


| Basic Information | |
|---|---|
| Family ID | F075361 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MRLVTFEDPVRRSRIGAVTADGSIVDLNSACALYLRDVEHE |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 32.77 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.28 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.672 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.605 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.849 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.580 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.29% β-sheet: 21.74% Coil/Unstructured: 57.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF01321 | Creatinase_N | 14.29 |
| PF01641 | SelR | 10.08 |
| PF04519 | Bactofilin | 5.88 |
| PF04075 | F420H2_quin_red | 5.04 |
| PF01565 | FAD_binding_4 | 4.20 |
| PF03301 | Trp_dioxygenase | 3.36 |
| PF08291 | Peptidase_M15_3 | 2.52 |
| PF00155 | Aminotran_1_2 | 1.68 |
| PF08818 | DUF1801 | 1.68 |
| PF00117 | GATase | 1.68 |
| PF07687 | M20_dimer | 1.68 |
| PF10459 | Peptidase_S46 | 0.84 |
| PF01996 | F420_ligase | 0.84 |
| PF00582 | Usp | 0.84 |
| PF00795 | CN_hydrolase | 0.84 |
| PF01546 | Peptidase_M20 | 0.84 |
| PF12779 | WXXGXW | 0.84 |
| PF00296 | Bac_luciferase | 0.84 |
| PF13450 | NAD_binding_8 | 0.84 |
| PF12704 | MacB_PCD | 0.84 |
| PF01625 | PMSR | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 14.29 |
| COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 10.08 |
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 5.88 |
| COG3483 | Tryptophan 2,3-dioxygenase (vermilion) | Amino acid transport and metabolism [E] | 3.36 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 1.68 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 1.68 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 1.68 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.84 |
| COG1478 | F420-0:Gamma-glutamyl ligase (F420 biosynthesis) | Coenzyme transport and metabolism [H] | 0.84 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.67 % |
| Unclassified | root | N/A | 19.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10712349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300004091|Ga0062387_100065089 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1818 | Open in IMG/M |
| 3300004091|Ga0062387_100075392 | All Organisms → cellular organisms → Bacteria | 1725 | Open in IMG/M |
| 3300005177|Ga0066690_10572983 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300005178|Ga0066688_10247147 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300005332|Ga0066388_104504572 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300005355|Ga0070671_100184591 | All Organisms → cellular organisms → Bacteria | 1767 | Open in IMG/M |
| 3300005366|Ga0070659_100613036 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300005434|Ga0070709_10209257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1386 | Open in IMG/M |
| 3300005468|Ga0070707_100350005 | All Organisms → cellular organisms → Bacteria | 1435 | Open in IMG/M |
| 3300005468|Ga0070707_100923035 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300005541|Ga0070733_10107240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1788 | Open in IMG/M |
| 3300005543|Ga0070672_100210736 | All Organisms → cellular organisms → Bacteria | 1627 | Open in IMG/M |
