


| Basic Information | |
|---|---|
| Family ID | F075384 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MSKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKIAPMKQF |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 87.39 % |
| % of genes near scaffold ends (potentially truncated) | 15.13 % |
| % of genes from short scaffolds (< 2000 bps) | 81.51 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.25 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.908 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.126 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.529 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (37.815 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.27% β-sheet: 0.00% Coil/Unstructured: 88.73% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF00486 | Trans_reg_C | 12.61 |
| PF13185 | GAF_2 | 10.08 |
| PF13191 | AAA_16 | 6.72 |
| PF13492 | GAF_3 | 6.72 |
| PF03704 | BTAD | 5.04 |
| PF01590 | GAF | 3.36 |
| PF16576 | HlyD_D23 | 2.52 |
| PF02163 | Peptidase_M50 | 0.84 |
| PF07995 | GSDH | 0.84 |
| PF07885 | Ion_trans_2 | 0.84 |
| PF13533 | Biotin_lipoyl_2 | 0.84 |
| PF06240 | COXG | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 5.04 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 5.04 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.84 |
| COG3427 | Carbon monoxide dehydrogenase subunit CoxG | Energy production and conversion [C] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.91 % |
| Unclassified | root | N/A | 31.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps__Contig_192030 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1322 | Open in IMG/M |
| 3300000890|JGI11643J12802_11088671 | Not Available | 581 | Open in IMG/M |
| 3300003267|soilL1_10006649 | All Organisms → cellular organisms → Bacteria | 12277 | Open in IMG/M |
| 3300003319|soilL2_10230403 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 2226 | Open in IMG/M |
| 3300003324|soilH2_10090600 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 5152 | Open in IMG/M |
| 3300004156|Ga0062589_101396488 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300004479|Ga0062595_100001144 | All Organisms → cellular organisms → Bacteria | 5731 | Open in IMG/M |
| 3300004643|Ga0062591_100117442 | All Organisms → cellular organisms → Bacteria | 1769 | Open in IMG/M |
| 3300004780|Ga0062378_10006400 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1884 | Open in IMG/M |
| 3300005175|Ga0066673_10170254 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300005178|Ga0066688_10678446 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300005332|Ga0066388_100310773 | All Organisms → cellular organisms → Bacteria | 2222 | Open in IMG/M |
| 3300005332|Ga0066388_100647010 | All Organisms → cellular organisms → Bacteria | 1672 | Open in IMG/M |
| 3300005439|Ga0070711_100392258 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300005444|Ga0070694_101071021 | Not Available | 671 | Open in IMG/M |
| 3300005445|Ga0070708_101064959 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300005445|Ga0070708_101234863 | Not Available | 699 | Open in IMG/M |
| 3300005467|Ga0070706_100338207 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
| 3300005468|Ga0070707_101427643 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 659 | Open in IMG/M |
| 3300005468|Ga0070707_101921406 | Not Available | 559 | Open in IMG/M |
