDKINEHTTQIEKALNE* |
| Ga0114350_10443302 | 3300008116 | Freshwater, Plankton | MKTIVIWGIWLALVLWWLTPEINHVKDKINEHTTQIEKALNE* |
| Ga0114962_100130877 | 3300009151 | Freshwater Lake | MRVAIIWIIWLALVLWWLSPEMNEIKDNINEHNAQIGKTFNE* |
| Ga0114980_102795783 | 3300009152 | Freshwater Lake | MRVAIIWIIWLALVVWWLSPEMNEIKDNINTHNAQIEKTFNE* |
| Ga0114968_100813764 | 3300009155 | Freshwater Lake | MRVAIIWIIWLALVVWWLSPEMNEIKDNINEHNAQIERTINE* |
| Ga0114968_101486844 | 3300009155 | Freshwater Lake | MRVAIIWIIWLALVVWWLSPEMNEIKDNINEHNAQIEKTINE* |
| Ga0114977_103785822 | 3300009158 | Freshwater Lake | MRVALIWIVWLALVLWWLTPEMNEIKDNINAHNAQIEKTFNE* |
| Ga0114978_1000396517 | 3300009159 | Freshwater Lake | MRVALIWLVWLALVLWWLTPEMNEMKDNINKHNAQIEKTFNE* |
| Ga0114978_1000494414 | 3300009159 | Freshwater Lake | MRVALIWIVWLALVLWWLTPEMNEIKDNINEHNAQIERALHE* |
| Ga0114978_100390053 | 3300009159 | Freshwater Lake | MKVVLIWCVWLALVLWWLTPEMNEIKDNINEHNEQIKRIINE* |
| Ga0114978_104591113 | 3300009159 | Freshwater Lake | MKIALIWIVWLALVLWWLTPEMNEIKDNINTHNAQIE |
| Ga0114978_106538631 | 3300009159 | Freshwater Lake | MRVALIWIVWLALVLWWLTPEMNEIKDNINTHNAQIEKTFNE* |
| Ga0114981_102445632 | 3300009160 | Freshwater Lake | MKVALIWIIWLALVLWWLTPEMNEIKDNINDHNEQIKRAINE* |
| Ga0114966_101492874 | 3300009161 | Freshwater Lake | WIIWLALVVWWLSPEMNEIKDNINEHNAQIEKTINE* |
| Ga0114970_101059285 | 3300009163 | Freshwater Lake | MRVAIIWIIWLALVVWWLSPEMNEIKDNINEHNAQIARTINE* |
| Ga0114975_101944434 | 3300009164 | Freshwater Lake | MRVAIIWIIWLALVVWWLSPEMNEIKDNINEHNAQIGKTFNE* |
| Ga0114975_106442222 | 3300009164 | Freshwater Lake | MKVVLIWCVWLALVLWWLTPEMNEIKDNINKHNAQIEKTFNE* |
| Ga0114979_101725373 | 3300009180 | Freshwater Lake | MKVVLIWIVWLALVLWWLTPEMNEIKDNINEHNEQIKRIINE* |
| Ga0114974_1001449110 | 3300009183 | Freshwater Lake | MKVALIWLVWLALVLWWLTPEMNEIKDNINKHNAQIERALHE* |
| Ga0114974_102236943 | 3300009183 | Freshwater Lake | MKIALIWIVWLALVLWWLTPEMNEIKDNINKHNAQIEKTFNE* |
| Ga0114974_106468322 | 3300009183 | Freshwater Lake | MKVALIWLVWLALVLWWLTPEMNEIKDNINKHNAQIEKTFNE* |
| Ga0114976_102866421 | 3300009184 | Freshwater Lake | STGMRVAIIWIIWLALVLWWLSPEMNEIKDNINEHNEQIKRIINE* |
| Ga0114976_105158871 | 3300009184 | Freshwater Lake | NATRFIIMDATMKIALIWIVWLALVLWWLTPEMNEIKDNINTHNAQIEKTFNE* |
| Ga0133913_100222168 | 3300010885 | Freshwater Lake | MKVAIIWIIWLALVVWWLSPEVDDIRERVTEHNTQIERTINE* |
| Ga0133913_101290313 | 3300010885 | Freshwater Lake | MKVALIWIVWLALVLWWLTPEMNAVKDRINEHNEQIKRIINE* |
| Ga0133913_105122107 | 3300010885 | Freshwater Lake | MRVALIWIVWLALVLWWLTPEMNEIKDNINDHNEQIKRAINE* |