| 3300005558|Ga0066698_10643896 | Not Available | 708 | Open in IMG/M |
| 3300005559|Ga0066700_11052392 | Not Available | 533 | Open in IMG/M |
| 3300005561|Ga0066699_10074390 | Not Available | 2171 | Open in IMG/M |
| 3300005598|Ga0066706_10323160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1219 | Open in IMG/M |
| 3300005617|Ga0068859_100741683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1071 | Open in IMG/M |
| 3300005712|Ga0070764_10012582 | All Organisms → cellular organisms → Bacteria | 4160 | Open in IMG/M |
| 3300006041|Ga0075023_100079424 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300006163|Ga0070715_10829988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300006173|Ga0070716_100089105 | All Organisms → cellular organisms → Bacteria | 1863 | Open in IMG/M |
| 3300006173|Ga0070716_101313180 | Not Available | 585 | Open in IMG/M |
| 3300006174|Ga0075014_100845440 | Not Available | 544 | Open in IMG/M |
| 3300006354|Ga0075021_10044321 | All Organisms → cellular organisms → Bacteria | 2560 | Open in IMG/M |
| 3300006804|Ga0079221_10175833 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300006871|Ga0075434_101124541 | Not Available | 798 | Open in IMG/M |
| 3300006893|Ga0073928_10424700 | Not Available | 967 | Open in IMG/M |
| 3300007788|Ga0099795_10114993 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300007982|Ga0102924_1018724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 5169 | Open in IMG/M |
| 3300009012|Ga0066710_104880354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300009038|Ga0099829_10520437 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300009137|Ga0066709_103694630 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300010048|Ga0126373_11981968 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300010048|Ga0126373_12963879 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300010362|Ga0126377_10659363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1096 | Open in IMG/M |
| 3300010366|Ga0126379_10542811 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
| 3300010366|Ga0126379_11691033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| 3300010375|Ga0105239_12877004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300010397|Ga0134124_10597236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1081 | Open in IMG/M |
| 3300011269|Ga0137392_10355453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1214 | Open in IMG/M |
| 3300012189|Ga0137388_12045909 | Not Available | 500 | Open in IMG/M |
| 3300012205|Ga0137362_11210229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300012209|Ga0137379_11814434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300012917|Ga0137395_11248501 | Not Available | 517 | Open in IMG/M |
| 3300013296|Ga0157374_11429084 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300014165|Ga0181523_10505248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
| 3300014497|Ga0182008_10351549 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300016294|Ga0182041_10748784 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
| 3300016404|Ga0182037_11034533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300017823|Ga0187818_10083727 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
