


| Basic Information | |
|---|---|
| Family ID | F075387 |
| Family Type | Metagenome |
| Number of Sequences | 119 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MGVWKRARVFNWELMFWISSLILAFMAVGALLAYQSFMRAR |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 86.55 % |
| % of genes near scaffold ends (potentially truncated) | 21.85 % |
| % of genes from short scaffolds (< 2000 bps) | 72.27 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (56.303 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.286 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.496 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (51.261 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.07% β-sheet: 0.00% Coil/Unstructured: 44.93% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF14378 | PAP2_3 | 2.52 |
| PF04357 | TamB | 1.68 |
| PF07650 | KH_2 | 1.68 |
| PF07238 | PilZ | 1.68 |
| PF04952 | AstE_AspA | 1.68 |
| PF04679 | DNA_ligase_A_C | 1.68 |
| PF00069 | Pkinase | 1.68 |
| PF00072 | Response_reg | 0.84 |
| PF14805 | THDPS_N_2 | 0.84 |
| PF02627 | CMD | 0.84 |
| PF01145 | Band_7 | 0.84 |
| PF05016 | ParE_toxin | 0.84 |
| PF13276 | HTH_21 | 0.84 |
| PF03705 | CheR_N | 0.84 |
| PF13578 | Methyltransf_24 | 0.84 |
| PF00155 | Aminotran_1_2 | 0.84 |
| PF14659 | Phage_int_SAM_3 | 0.84 |
| PF00535 | Glycos_transf_2 | 0.84 |
| PF13620 | CarboxypepD_reg | 0.84 |
| PF00589 | Phage_integrase | 0.84 |
| PF01850 | PIN | 0.84 |
| PF00248 | Aldo_ket_red | 0.84 |
| PF13414 | TPR_11 | 0.84 |
| PF13175 | AAA_15 | 0.84 |
| PF00871 | Acetate_kinase | 0.84 |
| PF12704 | MacB_PCD | 0.84 |
| PF00551 | Formyl_trans_N | 0.84 |
| PF07883 | Cupin_2 | 0.84 |
| PF08240 | ADH_N | 0.84 |
| PF07593 | UnbV_ASPIC | 0.84 |
| PF01047 | MarR | 0.84 |
| PF12710 | HAD | 0.84 |
| PF12867 | DinB_2 | 0.84 |
| PF03466 | LysR_substrate | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 6.72 |
| COG1352 | Methylase of chemotaxis methyl-accepting proteins | Signal transduction mechanisms [T] | 1.68 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 1.68 |
| COG2911 | Phospholipid transport to the outer membrane protein TamB | Cell wall/membrane/envelope biogenesis [M] | 1.68 |
| COG0282 | Acetate kinase | Energy production and conversion [C] | 0.84 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.84 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.84 |
| COG3426 | Butyrate kinase | Energy production and conversion [C] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 56.30 % |
| Unclassified | root | N/A | 43.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16894253 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3777 | Open in IMG/M |
| 2088090014|GPIPI_16939934 | All Organisms → cellular organisms → Bacteria | 1634 | Open in IMG/M |
| 2088090014|GPIPI_16993339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 32969 | Open in IMG/M |
| 2088090014|GPIPI_17370766 | Not Available | 1494 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101495840 | Not Available | 1198 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101939631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1863 | Open in IMG/M |
| 3300000559|F14TC_100040558 | All Organisms → cellular organisms → Bacteria | 3740 | Open in IMG/M |