| Ga0133913_114026082 | 3300010885 | Freshwater Lake | MKVVLIWIVWLGLVLYWLTPEMNSVKDRINEHNEQIKRIINE* |
| Ga0133913_134805061 | 3300010885 | Freshwater Lake | IVWLALVLWWLTPEMNEIKDNINEHNAQIERALHE* |
| Ga0164293_102783892 | 3300013004 | Freshwater | MRIAIIWIVWLGLVLYWLTPEMNSVKDRINEHNEQIKRALNE* |
| Ga0164293_108933882 | 3300013004 | Freshwater | MKVVLIWIIWLGLVLYWLTPEMNAVKDRINEHNEQIKRIINE* |
| Ga0164293_109467392 | 3300013004 | Freshwater | MKVAIIWIVWLGLVLYWLTPEMNSVKDKINEHNAQIKRIINE* |
| Ga0164292_105321982 | 3300013005 | Freshwater | MKTLVIWCAWLALVLWWLTPELNHVRDQINEHNEQIKRDLNE* |
| Ga0164292_110607852 | 3300013005 | Freshwater | MDATMKVVVIWIIWLGLVLYWLTPEMNSVKDRINEHNEQIKRALNE* |
| Ga0181347_10428145 | 3300017722 | Freshwater Lake | MRVALIWIIWLALVLWWLSPGFDGIRDNVTEHNAQIERTIN |
| Ga0181347_10844372 | 3300017722 | Freshwater Lake | MRVALIWILWLALVLWWLSPGFDGVRDNVTEHNTQIERTINE |
| Ga0181358_10335154 | 3300017774 | Freshwater Lake | MRVALIWIIWLALVLWWLSPGFDGIRDNVTEHNTQIERTINE |
| Ga0211732_13358652 | 3300020141 | Freshwater | MKVALIWIVWLALVLWWLTPELNEIKDNINEHTAQIERTINE |
| Ga0211736_104565614 | 3300020151 | Freshwater | IWIVWLGLVLYWLTPEMNSVKDRINEHNEQIKRIINE |
| Ga0211736_108581471 | 3300020151 | Freshwater | IWIVWLGLVLYWLTPEMNSVKDRINEHNEQIKRALNE |
| Ga0211734_101782102 | 3300020159 | Freshwater | MKVALIWIIWLGLVLYWLTPELNEIKDNINEHTAQIEKTFNE |
| Ga0211734_102990211 | 3300020159 | Freshwater | SEWTIMKVAIIWIIWLALVLWWLTPEMNSVKDQINDHNEQIKRIINE |
| Ga0211733_108171391 | 3300020160 | Freshwater | MKVVVIWCVWLALVLWWLTPEMNSVKDRINDHNEQIKRIINER |
| Ga0211735_100957111 | 3300020162 | Freshwater | VGLNRSKWTIMKVAIIWIIWLALVLWWLTPEMNSVKDRINEHNEQIKRIINE |
| Ga0211735_115078243 | 3300020162 | Freshwater | MKIALIWLVWLALVLWWLTPELNEIKDNINEHTAQIEKTFNE |
| Ga0211735_116077382 | 3300020162 | Freshwater | MRVALIWIVWLALVLWWLTPELNEIKDNINEHTAQIEKTINE |
| Ga0194115_100138965 | 3300020183 | Freshwater Lake | MRTIVIWAVWLALVLWWLTPELNHVRDQINEHNAQIKRILDE |
| Ga0211731_100668642 | 3300020205 | Freshwater | MRVALIWIVWLALVLWWLTPEMNEIKDNINEHTAQIEKTFNE |
| Ga0211731_112722372 | 3300020205 | Freshwater | MDAIMKVVVIWCVWLALVLWWLTPEMNAVKDRINEHNEQIKRII |
| Ga0208232_10289212 | 3300020527 | Freshwater | MKVAIIWIIWLALVLWWLTPEMNSVKDKINEHNEQIKRIINE |
| Ga0208856_10311842 | 3300020548 | Freshwater | MKVILIWIVWLGLVLYWLTPEMNSVKDRINEHNEQIKRIINE |
| Ga0208221_10770612 | 3300020574 | Freshwater | MKVAIIWIIWLALVLWWLTPEMNSVKDKINEHNEQIKRAINE |
| Ga0194048_101853112 | 3300021519 | Anoxic Zone Freshwater | MKIALIWIVWLALVLWWLSPEFETVRDKVSEHNAQIEKTFNE |
| Ga0222714_104910181 | 3300021961 | Estuarine Water | MDAFMKTIVIWVIWLALVLWWLTPEINHVKDKINEHTTQIERALNE |