| 3300017927|Ga0187824_10079561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1038 | Open in IMG/M |
| 3300017943|Ga0187819_10001412 | All Organisms → cellular organisms → Bacteria | 12411 | Open in IMG/M |
| 3300017955|Ga0187817_11006085 | Not Available | 534 | Open in IMG/M |
| 3300017959|Ga0187779_11019836 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300017961|Ga0187778_10066534 | All Organisms → cellular organisms → Bacteria | 2210 | Open in IMG/M |
| 3300018007|Ga0187805_10489798 | Not Available | 576 | Open in IMG/M |
| 3300018037|Ga0187883_10109762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1430 | Open in IMG/M |
| 3300018085|Ga0187772_10067205 | All Organisms → cellular organisms → Bacteria | 2244 | Open in IMG/M |
| 3300018088|Ga0187771_11910107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300018468|Ga0066662_10921480 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300018482|Ga0066669_11311685 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300019789|Ga0137408_1151768 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
| 3300019879|Ga0193723_1077436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 956 | Open in IMG/M |
| 3300019885|Ga0193747_1071019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 859 | Open in IMG/M |
| 3300020581|Ga0210399_10404455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1138 | Open in IMG/M |
| 3300020583|Ga0210401_11064490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300021168|Ga0210406_10356566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1179 | Open in IMG/M |
| 3300021178|Ga0210408_11348561 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300021180|Ga0210396_10305038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1409 | Open in IMG/M |
| 3300021403|Ga0210397_11626475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300021405|Ga0210387_10179237 | All Organisms → cellular organisms → Bacteria | 1829 | Open in IMG/M |
| 3300021406|Ga0210386_10248004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1518 | Open in IMG/M |
| 3300021420|Ga0210394_11438720 | Not Available | 585 | Open in IMG/M |
| 3300021432|Ga0210384_10821692 | Not Available | 828 | Open in IMG/M |
| 3300021433|Ga0210391_11158600 | Not Available | 599 | Open in IMG/M |
| 3300021475|Ga0210392_10122069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1745 | Open in IMG/M |
| 3300021477|Ga0210398_11001260 | Not Available | 667 | Open in IMG/M |
| 3300021560|Ga0126371_12078705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300021560|Ga0126371_12628450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300022557|Ga0212123_10766719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300025155|Ga0209320_10291768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300025320|Ga0209171_10468159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
| 3300025322|Ga0209641_10533666 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300025482|Ga0208715_1096681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300025905|Ga0207685_10643751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300025912|Ga0207707_10262274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1499 | Open in IMG/M |