| 3300000955|JGI1027J12803_100107147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7610 | Open in IMG/M |
| 3300001431|F14TB_104129872 | All Organisms → cellular organisms → Bacteria | 2369 | Open in IMG/M |
| 3300004156|Ga0062589_100160841 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1558 | Open in IMG/M |
| 3300004479|Ga0062595_101467465 | Not Available | 626 | Open in IMG/M |
| 3300004479|Ga0062595_101688109 | Not Available | 595 | Open in IMG/M |
| 3300004633|Ga0066395_10003424 | All Organisms → cellular organisms → Bacteria | 5491 | Open in IMG/M |
| 3300005330|Ga0070690_101677320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300005332|Ga0066388_100090393 | All Organisms → cellular organisms → Bacteria | 3482 | Open in IMG/M |
| 3300005332|Ga0066388_100162569 | All Organisms → cellular organisms → Bacteria | 2824 | Open in IMG/M |
| 3300005332|Ga0066388_100391843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2035 | Open in IMG/M |
| 3300005332|Ga0066388_101251811 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300005332|Ga0066388_101864658 | Not Available | 1072 | Open in IMG/M |
| 3300005367|Ga0070667_101000144 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300005440|Ga0070705_101122643 | Not Available | 644 | Open in IMG/M |
| 3300005466|Ga0070685_10094157 | Not Available | 1819 | Open in IMG/M |
| 3300005467|Ga0070706_100116423 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2489 | Open in IMG/M |
| 3300005468|Ga0070707_100025474 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5611 | Open in IMG/M |
| 3300005518|Ga0070699_100249003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1587 | Open in IMG/M |
| 3300005526|Ga0073909_10010020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2865 | Open in IMG/M |
| 3300005526|Ga0073909_10413288 | Not Available | 638 | Open in IMG/M |
| 3300005539|Ga0068853_100199586 | Not Available | 1820 | Open in IMG/M |
| 3300005548|Ga0070665_100050900 | All Organisms → cellular organisms → Bacteria | 4156 | Open in IMG/M |
| 3300005548|Ga0070665_100180564 | Not Available | 2111 | Open in IMG/M |
| 3300005548|Ga0070665_102236286 | Not Available | 550 | Open in IMG/M |
| 3300005552|Ga0066701_10304378 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 988 | Open in IMG/M |
| 3300005559|Ga0066700_10044879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2683 | Open in IMG/M |
| 3300005586|Ga0066691_10773837 | Not Available | 566 | Open in IMG/M |
| 3300005764|Ga0066903_100522836 | All Organisms → cellular organisms → Bacteria | 2021 | Open in IMG/M |
| 3300005764|Ga0066903_103270116 | Not Available | 876 | Open in IMG/M |
| 3300005842|Ga0068858_102434141 | Not Available | 517 | Open in IMG/M |
| 3300005843|Ga0068860_100899461 | Not Available | 901 | Open in IMG/M |
| 3300006031|Ga0066651_10483153 | Not Available | 656 | Open in IMG/M |
| 3300006163|Ga0070715_10070224 | Not Available | 1563 | Open in IMG/M |
| 3300006173|Ga0070716_100131451 | Not Available | 1583 | Open in IMG/M |
| 3300006175|Ga0070712_100842771 | Not Available | 788 | Open in IMG/M |
| 3300006175|Ga0070712_100888337 | Not Available | 768 | Open in IMG/M |
| 3300006237|Ga0097621_100023513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4799 | Open in IMG/M |