| 3300005536|Ga0070697_101291636 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 651 | Open in IMG/M |
| 3300005577|Ga0068857_101882327 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300005617|Ga0068859_103141233 | Not Available | 503 | Open in IMG/M |
| 3300005764|Ga0066903_107146004 | Not Available | 578 | Open in IMG/M |
| 3300005833|Ga0074472_10250547 | Not Available | 655 | Open in IMG/M |
| 3300005873|Ga0075287_1042439 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 612 | Open in IMG/M |
| 3300005884|Ga0075291_1003082 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 1785 | Open in IMG/M |
| 3300005893|Ga0075278_1037652 | Not Available | 704 | Open in IMG/M |
| 3300006163|Ga0070715_10089685 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1412 | Open in IMG/M |
| 3300006175|Ga0070712_100514651 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300006755|Ga0079222_10049947 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 1936 | Open in IMG/M |
| 3300006755|Ga0079222_10092255 | All Organisms → cellular organisms → Bacteria | 1565 | Open in IMG/M |
| 3300006804|Ga0079221_11226867 | Not Available | 584 | Open in IMG/M |
| 3300006845|Ga0075421_100310090 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 1916 | Open in IMG/M |
| 3300006847|Ga0075431_100191390 | All Organisms → cellular organisms → Bacteria | 2096 | Open in IMG/M |
| 3300006852|Ga0075433_10022679 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 5273 | Open in IMG/M |
| 3300006852|Ga0075433_10452906 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300006854|Ga0075425_102836635 | Not Available | 533 | Open in IMG/M |
| 3300006904|Ga0075424_100197953 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2134 | Open in IMG/M |
| 3300006904|Ga0075424_101785332 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300006914|Ga0075436_100101095 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 2008 | Open in IMG/M |
| 3300006954|Ga0079219_12257272 | Not Available | 525 | Open in IMG/M |
| 3300009143|Ga0099792_10358937 | Not Available | 881 | Open in IMG/M |
| 3300009147|Ga0114129_12500871 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 617 | Open in IMG/M |
| 3300009162|Ga0075423_11269710 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 787 | Open in IMG/M |
| 3300009840|Ga0126313_11024964 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 676 | Open in IMG/M |
| 3300010040|Ga0126308_10209931 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1254 | Open in IMG/M |
| 3300010045|Ga0126311_11435343 | Not Available | 577 | Open in IMG/M |
| 3300010166|Ga0126306_11436447 | Not Available | 571 | Open in IMG/M |
| 3300012212|Ga0150985_103103235 | Not Available | 534 | Open in IMG/M |
| 3300012212|Ga0150985_108153382 | Not Available | 514 | Open in IMG/M |
| 3300012212|Ga0150985_116758372 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 609 | Open in IMG/M |
| 3300012212|Ga0150985_121948300 | Not Available | 501 | Open in IMG/M |
| 3300012362|Ga0137361_10499495 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1117 | Open in IMG/M |
| 3300012917|Ga0137395_10085334 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2069 | Open in IMG/M |
| 3300012922|Ga0137394_10835196 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 771 | Open in IMG/M |
| 3300012923|Ga0137359_10482786 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1094 | Open in IMG/M |
| 3300012929|Ga0137404_11048561 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 747 | Open in IMG/M |