| 3300025932|Ga0207690_11517065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300025939|Ga0207665_10773066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
| 3300025939|Ga0207665_10839663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300025939|Ga0207665_11566058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300026309|Ga0209055_1233195 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300026318|Ga0209471_1113348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1160 | Open in IMG/M |
| 3300026324|Ga0209470_1383738 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300026331|Ga0209267_1113403 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300027466|Ga0207484_100287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1629 | Open in IMG/M |
| 3300027570|Ga0208043_1096369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 805 | Open in IMG/M |
| 3300027604|Ga0208324_1148777 | Not Available | 638 | Open in IMG/M |
| 3300027842|Ga0209580_10612869 | Not Available | 539 | Open in IMG/M |
| 3300027853|Ga0209274_10695524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300027869|Ga0209579_10448800 | Not Available | 700 | Open in IMG/M |
| 3300027875|Ga0209283_10859489 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300027882|Ga0209590_10845287 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300028807|Ga0307305_10085755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1456 | Open in IMG/M |
| 3300028906|Ga0308309_10721649 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300029701|Ga0222748_1104765 | Not Available | 555 | Open in IMG/M |
| 3300031720|Ga0307469_11652776 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300031720|Ga0307469_11697810 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300031768|Ga0318509_10780768 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300031820|Ga0307473_10594726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 763 | Open in IMG/M |
| 3300031820|Ga0307473_11354867 | Not Available | 534 | Open in IMG/M |
| 3300031879|Ga0306919_11078593 | Not Available | 613 | Open in IMG/M |
| 3300032205|Ga0307472_100025802 | All Organisms → cellular organisms → Bacteria | 3315 | Open in IMG/M |
| 3300032783|Ga0335079_10296387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1766 | Open in IMG/M |
| 3300032783|Ga0335079_11292675 | Not Available | 729 | Open in IMG/M |
| 3300032892|Ga0335081_10833564 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300032893|Ga0335069_11252821 | Not Available | 809 | Open in IMG/M |
| 3300032955|Ga0335076_10588067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 995 | Open in IMG/M |
| 3300033134|Ga0335073_10343136 | All Organisms → cellular organisms → Bacteria | 1772 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.61% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.40% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.40% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.88% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.04% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.20% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.20% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 