| 3300006854|Ga0075425_100028697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6158 | Open in IMG/M |
| 3300006854|Ga0075425_100699357 | Not Available | 1164 | Open in IMG/M |
| 3300006854|Ga0075425_101686748 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300006871|Ga0075434_100213692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1949 | Open in IMG/M |
| 3300006914|Ga0075436_101299794 | Not Available | 550 | Open in IMG/M |
| 3300007076|Ga0075435_101099152 | Not Available | 695 | Open in IMG/M |
| 3300009038|Ga0099829_10017047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4895 | Open in IMG/M |
| 3300009038|Ga0099829_10211925 | All Organisms → cellular organisms → Bacteria | 1571 | Open in IMG/M |
| 3300009101|Ga0105247_10258957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1192 | Open in IMG/M |
| 3300009792|Ga0126374_10091829 | All Organisms → cellular organisms → Bacteria | 1695 | Open in IMG/M |
| 3300010043|Ga0126380_11595424 | Not Available | 582 | Open in IMG/M |
| 3300010046|Ga0126384_10969788 | Not Available | 772 | Open in IMG/M |
| 3300010047|Ga0126382_10339730 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1145 | Open in IMG/M |
| 3300010358|Ga0126370_11326372 | Not Available | 676 | Open in IMG/M |
| 3300010359|Ga0126376_10794686 | Not Available | 923 | Open in IMG/M |
| 3300010362|Ga0126377_13359330 | Not Available | 517 | Open in IMG/M |
| 3300010366|Ga0126379_10521196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1264 | Open in IMG/M |
| 3300010400|Ga0134122_11061022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 799 | Open in IMG/M |
| 3300011270|Ga0137391_10881600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300011271|Ga0137393_10231570 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1565 | Open in IMG/M |
| 3300012202|Ga0137363_10913297 | Not Available | 745 | Open in IMG/M |
| 3300012205|Ga0137362_10063376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3044 | Open in IMG/M |
| 3300012205|Ga0137362_10627494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 926 | Open in IMG/M |
| 3300012209|Ga0137379_10861173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 811 | Open in IMG/M |
| 3300012361|Ga0137360_10305561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1321 | Open in IMG/M |
| 3300012683|Ga0137398_10786065 | Not Available | 664 | Open in IMG/M |
| 3300012903|Ga0157289_10145205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300012929|Ga0137404_10338018 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
| 3300012960|Ga0164301_10794985 | Not Available | 723 | Open in IMG/M |
| 3300012971|Ga0126369_10436408 | Not Available | 1355 | Open in IMG/M |
| 3300013306|Ga0163162_10535161 | Not Available | 1300 | Open in IMG/M |
| 3300013308|Ga0157375_10362717 | All Organisms → cellular organisms → Bacteria | 1615 | Open in IMG/M |
| 3300015241|Ga0137418_10382955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1152 | Open in IMG/M |
| 3300015371|Ga0132258_10015633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 16259 | Open in IMG/M |
| 3300015371|Ga0132258_12986795 | Not Available | 1173 | Open in IMG/M |
| 3300015373|Ga0132257_101694619 | Not Available | 810 | Open in IMG/M |