| 3300012957|Ga0164303_10047341 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1884 | Open in IMG/M |
| 3300012958|Ga0164299_10331927 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 949 | Open in IMG/M |
| 3300012960|Ga0164301_10108840 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1610 | Open in IMG/M |
| 3300012960|Ga0164301_10579477 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 824 | Open in IMG/M |
| 3300012985|Ga0164308_10405432 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1116 | Open in IMG/M |
| 3300012986|Ga0164304_10005298 | All Organisms → cellular organisms → Bacteria | 5195 | Open in IMG/M |
| 3300012988|Ga0164306_10072825 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 2159 | Open in IMG/M |
| 3300012989|Ga0164305_10436325 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1013 | Open in IMG/M |
| 3300012989|Ga0164305_10622301 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 871 | Open in IMG/M |
| 3300013308|Ga0157375_12928467 | Not Available | 570 | Open in IMG/M |
| 3300014314|Ga0075316_1211973 | Not Available | 515 | Open in IMG/M |
| 3300015264|Ga0137403_10773301 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 817 | Open in IMG/M |
| 3300015371|Ga0132258_13353382 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1101 | Open in IMG/M |
| 3300015373|Ga0132257_101809216 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 785 | Open in IMG/M |
| 3300015373|Ga0132257_103594911 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 564 | Open in IMG/M |
| 3300015374|Ga0132255_100278332 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 2401 | Open in IMG/M |
| 3300018466|Ga0190268_10720640 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 737 | Open in IMG/M |
| 3300018482|Ga0066669_10126679 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1831 | Open in IMG/M |
| 3300019269|Ga0184644_1617201 | Not Available | 525 | Open in IMG/M |
| 3300019877|Ga0193722_1011775 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2231 | Open in IMG/M |
| 3300020068|Ga0184649_1526131 | Not Available | 522 | Open in IMG/M |
| 3300021445|Ga0182009_10183018 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1012 | Open in IMG/M |
| 3300022756|Ga0222622_11270055 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 542 | Open in IMG/M |
| 3300025906|Ga0207699_11437592 | Not Available | 510 | Open in IMG/M |
| 3300025910|Ga0207684_11101488 | Not Available | 661 | Open in IMG/M |
| 3300025993|Ga0208415_1018622 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 668 | Open in IMG/M |
| 3300026040|Ga0208144_1031514 | Not Available | 585 | Open in IMG/M |
| 3300026041|Ga0207639_10712523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 931 | Open in IMG/M |
| 3300026088|Ga0207641_10147789 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2126 | Open in IMG/M |
| 3300027716|Ga0209682_10008261 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2654 | Open in IMG/M |
| 3300027765|Ga0209073_10169344 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 816 | Open in IMG/M |
| 3300027775|Ga0209177_10302614 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 610 | Open in IMG/M |
| 3300027787|Ga0209074_10014976 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2002 | Open in IMG/M |
| 3300027840|Ga0209683_10235407 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 842 | Open in IMG/M |