3.36% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.36% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.36% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.52% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.52% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.68% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.68% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.84% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.84% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.84% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.84% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.84% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.84% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.84% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025155 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4 | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025482 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300027466 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK03-B (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_107123492 | 3300001593 | Forest Soil | MRFITFDDPVRRSRIGALAPDGRIVDLNSACALYLRDVENEGS |
| Ga0062387_1000650894 | 3300004091 | Bog Forest Soil | MRLVTFEDPAQRRRIGAVADDARIVDLRSACALYLREVESESA |
| Ga0062387_1000753925 | 3300004091 | Bog Forest Soil | MRLVTFEDGAQRNRTGAVTDGGRFVDLHSACALYLRDVENE |
| Ga0066690_105729832 | 3300005177 | Soil | MRLVTFENPVRQPRIGALTPSHRIADLNSACAIYLRDVESESAYQRLADA |
| Ga0066688_102471471 | 3300005178 | Soil | MRLVTFEDPVRQSRVGALTTDGRIIDLHSACALYLREVENE |
| Ga0066388_1045045721 | 3300005332 | Tropical Forest Soil | MRLVTFEDPVRRSRIGAVTADGSIVDLNSACALYLRDVEHE |
| Ga0070671_1001845915 | 3300005355 | Switchgrass Rhizosphere | MRLVTFETSAKQSRIGAISADGRVIDLNSACALYLRDVESESA |
| Ga0070659_1006130362 | 3300005366 | Corn Rhizosphere | MRFITFDDPVRRSRIGALAPDGRIVDLNSACALYLRDVENEGAYD |
| Ga0070709_102092571 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLITFYDTVRRSRIGALALDGRIVDLNSACALYLRNVENEGA |
| Ga0070707_1003500053 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLVTFEDPVHQSRIGALTPDGRIVDLHSACALYLRDVEH |
| Ga0070707_1009230351 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLVTFENPVRQARIGALTTDRRIVDLNSACAMYLRDVEGENAHVRLADA |
| Ga0070733_101072403 | 3300005541 | Surface Soil | MRLVTFEDPAQRLRIGAVTDDARFVDLHSACSLYLRDVENESAFERLADALVP |
| Ga0070672_1002107361 | 3300005543 | Miscanthus Rhizosphere | MRLVTFETSAKQSRIGAISADGRVIDLNSACALYL |
| Ga0066698_106438961 | 3300005558 | Soil | MRLVTFEDSVRRSRIGAIDAADRVVDLHSACALYLREVE |
| Ga0066700_110523921 | 3300005559 | Soil | MRLVTFENPGRQARVGALTTDRRIVDLNSACALYLRDVEGENAHDRLAD |
| Ga0066699_100743903 | 3300005561 | Soil | MRLVTFENPVRQACIGALTTDRRIVDLNSACALYLRDVEGE |
| Ga0066706_103231601 | 3300005598 | Soil | MRLVTFEDPTRRSRVGAVTSDGRIADLHTACALYLRDVEAESAFYRLADAM |
| Ga0068859_1007416833 | 3300005617 | Switchgrass Rhizosphere | MRLVTFETSAKQSRIGAISADGRVIDLNSACALYLRDV |
| Ga0070764_100125827 | 3300005712 | Soil | MRLITFEDPAKRTRIGAVTDNGRFVDLHSACALYLRDVENE |
| Ga0075023_1000794243 | 3300006041 | Watersheds | MRLVTYENPVRHSRTGALTSDGRVVDLNSACALYLRDIE |
| Ga0070715_108299881 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLISFLNSARQSRIGAMTTGGRIIDLNSACALYLRDVE |
| Ga0070716_1000891055 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLVTFETSAKQSRIGAISADGRVIDLNSACALYLRDVES |