| 3300015374|Ga0132255_102728802 | Not Available | 755 | Open in IMG/M |
| 3300016404|Ga0182037_11684824 | Not Available | 565 | Open in IMG/M |
| 3300019886|Ga0193727_1137754 | Not Available | 679 | Open in IMG/M |
| 3300019887|Ga0193729_1023320 | Not Available | 2666 | Open in IMG/M |
| 3300020199|Ga0179592_10425996 | Not Available | 576 | Open in IMG/M |
| 3300022557|Ga0212123_10002010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 51640 | Open in IMG/M |
| 3300024181|Ga0247693_1046723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300024331|Ga0247668_1087731 | Not Available | 629 | Open in IMG/M |
| 3300025910|Ga0207684_10020680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5623 | Open in IMG/M |
| 3300025910|Ga0207684_10143548 | All Organisms → cellular organisms → Bacteria | 2053 | Open in IMG/M |
| 3300025914|Ga0207671_10849868 | Not Available | 723 | Open in IMG/M |
| 3300025915|Ga0207693_10670936 | Not Available | 804 | Open in IMG/M |
| 3300025922|Ga0207646_11103106 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300025936|Ga0207670_10388883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1113 | Open in IMG/M |
| 3300025942|Ga0207689_11599695 | Not Available | 542 | Open in IMG/M |
| 3300025961|Ga0207712_10341219 | Not Available | 1242 | Open in IMG/M |
| 3300026088|Ga0207641_10580494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1096 | Open in IMG/M |
| 3300026089|Ga0207648_10440738 | Not Available | 1185 | Open in IMG/M |
| 3300026324|Ga0209470_1156984 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300026490|Ga0257153_1033492 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300026490|Ga0257153_1085810 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300026514|Ga0257168_1016049 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
| 3300026557|Ga0179587_10024345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3299 | Open in IMG/M |
| 3300027846|Ga0209180_10013810 | All Organisms → cellular organisms → Bacteria | 4213 | Open in IMG/M |
| 3300027862|Ga0209701_10030136 | All Organisms → cellular organisms → Bacteria | 3525 | Open in IMG/M |
| 3300027874|Ga0209465_10049124 | Not Available | 2016 | Open in IMG/M |
| 3300027903|Ga0209488_10885440 | Not Available | 627 | Open in IMG/M |
| 3300028379|Ga0268266_10092981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2646 | Open in IMG/M |
| 3300028379|Ga0268266_10127286 | Not Available | 2274 | Open in IMG/M |
| 3300028381|Ga0268264_10061925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3140 | Open in IMG/M |
| 3300031231|Ga0170824_104862693 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300031231|Ga0170824_111847694 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
| 3300031474|Ga0170818_106721865 | Not Available | 557 | Open in IMG/M |
| 3300031561|Ga0318528_10121296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1382 | Open in IMG/M |
| 3300031720|Ga0307469_11490646 | Not Available | 647 | Open in IMG/M |
| 3300031879|Ga0306919_11053043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300031946|Ga0310910_10169779 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1679 | Open in IMG/M |
| 3300031959|Ga0318530_10183563 | Not Available | 856 | Open in IMG/M |