| 3300027903|Ga0209488_11137985 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 530 | Open in IMG/M |
| 3300028812|Ga0247825_10165393 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1521 | Open in IMG/M |
| 3300028824|Ga0307310_10554670 | Not Available | 583 | Open in IMG/M |
| 3300030336|Ga0247826_11097875 | Not Available | 635 | Open in IMG/M |
| 3300030336|Ga0247826_11100303 | Not Available | 634 | Open in IMG/M |
| 3300030988|Ga0308183_1203033 | Not Available | 517 | Open in IMG/M |
| 3300030993|Ga0308190_1129823 | Not Available | 581 | Open in IMG/M |
| 3300031058|Ga0308189_10518582 | Not Available | 516 | Open in IMG/M |
| 3300031114|Ga0308187_10491742 | Not Available | 503 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1095840 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 641 | Open in IMG/M |
| 3300031547|Ga0310887_10538802 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 708 | Open in IMG/M |
| 3300031548|Ga0307408_100517208 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1048 | Open in IMG/M |
| 3300031562|Ga0310886_10797334 | Not Available | 594 | Open in IMG/M |
| 3300031824|Ga0307413_10439534 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1032 | Open in IMG/M |
| 3300031824|Ga0307413_11169006 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 668 | Open in IMG/M |
| 3300031852|Ga0307410_10894731 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 760 | Open in IMG/M |
| 3300031901|Ga0307406_10282433 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1267 | Open in IMG/M |
| 3300031938|Ga0308175_100003057 | All Organisms → cellular organisms → Bacteria | 11543 | Open in IMG/M |
| 3300031938|Ga0308175_100039022 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 4009 | Open in IMG/M |
| 3300031939|Ga0308174_11235926 | Not Available | 638 | Open in IMG/M |
| 3300031965|Ga0326597_10120673 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 3169 | Open in IMG/M |
| 3300031996|Ga0308176_10031852 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 4121 | Open in IMG/M |
| 3300032126|Ga0307415_100022398 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 3898 | Open in IMG/M |
| 3300034099|Ga0373902_148327 | Not Available | 557 | Open in IMG/M |
| 3300034448|Ga0370540_15623 | Not Available | 528 | Open in IMG/M |
| 3300034661|Ga0314782_183475 | Not Available | 533 | Open in IMG/M |
| 3300034664|Ga0314786_177049 | Not Available | 516 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.13% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 9.24% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.40% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 5.88% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 5.04% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.36% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 3.36% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.36% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 3.36% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 2.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.52% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 2.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.52% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.68% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.68% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.84% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.84% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.84% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.84% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300004780 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300005873 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 | Environmental | Open in IMG/M |