| Ga0070716_1013131803 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLITFEDSVKRSRIGAVTPDGRIGDLKIVDLNSACALY |
| Ga0075014_1008454402 | 3300006174 | Watersheds | MRLVTFENSVRQPRVGAMTRDGRIVDLNCAAALYLR |
| Ga0075021_100443211 | 3300006354 | Watersheds | MRLITFEDSVRRSRIGALAPDGRIGDLKIVDLNSACALYLRDVEDEGAFKR |
| Ga0079221_101758331 | 3300006804 | Agricultural Soil | MRLVTFENPARESRIGAMAADDRVVDLHSACALYLRDVENESAFYRLAD |
| Ga0075434_1011245413 | 3300006871 | Populus Rhizosphere | MRLVSFEDPARQSRIGAMAADGRIVDLHSACALYLRDVENE |
| Ga0073928_104247001 | 3300006893 | Iron-Sulfur Acid Spring | MRLVTFEDPVRRSRIGGVTDDGRIVDLRSACALYLRDVENESTFERLADA |
| Ga0099795_101149931 | 3300007788 | Vadose Zone Soil | MRFITFDDPVRRSRIGALAPDGRIVDLNTACAVYVRD |
| Ga0102924_10187245 | 3300007982 | Iron-Sulfur Acid Spring | MRLVTFEDAVKRSRVGAVTDDGQIVDLNSACALYLAEVENESAYY |
| Ga0066710_1048803541 | 3300009012 | Grasslands Soil | MRLVTFEDPVRQSRIGAVLNDGRIVDLHSACALYLRDVESEAAFYRIAD |
| Ga0099829_105204372 | 3300009038 | Vadose Zone Soil | MRLVTFEDRSRRSWIGALTPQGLIIDLNTACSLYLRDVEKESAFYRIAEARVPP |
| Ga0066709_1036946301 | 3300009137 | Grasslands Soil | MRLVTFENPVRRPRIGALTPQHRIADLNSACAIYLRDVESES |
| Ga0126373_119819682 | 3300010048 | Tropical Forest Soil | MRLITFENSVRQSRIGSLTRGDRIVDLNSAYALYL |
| Ga0126373_129638792 | 3300010048 | Tropical Forest Soil | MRLVTFENPVRTFRIGALVDNDRIVDLHSACALYLRDAE |
| Ga0126377_106593632 | 3300010362 | Tropical Forest Soil | MKLVTFENASRQSSIGAVTEDGRIVDLHTACALYLRDVENEN |
| Ga0126379_105428111 | 3300010366 | Tropical Forest Soil | MRLVTFENPARQSRIGTMTSEGRVVDLHSACALYLRDVENESAFYRLADAL |
| Ga0126379_116910331 | 3300010366 | Tropical Forest Soil | MKLVTFETASRQSSVGAVTSDGKIIDLHAACALYLRDVENENAFNRLADALVPANM |
| Ga0105239_128770041 | 3300010375 | Corn Rhizosphere | MRFITFDDPVRRSRIGALAPDGRIVDLNSSCALYLRDVENEGAYDRISAALVPPNMRK |
| Ga0134124_105972362 | 3300010397 | Terrestrial Soil | MKLITFEDSVRRSRVGALVADGRILDLNSACALYLREVENESAFDRLADALVPPNMRE |
| Ga0137392_103554533 | 3300011269 | Vadose Zone Soil | MRLITFEDPVRQFRIGALTADGRVVDLHSACALYLRDVENES |
| Ga0137388_120459091 | 3300012189 | Vadose Zone Soil | MRLVTFENPVRQARVGALTTDRRIVDLNSACALYLRDVE |
| Ga0137362_112102292 | 3300012205 | Vadose Zone Soil | MRLVTFENPIRQLRIGALTTDHRIVDLNSACALYLRDVEGE |
| Ga0137379_118144341 | 3300012209 | Vadose Zone Soil | MRLVTFENPVRQARIGALTPDRRIVDLNSACALYLRDVDG |
| Ga0137395_112485011 | 3300012917 | Vadose Zone Soil | MRLVTFEDPVRQSRIGALTPDGRIVDLHSACALYL |
| Ga0157374_114290842 | 3300013296 | Miscanthus Rhizosphere | MRLITFLNSTRQSRIGAMTPESRIVDLNSACALYLRD |
| Ga0181523_105052481 | 3300014165 | Bog | MRLVTFEDGVQRNRIGAVTDDGRSVDLHSACALYLRDVENESAFERLGEALVPSNMLALFEGG |
| Ga0182008_103515492 | 3300014497 | Rhizosphere | MRLITFLNSTRQSRIGAMTPESRIVDLNSACALYLRDIENENAY |
| Ga0182041_107487841 | 3300016294 | Soil | MRLVTFEDSAKNSRVGAVISDGRIVDLNSAAALYLRDVESEGAFYRLA |
| Ga0182037_110345331 | 3300016404 | Soil | MRLVTFENSVCQSRIGAWTHDGRIVDLNSAYALYLRDVRHEGA |
| Ga0187818_100837273 | 3300017823 | Freshwater Sediment | MRLVTFIDPARRSRIGAMAGDETIVDLHSACSLYLRDV |
| Ga0187824_100795611 | 3300017927 | Freshwater Sediment | MRLVSFEDPVRQSRIGALVPDGRIVDLHSACALYLRDVEHESAFYRLAEALVPPN |
| Ga0187819_1000141212 | 3300017943 | Freshwater Sediment | MRLVTFEDPVKRSRIGAVTGDGSIVDLNSACALYLRDVEHEGAFYR |