| 3300032180|Ga0307471_100190321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2038 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.08% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.08% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.72% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.04% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.36% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.36% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.52% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.52% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.52% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.68% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.68% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.84% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_03892150 | 2088090014 | Soil | MGVWKRARVFNWELMFWISSLILAFAAIGALLVYQSYMRAR |
| GPIPI_02333700 | 2088090014 | Soil | MRGWKRAHAFNWELMFGISSLILAFMAVGALLVYESFMRAR |
| GPIPI_03972440 | 2088090014 | Soil | MGVWKRERAFNWELMFWISSLTLAVLATAALLAYQSFIHAR |
| GPIPI_00896620 | 2088090014 | Soil | MGVWKGTRVFNWDLMFWISSLILAFTAIGAFLTYYSFLSAR |
| INPhiseqgaiiFebDRAFT_1014958403 | 3300000364 | Soil | MGVWKQARVFNWELAFWITSLVLAFMAIGALLAYHSFLHA* |
| INPhiseqgaiiFebDRAFT_1019396314 | 3300000364 | Soil | MGAWKRARVFNWDLMFGISCLILAFFAVAALAAYQSFLLAR* |
| F14TC_1000405585 | 3300000559 | Soil | MRGWKRAHAFNWELMFGISSLILAFMAVGALLVYESFMRAR* |
| JGI1027J12803_1001071476 | 3300000955 | Soil | MGVWKRERAFNWELMFWISSLTLAVLATAALLAYQSFIHAR* |
| F14TB_1041298722 | 3300001431 | Soil | LRGWKRAHAFNWELMFGISSLILAFMAVGALLVYESFMRAR* |
| Ga0062589_1001608411 | 3300004156 | Soil | MGVWKGTRVFNWDLMFWISSLILAFMGMGALLAYQNFLSAR* |
| Ga0062595_1014674652 | 3300004479 | Soil | MGVWKRVRVFNWELMFGISFLILAFFAVGALLAYHSFLSAR* |
| Ga0062595_1016881092 | 3300004479 | Soil | MGEWKRARVFNWELMLGISFLVLGFAAMGALLAYHSFVHAR* |
| Ga0066395_100034243 | 3300004633 | Tropical Forest Soil | MGVWKRARAFNWELAFWISALVLAFITIGALLTYQSYGLAGR* |
| Ga0070690_1016773201 | 3300005330 | Switchgrass Rhizosphere | MGVWKRARVFNWELAFWISSLVLAFMAIGALLAYQSFLHA* |
| Ga0066388_1000903931 | 3300005332 | Tropical Forest Soil | MGVWKRQRVFNWELMFGISALVLAFIAMGALLAYRGFVSAGR* |
| Ga0066388_1001625693 | 3300005332 | Tropical Forest Soil | MGVWKRDRVVNWELMFWISSLILAFLAMGALLAYQSFILAR* |
| Ga0066388_1003918433 | 3300005332 | Tropical Forest Soil | MGVWKRERVFNWELMFGISGLVLAFMVMGALLTYHGFVSAGR* |
| Ga0066388_1012518112 | 3300005332 | Tropical Forest Soil | MGVWKRERVFNWELVFGISGLVLAFMAMGALLAYKGFVSAGR* |
| Ga0066388_1018646582 | 3300005332 | Tropical Forest Soil | MGVWKRARVFNWELAFWISALVLAFITIGALLTYQSYGLAGR* |
| Ga0070667_1010001442 | 3300005367 | Switchgrass Rhizosphere | VSMGVWKRARVFNWELAFWISSLVLAFMAIGALLAYQSFLHA* |
| Ga0070705_1011226431 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRWKRARVFNWELMLKISSLILGFMALGALLIYESFIQAQ* |
| Ga0070685_100941573 | 3300005466 | Switchgrass Rhizosphere | MLHEAGREVTMGVWKGTRVFNWDLMFWIFSFILAFVGLGAFLAYQSFLSAR* |
| Ga0070706_1001164232 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRWKRAHVFNWELMFKISSLILVFMALGALLIYESFMQAQ* |
| Ga0070707_1000254744 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRWKRAHVFNWELMFKISSLILGFMALGALLIYESFMQAQ* |