| 3300005884 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_302 | Environmental | Open in IMG/M |
| 3300005893 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014314 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2 | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300020068 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025993 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 (SPAdes) | Environmental | Open in IMG/M |
| 3300026040 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027716 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030988 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300034099 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B1A0.3 | Engineered | Open in IMG/M |
| 3300034448 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_115 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034661 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034664 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_03652820 | 2199352024 | Soil | MSKHDEQSRAKTPEQQPKKPVPAKDVELGVEELEEKIAPM |
| JGI11643J12802_110886712 | 3300000890 | Soil | MSKHDEQTKTPEQQPKKPVPAKDVELGVEELEEKIAPMKV* |
| soilL1_100066495 | 3300003267 | Sugarcane Root And Bulk Soil | MSKHDEQSRTKTPEQQPKKPAPSKDVELGVEELEEKISPMKLS* |
| soilL2_102304033 | 3300003319 | Sugarcane Root And Bulk Soil | MSKHDEQSRTKTPEQQPKKPAPSKDVELGVEELEEKISPMKLR* |
| soilH2_100906007 | 3300003324 | Sugarcane Root And Bulk Soil | MSKHDEQSRSKTPEQQPKKPVPAKDVELGVEELEEKIAPMKF* |
| Ga0062589_1013964882 | 3300004156 | Soil | MSKHDEQSRTKTPEQQPKKPVPSKDVELGVEELEEKIAPMKAH* |
| Ga0062595_1000011445 | 3300004479 | Soil | MSKHDEQSRSKTTEQQPKKPVPAKDVELGVEELEEKIAPMKISV* |
| Ga0062591_1001174423 | 3300004643 | Soil | MSKHDEQSRAKTPEQQPKKPVPAKDVELGVEELEEKIAPMKQF* |
| Ga0062378_100064002 | 3300004780 | Wetland Sediment | MSKHDEQSRTKTPEQQPKKPVPSKDVELGVEELEEKVAPMKITR* |
| Ga0066673_101702542 | 3300005175 | Soil | MSKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKIAPMKQF* |
| Ga0066688_106784463 | 3300005178 | Soil | MSKHDEQSKTKTSEQQPKKPVPTKDVELGVEELEEKIAPMQFR* |
| Ga0066388_1003107733 | 3300005332 | Tropical Forest Soil | MSKHDEQTRTKTTEQQPKKPVPAKDVELGVEELEEKIAPMKAI* |
| Ga0066388_1006470102 | 3300005332 | Tropical Forest Soil | MSKHDDQSRSKTTEQQPKKPVPAKDVELGVEELEEKIAPMKVF* |
| Ga0070711_1003922582 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKIAPMKLY* |
| Ga0070694_1010710211 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKHDEQTRTRTPEQQPKKPAPSKDVELGVEELEEKVAPVKFY* |
| Ga0070708_1010649591 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKHDERSQTKTPEQQPKKPVPSKDVELGVEELEEKIAPMKLV* |
| Ga0070708_1012348631 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKHDEQARTKTPEQQPKKPVPAKDVELGVEELEEKIAPMKAF* |
| Ga0070706_1003382072 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKHDERSQTKTPEQQPKKPVPSKDVELGVEELEEKIAPMKMV* |
| Ga0070707_1014276431 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | EMSAIMSKHDERSQTKTPEQQPKKPVPSKDVELGVEELEEKIAPMKLV* |
| Ga0070707_1019214062 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MVKHDEQSRTRTPEQQPKKPVPAKDVELEVEELEEKIAPVKIF* |