| Ga0222712_103748733 | 3300021963 | Estuarine Water | MKVVLIWIVWLGLVLYWLTPEMNSVKDRINEHNEQIKRALNE |
| Ga0214921_100727547 | 3300023174 | Freshwater | MDAPMKIALIWIIWLALVLWWLSPEMNEIKDNINEHNAQIGKTFNE |
| Ga0214923_100383254 | 3300023179 | Freshwater | MRVAIIWIIWLALVVWWLSPEMNEIKDNINEHNAQIERTINE |
| Ga0214919_1000085221 | 3300023184 | Freshwater | MKIALIWIIWLALVLWWLSPEMNEIKDNINEHNAQIGKTFNE |
| Ga0214919_100040065 | 3300023184 | Freshwater | MRIIVIWAVWLALVLWWLTPELNHVRDQINEHNVAIKKALEE |
| Ga0214919_100340063 | 3300023184 | Freshwater | MKNILIWTVWLALVLWWLTPEMNAVKDKINEHNALIERTLHE |
| Ga0214919_100845823 | 3300023184 | Freshwater | MKIALIWIVWLALVLWWLSPEFETIRDKVSEHNAQIEKTFNE |
| Ga0214919_101644163 | 3300023184 | Freshwater | MRVAIIWIIWLALVVWWLSPEMNEIKDNINAHNTQIERTLHE |
| Ga0214919_106411511 | 3300023184 | Freshwater | LIWAVWLALVLWWLTPELNHVRDQINEHNAVIKKALEE |
| Ga0214919_107374961 | 3300023184 | Freshwater | MRVAIIWIIWLALVVWWLSPEMNEIKDNINEHNAQIARTINE |
| Ga0214919_107961462 | 3300023184 | Freshwater | MKIALIWIVWLALVVWWLSPEVDGIRDNVTEHNAQIERTINE |
| Ga0208974_100130315 | 3300027608 | Freshwater Lentic | MKVVLIWIVWLALVLWWLTPELNEIKDNINEHTAQIEKTINE |
| Ga0208942_11075463 | 3300027627 | Freshwater Lentic | MRVALIWILWLAIVLWWLSPGFDGVRDNVTEHNTQIERTINE |
| Ga0208960_11211192 | 3300027649 | Freshwater Lentic | MRVALIWILWLALVLWWLSPGFDGVRDNVTEHNAQIERTINE |
| Ga0209297_12272462 | 3300027733 | Freshwater Lake | MKVVLIWCVWLALVLWWLTPEMNEIKDNINKHNAQIEKTFNE |
| Ga0209084_10624083 | 3300027749 | Freshwater Lake | MRVAIIWIIWLALVLWWLSPEMNEIKDNINEHNAQIGKTFNE |
| Ga0209596_10411743 | 3300027754 | Freshwater Lake | MRVAIIWIIWLALVVWWLSPEMNEIKDNINEHNAQIEKTINE |
| Ga0209444_100780744 | 3300027756 | Freshwater Lake | MRVALIWIIWLALVLWWLSPGFDGIRDNVTEHNTQIERTIN |
| Ga0209444_101532072 | 3300027756 | Freshwater Lake | MRVALIWIVWLALVLWWLSPGFDGIRDNVTEHNTQIERTIN |
| Ga0209296_10866233 | 3300027759 | Freshwater Lake | MKVALIWLVWLALVLWWLTPEMNEIKDNINKHNAQIERALHE |
| Ga0209296_11615112 | 3300027759 | Freshwater Lake | MDATMKIALIWIVWLALVLWWLTPEMNEIKDNINKHNAQIEKTFNE |
| Ga0209296_13244843 | 3300027759 | Freshwater Lake | MRVALIWLVWLALVLWWLTPEMNEMKDNINKHNAQIEKTFNE |
| Ga0209088_102440462 | 3300027763 | Freshwater Lake | MRVAIIWIIWLALVVWWLSPEMNEIKDNINEHNAQIGKTFNE |
| Ga0209500_1000430811 | 3300027782 | Freshwater Lake | MRVALIWIVWLALVLWWLTPEMNEIKDNINEHNAQIERALHE |
| Ga0209500_100152003 | 3300027782 | Freshwater Lake | MKVVLIWCVWLALVLWWLTPEMNEIKDNINEHNEQIKRIINE |
| Ga0209191_10463453 | 3300027969 | Freshwater Lake | MRVAIIWIIWLALVVWWLSPEMNEIKDNINEHNAQIERALHE |