| Ga0070699_1002490032 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MRGWKRVHVFNWELMFTISSLVLAFMAVGALLIYESFVRAR* |
| Ga0073909_100100204 | 3300005526 | Surface Soil | MGVWKRERVFNWELMFWISSLILAFMAIGALLAYLSFIRAR* |
| Ga0073909_104132882 | 3300005526 | Surface Soil | MSGNGRRVFNWELIFWISCLTLGFMAIGALAIYQSYVHAQ* |
| Ga0068853_1001995863 | 3300005539 | Corn Rhizosphere | MGVWKGTRVFNWDLMFWIFSLILAFVGLGVFLAYQSFLSAR* |
| Ga0070665_1000509001 | 3300005548 | Switchgrass Rhizosphere | AEAGREAGMGEWKRARVFNWELMLGISFLVLGFAAMGALLAYHSFVHAR* |
| Ga0070665_1001805643 | 3300005548 | Switchgrass Rhizosphere | MLHEAGREVTMGVWKGTRVFNWDLMFWIFSLILAFVGLGVFLAYQSFLSAR* |
| Ga0070665_1022362861 | 3300005548 | Switchgrass Rhizosphere | MGVWKRARVFNWELMFWISSLTLAILTTGALLAYQSFIRAR* |
| Ga0066701_103043782 | 3300005552 | Soil | MRGWKRARVFNWELMFGISSLILAFMAVGALLIYESFMRAR* |
| Ga0066700_100448791 | 3300005559 | Soil | MKRWKRAHVFNWELMFKISSLILGFMALGALLIYESFMQAQ* |
| Ga0066691_107738371 | 3300005586 | Soil | MKRWKRAHVFNWELMFKISSLILAFMALGALLIYESFMQAQ* |
| Ga0066903_1005228363 | 3300005764 | Tropical Forest Soil | MGVWKRQRVFNWELVFGISGLVLAFMAIGALLAYQGFLSAGR* |
| Ga0066903_1032701162 | 3300005764 | Tropical Forest Soil | MGVWKRARVFNWELVFWISSLILAFLAIGALLAYQSFMRAR* |
| Ga0068858_1024341412 | 3300005842 | Switchgrass Rhizosphere | MGVWKRVRVFNWELMFWISSLILGFMAIGALLAYQSFMRAR* |
| Ga0068860_1008994612 | 3300005843 | Switchgrass Rhizosphere | MGVWKRARVFNWELMFGVSFLVLAFAAMGALLAYHSFVHAR* |
| Ga0066651_104831532 | 3300006031 | Soil | MRRWKRAHVFNWELMFKISSLILGFVALGALLIYESFIQAQ* |
| Ga0070715_100702243 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVWKRERVFNWELMFWISSVILAFMAIGALLAYLSFIRAR* |
| Ga0070716_1001314512 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVWKRTRVFNWDLMFWISSLILAFTAIGAFLTYYSFPSAR* |
| Ga0070712_1008427712 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVWKRARVFNWELMFWISSLILAFMVMAALLAYQSFMSAR* |
| Ga0070712_1008883371 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSARGRRLFKWELIFGISSLILGFMVIGALLTYASFVHAR* |
| Ga0097621_1000235132 | 3300006237 | Miscanthus Rhizosphere | MGVWKRIRVFNWELMFGISFLILAFIAMGALLAYHSFLHAR* |
| Ga0075425_10002869713 | 3300006854 | Populus Rhizosphere | MGVWKRARVFNWELMFWISSLILAFFAIGALLAYQSFLRAR* |
| Ga0075425_1006993572 | 3300006854 | Populus Rhizosphere | MGRWKRARVFNWELLFKISSLILGFMAVGALLIYDSYINAR* |
| Ga0075425_1016867482 | 3300006854 | Populus Rhizosphere | MGVWRPVYVFNWELALGISALVLAFIAVAVFLTYQSYLPG* |
| Ga0075434_1002136923 | 3300006871 | Populus Rhizosphere | MGVWKRARVFNWELMFWISSLVLAFMGVGAMLAYQSFLRAR* |
| Ga0075436_1012997941 | 3300006914 | Populus Rhizosphere | MGVWKRARVFNWELTFWISALILGFMAIGALLAYQSFLRAR* |
| Ga0075435_1010991521 | 3300007076 | Populus Rhizosphere | MGVWKRARVFNWELMFGISFLVLAFVAMGTLLAYHSFLHAR* |
| Ga0099829_100170473 | 3300009038 | Vadose Zone Soil | MGSWKRARVFNWELMFGISSLIFAFMAAGALLVYETFMRAR* |
| Ga0099829_102119252 | 3300009038 | Vadose Zone Soil | MRRWKRAHVFNWELMFGISFLILGFMAVGALLIYESAP* |
| Ga0105247_102589571 | 3300009101 | Switchgrass Rhizosphere | MGVWKRARVFNWELMFGVSFLVLAFAAMGALLAYHSFVHAR |
| Ga0126374_100918291 | 3300009792 | Tropical Forest Soil | VSRRKGEVSMGVWKRAPAFNWELMFWISCLIMAFLGTGALLAYRGFLSAR* |
| Ga0126380_115954241 | 3300010043 | Tropical Forest Soil | MGEWKRARVFNWELTFGISFLVLSLMAMGALLAYHGFITAR* |