| Ga0070697_1012916362 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKHDEQTRTRTPEQQPKKPVPSKDVELGVEELEEKIAPLKPF* |
| Ga0068857_1018823272 | 3300005577 | Corn Rhizosphere | MIKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKIAPMKQF* |
| Ga0068859_1031412332 | 3300005617 | Switchgrass Rhizosphere | MIKHDEQSRTKTTEQQPKKPVPAKDVELGVEELEEKIAPMK |
| Ga0066903_1071460042 | 3300005764 | Tropical Forest Soil | MSKHDEQSRTKTTEQQPKKPAPAQDVELGVEELEEKIAPMKTF* |
| Ga0074472_102505473 | 3300005833 | Sediment (Intertidal) | MSKHDEQSRTRTPQQQPKNPVPSKDVELGVEELEEKVAPMKITR* |
| Ga0075287_10424392 | 3300005873 | Rice Paddy Soil | MSKHDEQSRTKTPEQQPKTPVPSKDVELGVEELEEKIAPMRLK* |
| Ga0075291_10030821 | 3300005884 | Rice Paddy Soil | MSKHDEQSRTKTPEQQPKTPVPSKDVELGVEELEEKIAPMKFN* |
| Ga0075278_10376523 | 3300005893 | Rice Paddy Soil | MSKHDEQSRSKTPEQQPKKPVPSKDVELGVEELEEKVAPMKVR* |
| Ga0070715_100896851 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKHDEQSRTKTPEQQPKKPVPSKDVELGVEELEEKIAPMKLY* |
| Ga0070712_1005146513 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MIKHDEQSRTKTTEQQPKKPVPAKDVELGVEELEEKIAPMKAF* |
| Ga0079222_100499472 | 3300006755 | Agricultural Soil | MSKHDEQSRSKTPEQQPKKPVPAKDVELGVEELEEKIAPMKYF* |
| Ga0079222_100922552 | 3300006755 | Agricultural Soil | MIKHDEQSRSKTTEQQPKKPVPAKDVELGVEELEEKIAPMKAM* |
| Ga0079221_112268673 | 3300006804 | Agricultural Soil | MSKHDEQSRSKTPEQQPKKPVPAKDVELGVEELEEKIAPMKSF* |
| Ga0075421_1003100902 | 3300006845 | Populus Rhizosphere | MSKHDEQSKTRTPEQQPKKQPSKDVELDVQELEEKIAPVKYY* |
| Ga0075431_1001913902 | 3300006847 | Populus Rhizosphere | MSKHDEQSKTRTPEQQPKKQPSKDVELDVQELEEKIAPVKIY* |
| Ga0075433_100226793 | 3300006852 | Populus Rhizosphere | MIKHDEQSRTKTPEQQPKKPVPAKDVELEVEELEEKIAPVKVF* |
| Ga0075433_104529061 | 3300006852 | Populus Rhizosphere | MSKHDEQSRTKTTEQQPKKPVPAKDVELGVEELEEKIAPMK |
| Ga0075425_1028366352 | 3300006854 | Populus Rhizosphere | MIKHDEQSRTKTTEQQPKKPVPAKDVELGVEELEEKIAPMKTF* |
| Ga0075424_1001979532 | 3300006904 | Populus Rhizosphere | AIMIKHDEQSRTKTPEQQPKKPVPAKDVELEVEELEEKIAPVKVF* |
| Ga0075424_1017853322 | 3300006904 | Populus Rhizosphere | MIKHDEQSRTKTPEQQPKKPIPAKDVELGVEELEEKIAPMKQF* |
| Ga0075436_1001010951 | 3300006914 | Populus Rhizosphere | MSKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKIA |
| Ga0079219_122572722 | 3300006954 | Agricultural Soil | MIKHDEQSRSKTTEQQPKKPVPAKDVELGVEELEEKIAPMKSF* |
| Ga0099792_103589372 | 3300009143 | Vadose Zone Soil | MSAIMSKHDERPQTKTPEQQPKKPVPSKDVELGVEELEEKIAPMKFA* |
| Ga0114129_125008711 | 3300009147 | Populus Rhizosphere | MSKHDEQARTKTPEQQPKKPVPAKDVELGVEELEEKIAPMKLA* |
| Ga0075423_112697102 | 3300009162 | Populus Rhizosphere | MIKHDEQSRTKTTEQQPKKPVPAKDVELGVEELEEKIAPLKAF* |
| Ga0126313_110249642 | 3300009840 | Serpentine Soil | MSAIMMKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKVAPLRI* |
| Ga0126308_102099312 | 3300010040 | Serpentine Soil | MSAIMIKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKVAPLRI* |
| Ga0126311_114353432 | 3300010045 | Serpentine Soil | MSKHDEQSRTKTPEQQPKKPATSKDVELGIEELEEKIAPMKAL* |
| Ga0126306_114364472 | 3300010166 | Serpentine Soil | MSKHDEQTKTPEQQPKKPVPAKDVELGIEELEEKIAPMKY* |
| Ga0150985_1031032351 | 3300012212 | Avena Fatua Rhizosphere | MTKHDEQSRTKSPEQQPKKPVPAEDVELGVEELEEKIAPMKLVQ* |
| Ga0150985_1081533822 | 3300012212 | Avena Fatua Rhizosphere | MSAIMIKHDEQSRTKTPEQQPKKPVPAKDVELGIEELEEKVAPFRI* |
| Ga0150985_1167583722 | 3300012212 | Avena Fatua Rhizosphere | MSKHDEQSKTRTPEQQPKKQPSKDIELDVQELEEKIAPVKIL* |