| Ga0187817_110060851 | 3300017955 | Freshwater Sediment | MRLVTFEDPAKRSRIGAVTNDARIVDLHSACALYLRDVESESAFGRLA |
| Ga0187779_110198362 | 3300017959 | Tropical Peatland | MRLLTFEDPGRRSRIGALTGDDQIVDLNSACALYLRDVEHESAYDRLA |
| Ga0187778_100665343 | 3300017961 | Tropical Peatland | MRLLTFEDPGRRSRIGALTGDDQIVDLNSACALYLRDV |
| Ga0187805_104897982 | 3300018007 | Freshwater Sediment | MRLVTFESGPHQSRIGAISSEYFLDLNFACALYLRDVEHDPAFYRVA |
| Ga0187883_101097623 | 3300018037 | Peatland | MRLVTFEDGVRRNRIGAVTDDGRFVDLHSACALYLRDVENESAFERLAEA |
| Ga0187772_100672055 | 3300018085 | Tropical Peatland | MRLVTFQDPARRLRIGAVAGDSRIIDLNSACALYLREVE |
| Ga0187771_119101072 | 3300018088 | Tropical Peatland | MRLVTFEDPVQRMRIGAVADDGRVVDLNLACALYLQQVEHEGAFYR |
| Ga0066662_109214801 | 3300018468 | Grasslands Soil | MRLVTFETPSAPARIGAVSDNDSILDLNTACALYLRDVEGESAYYRLADALVP |
| Ga0066669_113116851 | 3300018482 | Grasslands Soil | MRLITFLNSTRQSRIGAMTPESRIVDLNSACALYL |
| Ga0137408_11517681 | 3300019789 | Vadose Zone Soil | MRLITFDDPVRRSRIGALATDGRIVDLNTACAVYVRDVENEGAYDRLSGALVPPNMRKLFAG |
| Ga0193723_10774363 | 3300019879 | Soil | MRLVTFENPIRQARIGALTTDHRIVDLNSACALYLRDVEGE |
| Ga0193747_10710191 | 3300019885 | Soil | MRLVTFEDPTRRSRVGAVTSDGRIVDLHTACALYLRDVE |
| Ga0210399_104044552 | 3300020581 | Soil | MRLVTFEDPVHQSRIGAVTADSRIVDLHSACALYLRDVESESAFY |
| Ga0210401_110644902 | 3300020583 | Soil | MRLITFEDSVRRSRIGAPTPDGRIVDLNSACALYLRDV |
| Ga0210406_103565661 | 3300021168 | Soil | MRLVTFEDPVHQSRIGAVTADSRIVDLHSACALYLRDVESESAFYRLADAL |
| Ga0210408_113485611 | 3300021178 | Soil | MRLITFENSVRQSRIGAFTAEDRIVDLNSAYALYLREVRQEG |
| Ga0210396_103050381 | 3300021180 | Soil | MRLVTFEDPARQSCVGAVTPDGRIVDLHTACALYLRDVEAESAFYRLADA |
| Ga0210397_116264752 | 3300021403 | Soil | MRLVTFEDPSKRSRTGAVVKDGRIVDLNSACALYLRDVENESAFYRL |
| Ga0210387_101792371 | 3300021405 | Soil | MRLITFEDPAQRRRIGAVTDDARFVDLHSACSLYLRDVENE |
| Ga0210386_102480041 | 3300021406 | Soil | MRLVTFENSVRQSRIGAFTAQDRIVDLNSAYALYLREVRQE |
| Ga0210394_114387201 | 3300021420 | Soil | MRLVTFEDPAQRRRIGAVTDDARFVDLHSACALYLR |
| Ga0210384_108216922 | 3300021432 | Soil | MRLVTFEDPVQRSRVGAVTDDARIVDLHSACALYLRDVENESASE |
| Ga0210391_111586001 | 3300021433 | Soil | MRLVTFEDPVHRSRIGAVTDDGRIVDLHSAGALYLRDVENENAFERL |
| Ga0210392_101220692 | 3300021475 | Soil | MRLVTFEDPSKRSRTGAVVKDGRIVDLNSACALYLRDVENESAFYRLADAMV |
| Ga0210398_110012601 | 3300021477 | Soil | MRLVTFEDPAQRRRIGAVTDDGRVVDLHSACALYLRDVEN |
| Ga0126371_120787051 | 3300021560 | Tropical Forest Soil | MRLVTFEDSNKNSRVGAVIGDGRIVDLNSAAALYLRDVESEGA |
| Ga0126371_126284501 | 3300021560 | Tropical Forest Soil | MRLITFENSVRQSRIGSLTRDDRIVDLNSAYALYLRE |
| Ga0212123_107667193 | 3300022557 | Iron-Sulfur Acid Spring | MRLVTFEDPARHSRVGAVTPDGRIVDLHTACALYLRDVE |
| Ga0209320_102917681 | 3300025155 | Soil | MRLVTFEDRSHRSRIGALTPDNRIVDLNTAFDSFRKDSEG |
| Ga0209171_104681593 | 3300025320 | Iron-Sulfur Acid Spring | MRLVTFEDPARQSRVGAVTPDGQIVDLHTACALYLRDVEAENAFYRLADALVPHN |
| Ga0209641_105336662 | 3300025322 | Soil | MRLVTFEDSARRSRSGALTPDGRIVDLNTAYALYLRDAEGEPA |
| Ga0208715_10966811 | 3300025482 | Arctic Peat Soil | MRLVTFEDGVRRSRIGALAPDGRIVDLNSACALYLRDVEDEGAFYHLANALVPPNMR |
| Ga0207685_106437511 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLISFLNSARQSRIGAMTTGGRIIDLNSACALYLRDVENEN |