| Ga0126384_109697881 | 3300010046 | Tropical Forest Soil | MGVWKRDRVFNWELLVGISALTLAFLIFAAVLTYHGYTVAGRYR* |
| Ga0126382_103397302 | 3300010047 | Tropical Forest Soil | MGVWKRQRVFNWELMFGISALVLAFIAVGALLAYRGFVSAGR* |
| Ga0126370_113263721 | 3300010358 | Tropical Forest Soil | MGGWKRHRVFNWELVFGISGLVLAFMVVGALLAYQS |
| Ga0126376_107946862 | 3300010359 | Tropical Forest Soil | MGVWKRQRVFNWELMFGISALVLAFIAMGALLAYRGFV* |
| Ga0126377_133593301 | 3300010362 | Tropical Forest Soil | RAAKHYLSRRKGEVSMGVWKRAPAFNWELMFWVSCLVLAFLGTGALLAYRGFLSAR* |
| Ga0126379_105211962 | 3300010366 | Tropical Forest Soil | MGVWKRERVFNWELLFGISALTLAFIAMGALLAYHGFVSAGR* |
| Ga0134122_110610222 | 3300010400 | Terrestrial Soil | MGVWKRARVFNWELAFWISSLILAFMAMGALLAYHSFVHA* |
| Ga0137391_108816001 | 3300011270 | Vadose Zone Soil | LQKTGREVRMGSWKRARVFNWELMFGISSLIFAFMAAGALLIYESFMRAR* |
| Ga0137393_102315701 | 3300011271 | Vadose Zone Soil | KTGREVRMGSWKRARVFNWELMFGISSLIFAFMAAGALLVYETFMRAR* |
| Ga0137363_109132972 | 3300012202 | Vadose Zone Soil | MGSWKRARVFNWELMFGISSLIFAFMAAGALLIYESFMRAR* |
| Ga0137362_100633761 | 3300012205 | Vadose Zone Soil | MKRWKRAHVFNWELMFKISSLILGFMALGALLIYESFIQAQ* |
| Ga0137362_106274941 | 3300012205 | Vadose Zone Soil | MGVWKRARVFNWELMFWISSLILAFMAGGALLAYQSFMRAR* |
| Ga0137379_108611732 | 3300012209 | Vadose Zone Soil | WKRAHAFNWELMFKISSLILGFMALGALLIYESFIQAQ* |
| Ga0137360_103055612 | 3300012361 | Vadose Zone Soil | MGVWKRARVFNWELTFWISSLILAFMAGGALLAYQSFMRAR* |
| Ga0137398_107860651 | 3300012683 | Vadose Zone Soil | RARVFNWELMFGISSLIFAFMAAGALLIYESFMRAR* |
| Ga0157289_101452051 | 3300012903 | Soil | MGVWKRARVFNWELAFWISSLVLAFMAMGALLAYHSFVHA* |
| Ga0137404_103380181 | 3300012929 | Vadose Zone Soil | MGVWKRARVFNWELMFWISSLILAFMAGGALLAYQSFMRTR* |
| Ga0164301_107949851 | 3300012960 | Soil | MGVWKRERVFNWELMFWISSLILAFVAIGALLAYLSFIRAR* |
| Ga0126369_104364082 | 3300012971 | Tropical Forest Soil | MGAWKRQRVFNWELVFGIFGLVLGFVAVGALLAYQSFLSAGR |
| Ga0163162_105351612 | 3300013306 | Switchgrass Rhizosphere | MLHEAGREVTMGAWKGTRVFNWDLMFWIFSLILAFVGLGVFLAYQSFLSAR* |
| Ga0157375_103627172 | 3300013308 | Miscanthus Rhizosphere | RVFNWELMFGISFLILAFFAVGALLAYHSFLSAR* |
| Ga0137418_103829551 | 3300015241 | Vadose Zone Soil | MRGWKRARVFNWELMFGISSLIFAFMAAAALLIYESFMRAR* |
| Ga0132258_1001563321 | 3300015371 | Arabidopsis Rhizosphere | MGVWKRAGAFNWELLLCISSLIWALVAMGALLTYHSFVHAR* |
| Ga0132258_129867951 | 3300015371 | Arabidopsis Rhizosphere | MGAWKRARVFNWELMFWISSLILAFLAVGALLAYQSFLRAR* |
| Ga0132257_1016946191 | 3300015373 | Arabidopsis Rhizosphere | MGAWKRARVFNWDLVVWISCLVLAIFAVAALAAYQSFLS |
| Ga0132255_1027288022 | 3300015374 | Arabidopsis Rhizosphere | MGVWKRIRVFNWELMFGISFLILAFIAMGALLAYH |
| Ga0182037_116848241 | 3300016404 | Soil | GMGVWKRQRVFNWELVFGIFGLVLAFVAMGALLAYQGFISAGR |
| Ga0193727_11377542 | 3300019886 | Soil | MGVWKRARVLNWELMFWISSLILVFMAGGALLAYQSFIRAR |
| Ga0193729_10233203 | 3300019887 | Soil | MGVWKRARVLNWELTFWISSLILAFMAGGALLAYQSFIRAR |
| Ga0179592_104259961 | 3300020199 | Vadose Zone Soil | KTGREVRMGSWKRARVFNWELMFGISSLIFAFMAAGALLIYESFMRAR |
| Ga0212123_100020101 | 3300022557 | Iron-Sulfur Acid Spring | MGGWKRARVFNWELMFGISSLVLAFMAVGALLIYASFMRAR |
| Ga0247693_10467232 | 3300024181 | Soil | MGAWKRARVFNWELMFGISGLILAFFAVGALLAYHSFSSAR |