| Ga0150985_1219483002 | 3300012212 | Avena Fatua Rhizosphere | MSKHDEQSRTKAPEQQPKKPVPAKDVELGVEELEEKIAPMKLA* |
| Ga0137361_104994952 | 3300012362 | Vadose Zone Soil | MSAIMSKHDERSQAKTPEQQPKKPVPSKDVELGVEELEEKIAPMKFA* |
| Ga0137395_100853343 | 3300012917 | Vadose Zone Soil | MSAIMSKHDERSQTKTPEQQPKKPVPSKDVELGVEELEEKIAPMKFA* |
| Ga0137394_108351962 | 3300012922 | Vadose Zone Soil | MSKHDEQTKTPEQQPKKPVPAKDVELGVQELEEKIAPMSVFK* |
| Ga0137359_104827863 | 3300012923 | Vadose Zone Soil | MSAIMSKHDERSQTKTPEQQPKKAVPSKDVELGVEELEEKIAPMKFA* |
| Ga0137404_110485611 | 3300012929 | Vadose Zone Soil | ETRAIMSKHDEQTRTRTPEQQPKKPVTSKDVELGVEELEEKIAPMKAF* |
| Ga0164303_100473413 | 3300012957 | Soil | MIKHDEQSRTKTTEQQPKKPVPAKDVELDVEELEEKIAPVRF* |
| Ga0164299_103319273 | 3300012958 | Soil | MIKHDEQSRTKTPEQQPKKPVPAKDVELDVEELEETIAPVRF* |
| Ga0164301_101088403 | 3300012960 | Soil | MIKHDEQSRTKTPEQQPKKPVPSKDVELGVEELEEKIAPMKI* |
| Ga0164301_105794773 | 3300012960 | Soil | MIKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEE |
| Ga0164308_104054323 | 3300012985 | Soil | MIKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKIAPMKI* |
| Ga0164304_100052983 | 3300012986 | Soil | MSKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKIAPMKTF* |
| Ga0164306_100728253 | 3300012988 | Soil | MIKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKISPMKI* |
| Ga0164305_104363252 | 3300012989 | Soil | MSKHDEQSRTKTPEQQPKKPVPSKDVELGVEELEEKIAPMKQF* |
| Ga0164305_106223013 | 3300012989 | Soil | MIKHDEQSRTKTPEQQPKKPVPSKDVELGVEELEEKIAPM |
| Ga0157375_129284672 | 3300013308 | Miscanthus Rhizosphere | MIKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKIAPMKAF* |
| Ga0075316_12119732 | 3300014314 | Natural And Restored Wetlands | MSKHDEQSRTKTPEQQPKKPVPSKDVELGVEELEEKIAPMKFNA* |
| Ga0137403_107733012 | 3300015264 | Vadose Zone Soil | MSKHDERSQTKTPEQQPKKPVSTNDVELGVEELEEKIAPSTLPVKPK* |
| Ga0132258_133533823 | 3300015371 | Arabidopsis Rhizosphere | MSKHDEQTRTKTTEQQPKKPAPAKDVELGVEELEEKIAPMKAF* |
| Ga0132257_1018092161 | 3300015373 | Arabidopsis Rhizosphere | MSKHDEQSRAKTPEQQPKKPVPAKDVELGVEELEEKIAPMKSF* |
| Ga0132257_1035949111 | 3300015373 | Arabidopsis Rhizosphere | MSKHDEQSKTRTPEQQPKKQPSKDVELDVQELEEKIAP |
| Ga0132255_1002783322 | 3300015374 | Arabidopsis Rhizosphere | MIKHDEQSRTKTTEQQPKKPVPAKDVELGVEELEEKIAPMKLV* |
| Ga0190268_107206402 | 3300018466 | Soil | MSKHDEQSKTRTPEQQPKKPSKDVELDVQELEEKIAPVKAF |
| Ga0066669_101266792 | 3300018482 | Grasslands Soil | MSKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKIAPMKQF |
| Ga0184644_16172012 | 3300019269 | Groundwater Sediment | MSKHDEQSRTKTPEQQPKKPAPAKDVELGVEELEEKIAPMKAL |
| Ga0193722_10117753 | 3300019877 | Soil | MSKHDDQNRTKAPEQQPKKPVPSKDVELGVEELEEKIAPMKAF |
| Ga0184649_15261312 | 3300020068 | Groundwater Sediment | MSKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKIAPMKAL |
| Ga0182009_101830182 | 3300021445 | Soil | MIKHDEQSRSKTTEQQPKKPVPAKDVELGVEELEEKIAPMKAM |
| Ga0222622_112700552 | 3300022756 | Groundwater Sediment | DEQTKTPEQQPKKPVPAKDVELGIEELEEKIAPMKF |
| Ga0207699_114375921 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | RSKTTEQQPKKPVQAKDVELEVEELEEKIAPMQVKSH |
| Ga0207684_111014882 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MIKHDEQSRTRTPEQQPKKPVPAKDVELGVEELEEKIAPMKMV |
| Ga0208415_10186222 | 3300025993 | Rice Paddy Soil | IMSKHDEQFRTKTPEQQPKKPVPAKDVELGVEELEEKIAPMKFNA |
| Ga0208144_10315142 | 3300026040 | Natural And Restored Wetlands | MSKHDEQSRTKTPEQQPKKPVPSKDVELGVEELEEKIAPMKFNA |