| Ga0207707_102622741 | 3300025912 | Corn Rhizosphere | MRLVTFETSAKQSRIGAISADGRVIDLNSACALYLRDVESESAF |
| Ga0207690_115170652 | 3300025932 | Corn Rhizosphere | MRFITFDDPVRRSRIGALAPDGRIVDLNSACALYLRDVEN |
| Ga0207665_107730664 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLVTFENYVRQPRIGALTADQRIIDLNSAYALYLR |
| Ga0207665_108396631 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLITFEDSVKRSRIGAVTPDGRIGDLKIVDLNSACALYLRD |
| Ga0207665_115660581 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLVTFEDPVHQSRIGAMTADGRIVDLHSACALYLRDV |
| Ga0209055_12331951 | 3300026309 | Soil | MRLVTFEDPVRQARVGALTTDRRIVDLNSACALYLRDVE |
| Ga0209471_11133481 | 3300026318 | Soil | MRLVTFETAAKQSRIGAVTTDERIVDLNLACALYL |
| Ga0209470_13837382 | 3300026324 | Soil | MRLVTFEDSVRRSRIGAIAAEDRVVDLHSACALYLREVEGEAAF |
| Ga0209267_11134031 | 3300026331 | Soil | MRLVTFEDPVRQSRVGALTTDGRIIDLHSACALYLREVEN |
| Ga0207484_1002874 | 3300027466 | Soil | MRLVTFESSAKQSRIGAITANDRIIDLNSACALYLRDVESESAFYRLADA |
| Ga0208043_10963691 | 3300027570 | Peatlands Soil | MRLVTFEDPVRRSRVGAVADDGRIVDLHSACALYLRDVE |
| Ga0208324_11487772 | 3300027604 | Peatlands Soil | MRLVTFEDPAKRSRTGAVTNDARIVDLHSACALYLRD |
| Ga0209580_106128691 | 3300027842 | Surface Soil | MRLVTFEDPAQRRRIGAVTGDARFVDLHSACSLYLRDVE |
| Ga0209274_106955242 | 3300027853 | Soil | MRLVTFEDPVQRTRIGGVTDDGRFVDLHSACALYLRDVENESAFE |
| Ga0209579_104488001 | 3300027869 | Surface Soil | MRLVTFEDTAHRSRIGAVTADNRVIDLNNACALYLREVEDESAFSRLADAL |
| Ga0209283_108594891 | 3300027875 | Vadose Zone Soil | MRLVTFEDPVRQSRIGAMTADGRIVDLHSACALYLRDV |
| Ga0209590_108452872 | 3300027882 | Vadose Zone Soil | MRLVTFENPVRQACIGALTTDRRIVDLNSACALYLRDV |
| Ga0307305_100857552 | 3300028807 | Soil | MRLVTFEDPARQSRVGALTPDGRIVDLHTACALYLRDVESE |
| Ga0308309_107216491 | 3300028906 | Soil | MRLITFEDPVRRSRVGAVTGDEKVVDLNSACALYLREVENESAFYRLADALV |
| Ga0222748_11047651 | 3300029701 | Soil | MRLVTFEDPAQRRRIGAVTDDARFVDLHSACALYLRDVESESAFERLADALFRPTCSLCSRA |
| Ga0307469_116527761 | 3300031720 | Hardwood Forest Soil | MRLVTFENPVRQARIGALTTDRRIVDLNLACAMYLRDVEGENAHVRLADALVPGNMRAL |
| Ga0307469_116978101 | 3300031720 | Hardwood Forest Soil | MRLITFEDPLRRSRGGALAPDGRIVDLNSACALYLRDVDKQSAYSRLSDALV |
| Ga0318509_107807681 | 3300031768 | Soil | MRLLTFEDPGRRSRIGALTAGDQIVDLNSACALYLRDVEHESAYDRLADA |
| Ga0307473_105947262 | 3300031820 | Hardwood Forest Soil | MRLVTFEDPVRQSRIGAMTADGRIVDLHSACALYLRD |
| Ga0307473_113548671 | 3300031820 | Hardwood Forest Soil | MRLVTFEDPGRQSRVGALTADERIVDLHSACALYLRDVEKESAFYRLATA |
| Ga0306919_110785932 | 3300031879 | Soil | MRLVTFEDAVRRTRIGAVLADGRVVDLNSACALYLREVESESAFE |
| Ga0307472_1000258021 | 3300032205 | Hardwood Forest Soil | MRLVTFENPARQSRIGAMTDDGRVVDLHSACALYLRDVENESAFYRLAE |
| Ga0335079_102963871 | 3300032783 | Soil | MRLVTFETNACQLRVGAFAPDGRIVDLSSACALYLQQEKGESAFYRLADALVPSE |
| Ga0335079_112926752 | 3300032783 | Soil | MRLVTFINPAGENRIGARAADNDIVDLNRAAALYLRDVEHEAA |
| Ga0335081_108335641 | 3300032892 | Soil | MRLLTFEDPGRRSRIGALTADDQIVDLNSACALYLREVEHESAYDRLADAL |
| Ga0335069_112528211 | 3300032893 | Soil | MKLVTFEDPVRRSRIGAVTSDGSIVDLHSACALYLRDVEAEAAFYR |
| Ga0335076_105880672 | 3300032955 | Soil | MKLVTFEDAVKRSRIGAVTDDGRIVDLNAACALYLRDVEHEEAFGRLAGAL |
| Ga0335073_103431361 | 3300033134 | Soil | MRLVTFETNACQLRVGAFAPDGRIVDLSSACALYLQQEKGESAFYRLADALVPSEMGAL |
| ⦗Top⦘ |