| Ga0247668_10877311 | 3300024331 | Soil | KRARVFNWELMFGVSFLVLAFAAMGALLAYHSFVHAR |
| Ga0207684_100206802 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRWKRAHVFNWELMFKISSLILGFMALGALLIYESFMQAQ |
| Ga0207684_101435483 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRWKRAHVFNWELMFKISSLILVFMALGALLIYESFMQAQ |
| Ga0207671_108498682 | 3300025914 | Corn Rhizosphere | MGVWKRVRVFNWELMFGISFLILAFFAVGALLAYHSFLSAR |
| Ga0207693_106709362 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVWKRARVFNWELMFWISSLILAFMVMAALLAYQSFMSAR |
| Ga0207646_111031061 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSWKRAQVFNGELMFKISSLILGFMAVGAILIYESFIRAR |
| Ga0207670_103888831 | 3300025936 | Switchgrass Rhizosphere | MGVWKRVRVFNWELMFGVSFLVLAFAAMGALLAYHSF |
| Ga0207689_115996951 | 3300025942 | Miscanthus Rhizosphere | MGEWKRARVFNWELMLGISFLVLGFAAMGALLAYHSFVHAR |
| Ga0207712_103412191 | 3300025961 | Switchgrass Rhizosphere | MLHEAGREVTMGVWKGTRVFNWDLMFWIFSLILAFVGLGAFLAYQSFLSAR |
| Ga0207641_105804941 | 3300026088 | Switchgrass Rhizosphere | MGVWKRVRVFNWELMFWISSLTLAILTTGALLAYQSFIRAR |
| Ga0207648_104407383 | 3300026089 | Miscanthus Rhizosphere | MGVWKRARVFNWELAFWISSLILAFMAMGALLAYRSFLQA |
| Ga0209470_11569842 | 3300026324 | Soil | MKRWKRAHVFNWELMFKISSLILGFMALGALLIYESFMQAQ |
| Ga0257153_10334923 | 3300026490 | Soil | MGVWKRARVFNWELMFWISSLILAFMAVGALLAYQSFMRAR |
| Ga0257153_10858102 | 3300026490 | Soil | MGVWKRARVFNWELMFWISSLILAFMAEGALLAYQSFMRAR |
| Ga0257168_10160491 | 3300026514 | Soil | MGSWKRARVFNWELMFGISSLIFAFMAAGALLVYE |
| Ga0179587_100243452 | 3300026557 | Vadose Zone Soil | MGSWKRARVFNWELMFGISSLIFAFMAAGALLIYESFMRAR |
| Ga0209180_100138105 | 3300027846 | Vadose Zone Soil | MGSWKRARVFNWELMFGISSLIFAFMAAGALLVYETFMRAR |
| Ga0209701_100301363 | 3300027862 | Vadose Zone Soil | MRRWKRAHVFNWELMFGISFLILGFMAVGALLIYESAP |
| Ga0209465_100491241 | 3300027874 | Tropical Forest Soil | MGVWKRARAFNWELAFWISALVLAFITIGALLTYQSYGLAGR |
| Ga0209488_108854401 | 3300027903 | Vadose Zone Soil | MGSWKRARVFNWELMFWISSLILAFMAGGALLAYQSFMRAR |
| Ga0268266_100929815 | 3300028379 | Switchgrass Rhizosphere | MLHEAGREVTMGVWKGTRVFNWDLMFWIFSFILAFVGLGAFLAYQSFLSAR |
| Ga0268266_101272862 | 3300028379 | Switchgrass Rhizosphere | MLHEAGREVTMGAWKGTRVFNWDLMFWIFSLILAFVGLGVFLAYQSFLSAR |
| Ga0268264_100619255 | 3300028381 | Switchgrass Rhizosphere | MGVWKRARVFNWELMFWISSLTLAILTTGALLAYQ |
| Ga0170824_1048626931 | 3300031231 | Forest Soil | EAGWEVGMGVWKRARVFNWELMFWISSLILAFMAGGALLAYQSFLRAR |
| Ga0170824_1118476941 | 3300031231 | Forest Soil | MGVWKRARVFNWELMFWISSVILAFMAVGALLAYQSFMRAR |
| Ga0170818_1067218652 | 3300031474 | Forest Soil | ARVFNWELMFWISSVILAFMAVGALLAYQSFMRAR |
| Ga0318528_101212961 | 3300031561 | Soil | MGAWKRQRVFNWELVFGIFGLVLAFVAMGALLAYQ |
| Ga0307469_114906462 | 3300031720 | Hardwood Forest Soil | MGLWKRASVFNWELMFWISSLILAFMAIGAVLVYQTYMRAR |
| Ga0306919_110530432 | 3300031879 | Soil | MGAWKRQRVFNWELVFGIFGLVLAFVAMGALLAYQGFISA |
| Ga0310910_101697792 | 3300031946 | Soil | MGAWKRQRVFNWELVFGIFGLVLAFVAMGALLAYQGFISAGR |
| Ga0318530_101835631 | 3300031959 | Soil | GMGAWKRQRVFNWELVFGIFGLVLAFVAMGALLAYQGFISAGR |
| Ga0307471_1001903212 | 3300032180 | Hardwood Forest Soil | MGVWKRVRVFNWELVFWISSLILAFMAIGALLAYQSFMRAR |
| ⦗Top⦘ |