| Ga0207639_107125231 | 3300026041 | Corn Rhizosphere | MSKHDEQSRTKTPEQQPKKPVPSKDVELGVEELEEKIAPMKAH |
| Ga0207641_101477892 | 3300026088 | Switchgrass Rhizosphere | MIKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKIAPMKQF |
| Ga0209682_100082613 | 3300027716 | Wetland Sediment | MSKHDEQSRTKTPEQQPKKPVPSKDVELGVEELEEKVAPMKITR |
| Ga0209073_101693442 | 3300027765 | Agricultural Soil | MSKHDEQSRSKTPEQQPKKPVPAKDVELGVEELEEKIAPMKYF |
| Ga0209177_103026142 | 3300027775 | Agricultural Soil | MSKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKIAPMKYF |
| Ga0209074_100149762 | 3300027787 | Agricultural Soil | HDEQSRSKTTEQQPKKPVPAKDVELGVEELEEKIAPMKAM |
| Ga0209683_102354073 | 3300027840 | Wetland Sediment | MSKHDEQSRTKTPEQQPKKPVPSKDVELGVEELEEK |
| Ga0209488_111379851 | 3300027903 | Vadose Zone Soil | MSKHDERPQTKTPEQQPKKPVPSKDIELGVEELEEKIAPMKF |
| Ga0247825_101653932 | 3300028812 | Soil | MSKHDEQSRTKTPEQQPKKPATSKDVELGVEELEEKIAPMKAL |
| Ga0307310_105546701 | 3300028824 | Soil | MSKHDEQTKTPEQQPKKPVPAKDVELGIEELEEKIAPVKFV |
| Ga0247826_110978752 | 3300030336 | Soil | MIKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKIAPVKAF |
| Ga0247826_111003033 | 3300030336 | Soil | MSKHDEQSRTKTPEQQPKKPATSKDVELGVEELEEK |
| Ga0308183_12030331 | 3300030988 | Soil | MSKHDEQSKTRTPEQQPKKPVPSKDVELGVEELEEKIAPMKATL |
| Ga0308190_11298232 | 3300030993 | Soil | MSKHDEQTKTPEQQPKKPVPAKDVELGIEELEEKIAPMKF |
| Ga0308189_105185822 | 3300031058 | Soil | MIKHDEQSRTKTPEQQPKKPVPAKDVELGIEELEEKVAPFRI |
| Ga0308187_104917422 | 3300031114 | Soil | MSKQEQTKTPEQQPKKPMPAKDVELGVEELEEKIAPMKAL |
| (restricted) Ga0255311_10958401 | 3300031150 | Sandy Soil | MSKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKISPMKAF |
| Ga0310887_105388021 | 3300031547 | Soil | MIKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKIAPMKTF |
| Ga0307408_1005172083 | 3300031548 | Rhizosphere | MMKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKVAPLRI |
| Ga0310886_107973341 | 3300031562 | Soil | MIKHDEQSRTKTTEQQPKKPVPAKDVELDVEELEEKIAPVRF |
| Ga0307413_104395342 | 3300031824 | Rhizosphere | MSKHDEQSRTKTPEQQPKKPVPADVELGVEELEEKIAPMKAR |
| Ga0307413_111690062 | 3300031824 | Rhizosphere | EQSRTKTPEQQPKKPVPAKDVELGVEELEEKVAPLRI |
| Ga0307410_108947311 | 3300031852 | Rhizosphere | MMKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKIAPMKAR |
| Ga0307406_102824332 | 3300031901 | Rhizosphere | MSKHDEQFRTKTPEQQPKKPVPSKDVELGVEELEEKIAPMKLN |
| Ga0308175_10000305710 | 3300031938 | Soil | MSKHDEQSRSKTTEQQPKKPVPAKDVELGVEELEEKIAPMKAM |
| Ga0308175_1000390223 | 3300031938 | Soil | MSKHDEQSRSKTPEQQPKKPVPSKDVELGVEELEEKVAPMMVR |
| Ga0308174_112359262 | 3300031939 | Soil | MSKHDEQTRTKSTEQQPKKPVPAKDVELGVEELEEKIAPMKAM |
| Ga0326597_101206732 | 3300031965 | Soil | MSKHDEQSRTKTTEQQPKKPVPAKDVELSIEELEEKIAPMKLS |
| Ga0308176_100318522 | 3300031996 | Soil | MSKHDEQSRTKTPEQQPKKPVPSKDVELGVEELEEKVAPMMVR |
| Ga0307415_1000223985 | 3300032126 | Rhizosphere | MIKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKVAPLRI |
| Ga0373902_148327_392_526 | 3300034099 | Sediment Slurry | MSKHGEQSRTKTPEQQPKKPVPAKDVELGVEELEEKISPMKTFI |
| Ga0370540_15623_253_387 | 3300034448 | Soil | MSKHDEQSRTKTPEQQPKKPATSKDVELGVEELEEKIAPMKATL |
| Ga0314782_183475_150_281 | 3300034661 | Soil | MSKHDEQSRTKTPEQQPKKPATSKDVELGVEELEEKVAPVKFY |
| Ga0314786_177049_1_123 | 3300034664 | Soil | MIKHDEQSRTKTPEQQPKKPATSKDVELGVVDLEEKIAPMK |
| ⦗Top⦘ |