| Ga0315907_100111169 | 3300031758 | Freshwater | MRVTVIWIVWLALVLWWLTPELNHVKDKINERSTQIERTLNE |
| Ga0315907_101273344 | 3300031758 | Freshwater | MKTIVIWGIWLALVLWWLTPEINHVKDKINEHTTQIEKALNE |
| Ga0315904_105326842 | 3300031951 | Freshwater | MDATMKTIVIWGIWLALVLWWLTPEINHVKDKINEHTTQIEKALNE |
| Ga0334992_0129309_339_467 | 3300033992 | Freshwater | MKIAIIWIVWLGLVLYWLTPEMNSVKDRINEHNEQIKRALNE |
| Ga0334979_0263217_451_579 | 3300033996 | Freshwater | MKVAIIWIVWLGLVLYWLTPEMNSVKDKINEHNAQIKRIINE |
| Ga0335004_0435897_45_203 | 3300034021 | Freshwater | MGFNRSEWTIMKVAIIWIIWLALVLWWLTPEMNSVKDKINEHNEQIKRIINE |
| Ga0334995_0363503_56_196 | 3300034062 | Freshwater | MDATMKVALIWIIWLGLVLYWLTPEMNAVKDQINEHNEQIKRAINE |
| Ga0334995_0787278_273_413 | 3300034062 | Freshwater | MDATMKVVVIWCVWLGLVLYWLTPEMNSVKDRINEHNEQIKRIINE |
| Ga0335028_0019887_2137_2265 | 3300034071 | Freshwater | MKIAIIWIIWLGLVLYWLSPEMNAVKDRINEHNEQIKRIINE |
| Ga0335020_0350077_211_339 | 3300034082 | Freshwater | MKVAIIWIVWLALVLWWLTPEMNSVKDRINEHNEEIKRIINE |
| Ga0335020_0411763_134_262 | 3300034082 | Freshwater | MKVVVIWCVWLALVLWWLTPEMNSVKDRINEHNEQIKRIINE |
| Ga0335012_0031707_2_133 | 3300034093 | Freshwater | IMKVAITWIIWLALVLWWLTPEMNAVKDRINEHNEQIKRIINE |
| Ga0335012_0144364_167_295 | 3300034093 | Freshwater | MKIAIIWIIWLGLVLYWLTPEMNAVKDRINEHNEQIKRALNE |
| Ga0335012_0354601_437_565 | 3300034093 | Freshwater | MKVIVIWCVWLGLVLYWLTPEMNAVKDRINEHNEQIKRIINE |
| Ga0335022_0272825_842_973 | 3300034095 | Freshwater | IMKIAIIWIVWLGLVLYWLTPEMNSVKDRINEHNEQIKRALNE |
| Ga0335027_0171531_249_377 | 3300034101 | Freshwater | MKVVLIWIVWLALVLWWLTPEMNSVKDRINEHNEQIKRIINE |
| Ga0335027_0840282_78_218 | 3300034101 | Freshwater | MDATMKILVIWCVWLALVLWWLTPELNHVRDQINEHNEQIRRALNE |
| Ga0335029_0021691_3658_3786 | 3300034102 | Freshwater | MRVALIWIIWLALVLWWLTPEMNSVKDQINEHNEQIKRIINE |
| Ga0335029_0677637_294_434 | 3300034102 | Freshwater | MDATMKVVLIWIVWLGLVLYWLTPEMNAVKDRINEHNEQIKRIINE |
| Ga0335036_0779847_437_556 | 3300034106 | Freshwater | AIIWIIWLALVLWWLTPEMNSVKDKINEHNEQIKRIINE |
| Ga0335033_0242607_179_319 | 3300034117 | Freshwater | MDAIMKVAIIWIVWLGLVLYWLTPEMNSVKDRINEHNEQIKRALNE |
| Ga0335060_0308684_729_863 | 3300034122 | Freshwater | TIMKIAIIWIVWLGLVLYWLTPEMNSVKDRINEHNEQIKRALNE |
| Ga0335016_0764950_3_119 | 3300034166 | Freshwater | VIWCVWLALVLWWLTPELNHVRDQINEHNEQIRRALNE |
| Ga0335052_0193609_1058_1174 | 3300034279 | Freshwater | MKIAIIWIVWLGLVLYWLTPEMNSVKDRINEHNEQIKRA |
| Ga0335007_0014058_4202_4342 | 3300034283 | Freshwater | MDATMKVVLIWIVWLGLVLYWLTPEMNAVKDRINEHNEQIKRTLNE |
| ⦗Top⦘ |